


| Basic Information | |
|---|---|
| Family ID | F019889 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 227 |
| Average Sequence Length | 45 residues |
| Representative Sequence | HDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Number of Associated Samples | 195 |
| Number of Associated Scaffolds | 227 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.76 % |
| % of genes near scaffold ends (potentially truncated) | 95.59 % |
| % of genes from short scaffolds (< 2000 bps) | 93.39 % |
| Associated GOLD sequencing projects | 188 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.595 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.894 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.872 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.529 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 227 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 10.13 |
| PF09084 | NMT1 | 4.41 |
| PF01042 | Ribonuc_L-PSP | 3.96 |
| PF01494 | FAD_binding_3 | 3.96 |
| PF03992 | ABM | 2.64 |
| PF08448 | PAS_4 | 2.20 |
| PF00106 | adh_short | 1.76 |
| PF13561 | adh_short_C2 | 1.76 |
| PF01717 | Meth_synt_2 | 1.76 |
| PF00005 | ABC_tran | 1.76 |
| PF02129 | Peptidase_S15 | 1.32 |
| PF04828 | GFA | 1.32 |
| PF12071 | DUF3551 | 0.88 |
| PF02698 | DUF218 | 0.88 |
| PF07883 | Cupin_2 | 0.88 |
| PF01039 | Carboxyl_trans | 0.88 |
| PF02515 | CoA_transf_3 | 0.88 |
| PF00120 | Gln-synt_C | 0.44 |
| PF00196 | GerE | 0.44 |
| PF08239 | SH3_3 | 0.44 |
| PF05139 | Erythro_esteras | 0.44 |
| PF02775 | TPP_enzyme_C | 0.44 |
| PF13439 | Glyco_transf_4 | 0.44 |
| PF05598 | DUF772 | 0.44 |
| PF01546 | Peptidase_M20 | 0.44 |
| PF16576 | HlyD_D23 | 0.44 |
| PF01402 | RHH_1 | 0.44 |
| PF13430 | DUF4112 | 0.44 |
| PF07978 | NIPSNAP | 0.44 |
| PF04191 | PEMT | 0.44 |
| PF07238 | PilZ | 0.44 |
| PF02826 | 2-Hacid_dh_C | 0.44 |
| PF02630 | SCO1-SenC | 0.44 |
| PF04909 | Amidohydro_2 | 0.44 |
| PF00296 | Bac_luciferase | 0.44 |
| PF13188 | PAS_8 | 0.44 |
| PF00089 | Trypsin | 0.44 |
| PF00126 | HTH_1 | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 227 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 10.13 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 7.93 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.41 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.41 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 3.96 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 3.96 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 3.96 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 3.96 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.76 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.32 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.88 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.88 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.88 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.88 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.44 |
| COG2312 | Erythromycin esterase homolog | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.59 % |
| Unclassified | root | N/A | 4.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig1192385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
| 2170459023|GZGNO2B01DB4WH | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101691254 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300000559|F14TC_100224214 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10011316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2463 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10076653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 842 | Open in IMG/M |
| 3300000956|JGI10216J12902_104235132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1460 | Open in IMG/M |
| 3300000956|JGI10216J12902_114095074 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300001686|C688J18823_10645137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300001976|JGI24752J21851_1018629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 905 | Open in IMG/M |
| 3300004052|Ga0055490_10263838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300004114|Ga0062593_102268582 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300004114|Ga0062593_103158082 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300004157|Ga0062590_100045061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2394 | Open in IMG/M |
| 3300004633|Ga0066395_10206733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300005177|Ga0066690_10115879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1735 | Open in IMG/M |
| 3300005329|Ga0070683_100296895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1537 | Open in IMG/M |
| 3300005330|Ga0070690_101399091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300005332|Ga0066388_101241934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1278 | Open in IMG/M |
| 3300005344|Ga0070661_100159849 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300005353|Ga0070669_101798080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni | 535 | Open in IMG/M |
| 3300005353|Ga0070669_101929298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300005364|Ga0070673_102249702 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005434|Ga0070709_11650620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300005456|Ga0070678_100036349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3447 | Open in IMG/M |
| 3300005457|Ga0070662_100702206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 856 | Open in IMG/M |
| 3300005518|Ga0070699_100241795 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300005547|Ga0070693_101365204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 550 | Open in IMG/M |
| 3300005548|Ga0070665_100217046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1913 | Open in IMG/M |
| 3300005554|Ga0066661_10505844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
| 3300005577|Ga0068857_101787108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Budviciaceae → Budvicia → Budvicia aquatica | 602 | Open in IMG/M |
| 3300005718|Ga0068866_10239196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300005719|Ga0068861_100653797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 971 | Open in IMG/M |
| 3300005764|Ga0066903_101990884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1115 | Open in IMG/M |
| 3300005764|Ga0066903_107507696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300005764|Ga0066903_108863777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300005841|Ga0068863_100451525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1262 | Open in IMG/M |
| 3300005842|Ga0068858_100660355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1016 | Open in IMG/M |
| 3300005842|Ga0068858_102570725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300006038|Ga0075365_10484101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300006041|Ga0075023_100057754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1236 | Open in IMG/M |
| 3300006173|Ga0070716_100269833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1168 | Open in IMG/M |
| 3300006237|Ga0097621_100702688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 931 | Open in IMG/M |
| 3300006237|Ga0097621_101769368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300006354|Ga0075021_10500816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 769 | Open in IMG/M |
| 3300006579|Ga0074054_11874076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 827 | Open in IMG/M |
| 3300006791|Ga0066653_10771612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300006797|Ga0066659_10553795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 929 | Open in IMG/M |
| 3300006806|Ga0079220_10720466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
| 3300006844|Ga0075428_101221615 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300006854|Ga0075425_100856831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
| 3300006854|Ga0075425_101349475 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300006871|Ga0075434_102637370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300006903|Ga0075426_11155708 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300006904|Ga0075424_100611837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1163 | Open in IMG/M |
| 3300006969|Ga0075419_10390984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
| 3300006969|Ga0075419_10547211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 808 | Open in IMG/M |
| 3300007788|Ga0099795_10186289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 869 | Open in IMG/M |
| 3300009012|Ga0066710_100473730 | Not Available | 1882 | Open in IMG/M |
| 3300009089|Ga0099828_10063509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3104 | Open in IMG/M |
| 3300009092|Ga0105250_10456215 | Not Available | 574 | Open in IMG/M |
| 3300009094|Ga0111539_11833187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
| 3300009098|Ga0105245_10452259 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300009098|Ga0105245_11256314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 789 | Open in IMG/M |
| 3300009100|Ga0075418_10638866 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300009100|Ga0075418_11036340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300009147|Ga0114129_13160972 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300009148|Ga0105243_13103982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300009156|Ga0111538_12787101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300009176|Ga0105242_10838295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 914 | Open in IMG/M |
| 3300009545|Ga0105237_10955006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300009553|Ga0105249_10875048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 965 | Open in IMG/M |
| 3300009792|Ga0126374_10977917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300010037|Ga0126304_10691537 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010043|Ga0126380_10243886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1238 | Open in IMG/M |
| 3300010043|Ga0126380_12291297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 501 | Open in IMG/M |
| 3300010045|Ga0126311_10209073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1427 | Open in IMG/M |
| 3300010048|Ga0126373_10956018 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300010159|Ga0099796_10295334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300010166|Ga0126306_10347937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1151 | Open in IMG/M |
| 3300010358|Ga0126370_10623250 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300010359|Ga0126376_10409231 | Not Available | 1225 | Open in IMG/M |
| 3300010359|Ga0126376_12464101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300010360|Ga0126372_12727060 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300010361|Ga0126378_13082874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300010362|Ga0126377_10262356 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1687 | Open in IMG/M |
| 3300010362|Ga0126377_11775563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Starkeya → Starkeya novella | 692 | Open in IMG/M |
| 3300010373|Ga0134128_12144461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300010373|Ga0134128_13024603 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010375|Ga0105239_10750695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1117 | Open in IMG/M |
| 3300010391|Ga0136847_11618846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300010398|Ga0126383_10902184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300010398|Ga0126383_11208781 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010403|Ga0134123_13313614 | Not Available | 519 | Open in IMG/M |
| 3300011003|Ga0138514_100156119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 508 | Open in IMG/M |
| 3300011270|Ga0137391_10541658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 981 | Open in IMG/M |
| 3300011271|Ga0137393_11086815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300012022|Ga0120191_10165529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300012356|Ga0137371_10033607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3960 | Open in IMG/M |
| 3300012469|Ga0150984_113219216 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012532|Ga0137373_11238026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 524 | Open in IMG/M |
| 3300012685|Ga0137397_10140661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1785 | Open in IMG/M |
| 3300012882|Ga0157304_1084879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300012884|Ga0157300_1043082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300012891|Ga0157305_10288903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300012893|Ga0157284_10330166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300012900|Ga0157292_10062610 | Not Available | 1030 | Open in IMG/M |
| 3300012915|Ga0157302_10255926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300012922|Ga0137394_10741435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 825 | Open in IMG/M |
| 3300012927|Ga0137416_10190609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1638 | Open in IMG/M |
| 3300012948|Ga0126375_10941686 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012961|Ga0164302_10937257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300012971|Ga0126369_10705658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1086 | Open in IMG/M |
| 3300012985|Ga0164308_11258770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300012989|Ga0164305_11566057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 587 | Open in IMG/M |
| 3300012989|Ga0164305_12122846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300013100|Ga0157373_10090659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2153 | Open in IMG/M |
| 3300014265|Ga0075314_1144676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300014300|Ga0075321_1039109 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300014301|Ga0075323_1105766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300014325|Ga0163163_10002915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14465 | Open in IMG/M |
| 3300014864|Ga0180068_1059461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300014968|Ga0157379_10224816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1701 | Open in IMG/M |
| 3300015200|Ga0173480_11167791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300015251|Ga0180070_1034186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300015371|Ga0132258_12922562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1187 | Open in IMG/M |
| 3300015371|Ga0132258_13724395 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300015374|Ga0132255_101207590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1139 | Open in IMG/M |
| 3300016294|Ga0182041_10582411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 981 | Open in IMG/M |
| 3300016294|Ga0182041_12133735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300016319|Ga0182033_10000003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 108949 | Open in IMG/M |
| 3300016319|Ga0182033_10441749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1108 | Open in IMG/M |
| 3300016319|Ga0182033_10594283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
| 3300016341|Ga0182035_12101683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 513 | Open in IMG/M |
| 3300016371|Ga0182034_10028779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3440 | Open in IMG/M |
| 3300016387|Ga0182040_10496408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 975 | Open in IMG/M |
| 3300016404|Ga0182037_10198628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1554 | Open in IMG/M |
| 3300016422|Ga0182039_11226455 | Not Available | 678 | Open in IMG/M |
| 3300017965|Ga0190266_10769179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300017974|Ga0187777_11059274 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300017974|Ga0187777_11368569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 522 | Open in IMG/M |
| 3300018028|Ga0184608_10163766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 964 | Open in IMG/M |
| 3300018081|Ga0184625_10626336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300018468|Ga0066662_12055990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300019356|Ga0173481_10324144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300019362|Ga0173479_10863317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300021510|Ga0222621_1104303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300021560|Ga0126371_10548153 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300021560|Ga0126371_12445846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300021968|Ga0193698_1035403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300021976|Ga0193742_1167935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300022737|Ga0247747_1040683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300023057|Ga0247797_1000514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3075 | Open in IMG/M |
| 3300023062|Ga0247791_1035946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300025315|Ga0207697_10498645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300025911|Ga0207654_10014787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4039 | Open in IMG/M |
| 3300025912|Ga0207707_10230327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1612 | Open in IMG/M |
| 3300025914|Ga0207671_11379695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300025916|Ga0207663_10016054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4144 | Open in IMG/M |
| 3300025925|Ga0207650_11407841 | Not Available | 593 | Open in IMG/M |
| 3300025931|Ga0207644_11342872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300025934|Ga0207686_11572830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300025939|Ga0207665_10207319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1430 | Open in IMG/M |
| 3300025939|Ga0207665_10565103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 885 | Open in IMG/M |
| 3300025941|Ga0207711_10349894 | Not Available | 1368 | Open in IMG/M |
| 3300025941|Ga0207711_11919460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300026067|Ga0207678_10436223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1137 | Open in IMG/M |
| 3300026312|Ga0209153_1234970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300026895|Ga0207758_1028729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300027174|Ga0207948_1036053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L103C131B0 | 594 | Open in IMG/M |
| 3300027428|Ga0207617_105456 | Not Available | 525 | Open in IMG/M |
| 3300027646|Ga0209466_1015163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1621 | Open in IMG/M |
| 3300027738|Ga0208989_10105507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 958 | Open in IMG/M |
| 3300027909|Ga0209382_10550443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1264 | Open in IMG/M |
| 3300028536|Ga0137415_10464606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1072 | Open in IMG/M |
| 3300028708|Ga0307295_10165478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300028719|Ga0307301_10241339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300028721|Ga0307315_10186057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300028755|Ga0307316_10347823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300028810|Ga0307294_10031974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1453 | Open in IMG/M |
| 3300028881|Ga0307277_10141489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1040 | Open in IMG/M |
| 3300031199|Ga0307495_10200575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031200|Ga0307496_10039448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300031366|Ga0307506_10344419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
| 3300031474|Ga0170818_102673997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4385 | Open in IMG/M |
| 3300031544|Ga0318534_10601473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300031546|Ga0318538_10105949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1456 | Open in IMG/M |
| 3300031546|Ga0318538_10401951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Kushneria → Kushneria sinocarnis | 741 | Open in IMG/M |
| 3300031548|Ga0307408_102429123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300031561|Ga0318528_10281883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
| 3300031682|Ga0318560_10062116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1866 | Open in IMG/M |
| 3300031713|Ga0318496_10197152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1106 | Open in IMG/M |
| 3300031723|Ga0318493_10303051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
| 3300031751|Ga0318494_10463244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L103C131B0 | 738 | Open in IMG/M |
| 3300031753|Ga0307477_10306354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
| 3300031764|Ga0318535_10029143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 2196 | Open in IMG/M |
| 3300031764|Ga0318535_10567004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300031765|Ga0318554_10216693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1090 | Open in IMG/M |
| 3300031770|Ga0318521_10374062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 847 | Open in IMG/M |
| 3300031792|Ga0318529_10111579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1240 | Open in IMG/M |
| 3300031833|Ga0310917_10447920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L103C131B0 | 878 | Open in IMG/M |
| 3300031854|Ga0310904_10162680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1309 | Open in IMG/M |
| 3300031854|Ga0310904_10966281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300031859|Ga0318527_10389204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300031890|Ga0306925_10154849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 2466 | Open in IMG/M |
| 3300031892|Ga0310893_10052252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1362 | Open in IMG/M |
| 3300031896|Ga0318551_10070243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1813 | Open in IMG/M |
| 3300031896|Ga0318551_10819028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 541 | Open in IMG/M |
| 3300031910|Ga0306923_10604025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1231 | Open in IMG/M |
| 3300031910|Ga0306923_12460763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300031981|Ga0318531_10265849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 774 | Open in IMG/M |
| 3300032002|Ga0307416_100583281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1196 | Open in IMG/M |
| 3300032003|Ga0310897_10122512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1061 | Open in IMG/M |
| 3300032008|Ga0318562_10396746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300032035|Ga0310911_10922598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Kushneria → Kushneria sinocarnis | 503 | Open in IMG/M |
| 3300032042|Ga0318545_10349040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300032043|Ga0318556_10105563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1430 | Open in IMG/M |
| 3300032055|Ga0318575_10422697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Kushneria → Kushneria sinocarnis | 676 | Open in IMG/M |
| 3300032067|Ga0318524_10274306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
| 3300032075|Ga0310890_10646001 | Not Available | 823 | Open in IMG/M |
| 3300032075|Ga0310890_10795265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300032090|Ga0318518_10056842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1875 | Open in IMG/M |
| 3300032091|Ga0318577_10601465 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032122|Ga0310895_10062672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1407 | Open in IMG/M |
| 3300033289|Ga0310914_10307839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1429 | Open in IMG/M |
| 3300033417|Ga0214471_10779135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300033551|Ga0247830_10219590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1427 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.32% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.32% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.32% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.32% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.44% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.44% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.44% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.44% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.44% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027428 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A2-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_04998480 | 2124908045 | Soil | PKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| FA3_03999320 | 2170459023 | Grass Soil | ITIYICNPHDVPKARKILATYFAGNPPGSTLCILRGLANPNFLLEIEAIAVV |
| INPhiseqgaiiFebDRAFT_1016912541 | 3300000364 | Soil | KARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEATAAV* |
| F14TC_1002242141 | 3300000559 | Soil | PHDVPKARGILQTYFAGQPPASTLCILXGLANPNFLLEIEAIAAV* |
| AF_2010_repII_A1DRAFT_100113165 | 3300000597 | Forest Soil | ARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| AF_2010_repII_A1DRAFT_100766533 | 3300000597 | Forest Soil | RGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| JGI10216J12902_1042351322 | 3300000956 | Soil | VPQARTILQEYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| JGI10216J12902_1140950741 | 3300000956 | Soil | YICNPHDVPKARAILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| C688J18823_106451371 | 3300001686 | Soil | KARGILFDYFGKNPPGSTLCILRGLANPNFLLEIEAIAAV* |
| JGI24752J21851_10186293 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | KARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0055490_102638382 | 3300004052 | Natural And Restored Wetlands | CNPHDVPRARGILHTYFGAHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0062593_1022685822 | 3300004114 | Soil | PKARGILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0062593_1031580821 | 3300004114 | Soil | SDVTKVTIYICNPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0062590_1000450611 | 3300004157 | Soil | IYICNPHDVTKARRILTDYFGSNPPGSTLCVLRGLANPNFLLEVEAIAAV* |
| Ga0066395_102067331 | 3300004633 | Tropical Forest Soil | VPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0066690_101158793 | 3300005177 | Soil | DVTKITIYICNTHDVPKARGILQTYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0070683_1002968951 | 3300005329 | Corn Rhizosphere | DVPKARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0070690_1013990911 | 3300005330 | Switchgrass Rhizosphere | AKLSDVTKVAIYICNPHDVTKARRILTDYFGSNPPGSTLCVLRGLANPNFLLEVEAIAAV |
| Ga0066388_1012419343 | 3300005332 | Tropical Forest Soil | KITIYICNPHDVPKARGILHTYFAGQPPASTLCILRGLATPFLLEIEAIAAV* |
| Ga0070661_1001598491 | 3300005344 | Corn Rhizosphere | ICNPHDVPKARFILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0070669_1017980801 | 3300005353 | Switchgrass Rhizosphere | LCNPHDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0070669_1019292981 | 3300005353 | Switchgrass Rhizosphere | DVTKVTIYICNPHDVPKARGILFDYFGETPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0070673_1022497022 | 3300005364 | Switchgrass Rhizosphere | VPKARGILKTYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0070709_116506202 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VPKARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0070678_1000363496 | 3300005456 | Miscanthus Rhizosphere | VPKARGILFDYFGETPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0070662_1007022062 | 3300005457 | Corn Rhizosphere | ICNPHDVPKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0070699_1002417951 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KARSILQDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0070693_1013652041 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | HDVPKARGILQTYFAGAAPASTLCILRGLANPKFLLEIEAIAAV* |
| Ga0070665_1002170461 | 3300005548 | Switchgrass Rhizosphere | PKARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0066661_105058441 | 3300005554 | Soil | ICNPHDVPKARGILQTYFAGAAPASTLCILRGLANPHFLLEIEAIAAV* |
| Ga0068857_1017871081 | 3300005577 | Corn Rhizosphere | ITIYLCNPHDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0068866_102391962 | 3300005718 | Miscanthus Rhizosphere | PKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0068861_1006537971 | 3300005719 | Switchgrass Rhizosphere | DVPKARSILQDYFGGDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0066903_1019908844 | 3300005764 | Tropical Forest Soil | GVLQTYFAGNAPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0066903_1075076962 | 3300005764 | Tropical Forest Soil | ITIYICNPHDVPKARGVLQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0066903_1088637772 | 3300005764 | Tropical Forest Soil | KARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0068863_1004515251 | 3300005841 | Switchgrass Rhizosphere | VTKITIYICNPHDVPKARAILFDYFGKHPPGSTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0068858_1006603553 | 3300005842 | Switchgrass Rhizosphere | ICNPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0068858_1025707251 | 3300005842 | Switchgrass Rhizosphere | TIYICNPHDVPKARSILQDYFGGDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0075365_104841011 | 3300006038 | Populus Endosphere | VTKITIYICSPHDVPKARALLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0075023_1000577544 | 3300006041 | Watersheds | HDVPKARAILQDYFGDSPPASTLCVLRGLANPHFLLEVEAIAAV* |
| Ga0070716_1002698331 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VPKARGILQTYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0097621_1007026883 | 3300006237 | Miscanthus Rhizosphere | TIYICNPHDVPKARAILFDYFGKHPPGSTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0097621_1017693681 | 3300006237 | Miscanthus Rhizosphere | VTIYICNPHDVPKARGILSDYFGETPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0075021_105008161 | 3300006354 | Watersheds | KARKILATYFAGNPPGSTLCILRGLANPNFLLEIEAIAVV* |
| Ga0074054_118740761 | 3300006579 | Soil | ILQDYFGGDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0066653_107716121 | 3300006791 | Soil | CNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0066659_105537952 | 3300006797 | Soil | VPKARNVLQTYFKGHPPGSTLCILRGLANPNFLLEIEAIAAI* |
| Ga0079220_107204663 | 3300006806 | Agricultural Soil | YICSPHDVPKARRLLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0075428_1012216152 | 3300006844 | Populus Rhizosphere | VLQTYFAGNPPGSTLCILRGLVNPNFLLEIEAIAVV* |
| Ga0075425_1008568313 | 3300006854 | Populus Rhizosphere | CNPHDVPKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0075425_1013494751 | 3300006854 | Populus Rhizosphere | KVTIYICNPHDVPKARSILQDYFGGDSPVTTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0075434_1026373701 | 3300006871 | Populus Rhizosphere | TIYICNPHDVTKARRILTDYFGGNPPGSTLCVLRGLANPNFLLEVEAIAAV* |
| Ga0075426_111557081 | 3300006903 | Populus Rhizosphere | TKITIYICNPHDVPKARGILQTYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0075424_1006118371 | 3300006904 | Populus Rhizosphere | PHDVPKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0075419_103909843 | 3300006969 | Populus Rhizosphere | SPHDVPKARRLLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0075419_105472112 | 3300006969 | Populus Rhizosphere | ARSILQDYFGSDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0099795_101862891 | 3300007788 | Vadose Zone Soil | ICNPHDVPKARGVLQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0066710_1004737301 | 3300009012 | Grasslands Soil | RGILQTYFAGAAPASTLCILRGLANPHFLLEIEAIAAV |
| Ga0099828_100635095 | 3300009089 | Vadose Zone Soil | TICICNPHDVPKARGVLQTYFGGHPPGSTLCVLRGLANPNFLLEIEAIAAC* |
| Ga0105250_104562151 | 3300009092 | Switchgrass Rhizosphere | HDVPKARSILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0111539_118331873 | 3300009094 | Populus Rhizosphere | MTRSILQDYFGGDSPVTTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0105245_104522592 | 3300009098 | Miscanthus Rhizosphere | KARNILKTYFAGHAPGSTLCVLRGLANPNFLVEIEAIAAV* |
| Ga0105245_112563141 | 3300009098 | Miscanthus Rhizosphere | RAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0075418_106388661 | 3300009100 | Populus Rhizosphere | VLQTYFAGNPPGSTLCILRGLVNPNFLLEIEAIAVV |
| Ga0075418_110363403 | 3300009100 | Populus Rhizosphere | HDVPKARGVLQKYFAGNPPGSTLCILRGLAHPHFLLEIEATAVV* |
| Ga0114129_131609722 | 3300009147 | Populus Rhizosphere | PHDVPKARNVLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0105243_131039821 | 3300009148 | Miscanthus Rhizosphere | KVTIYICNPHDVPKARGILSDYFGETPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0111538_127871011 | 3300009156 | Populus Rhizosphere | KARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0105242_108382951 | 3300009176 | Miscanthus Rhizosphere | KVTIYICNPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0105237_109550061 | 3300009545 | Corn Rhizosphere | IYLCNPHDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0105249_108750481 | 3300009553 | Switchgrass Rhizosphere | AILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0126374_109779172 | 3300009792 | Tropical Forest Soil | YICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126304_106915372 | 3300010037 | Serpentine Soil | IYICNPHDVPKARNILKTYFAGHAPGSTLCILRGLANPNFLVEIEAIAAV* |
| Ga0126380_102438862 | 3300010043 | Tropical Forest Soil | RGILQTYCAGAAPASTLCGLRGLANPTVILEIEAIAAV* |
| Ga0126380_122912972 | 3300010043 | Tropical Forest Soil | TKVTLYICNPHDVPKARRVLATYFAGNPPGSTLCILRGLAHPSFLLEIEAIAAV* |
| Ga0126311_102090732 | 3300010045 | Serpentine Soil | YICNPHDVPKARSILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126373_109560181 | 3300010048 | Tropical Forest Soil | DVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0099796_102953341 | 3300010159 | Vadose Zone Soil | NPHDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126306_103479372 | 3300010166 | Serpentine Soil | KARAILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126370_106232501 | 3300010358 | Tropical Forest Soil | IYICNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126376_104092312 | 3300010359 | Tropical Forest Soil | LQEYFGNNPPASTLCVLRGLANPNFLLEIEAIAAL* |
| Ga0126376_124641012 | 3300010359 | Tropical Forest Soil | YICNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126372_127270601 | 3300010360 | Tropical Forest Soil | ICNPHDVPKARKVLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126378_130828741 | 3300010361 | Tropical Forest Soil | PKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126377_102623561 | 3300010362 | Tropical Forest Soil | ARKVLQTYFAAHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126377_117755633 | 3300010362 | Tropical Forest Soil | YICNPHDVPKARGVLQTYFAGHPPGSTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0134128_121444611 | 3300010373 | Terrestrial Soil | LQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0134128_130246032 | 3300010373 | Terrestrial Soil | NVLQTYFKGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0105239_107506951 | 3300010375 | Corn Rhizosphere | ILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0136847_116188461 | 3300010391 | Freshwater Sediment | YNYFDKHPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126383_109021841 | 3300010398 | Tropical Forest Soil | PKARGLLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126383_112087811 | 3300010398 | Tropical Forest Soil | NPHDVPKARNVLKTYFAGHAPGSTLCILRGLANPSFLLEIEAIAAV* |
| Ga0134123_133136141 | 3300010403 | Terrestrial Soil | VPKARSILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0138514_1001561192 | 3300011003 | Soil | THDVPKARKILATHFAGNPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0137391_105416583 | 3300011270 | Vadose Zone Soil | KARGILQTYFAGHPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0137393_110868152 | 3300011271 | Vadose Zone Soil | IYICNPHDVPKARNLLRTYFGEHPPGSTLCILRGLAHPNFLLEIEAIAAV* |
| Ga0120191_101655291 | 3300012022 | Terrestrial | ARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0137371_100336075 | 3300012356 | Vadose Zone Soil | CNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0150984_1132192161 | 3300012469 | Avena Fatua Rhizosphere | DVPKARNVLQTYFKGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0137373_112380261 | 3300012532 | Vadose Zone Soil | VGDITIYICNPHDVPKARGVLQAYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0137397_101406611 | 3300012685 | Vadose Zone Soil | KARGILQTYFAGHPPGSTLCILRGLANPHFLLEIEAIAAV* |
| Ga0157304_10848792 | 3300012882 | Soil | VTIYICNPHDVPKARGILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0157300_10430821 | 3300012884 | Soil | VPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0157305_102889032 | 3300012891 | Soil | DVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAVAAV* |
| Ga0157284_103301662 | 3300012893 | Soil | PKARGILSDYFGDTPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0157292_100626102 | 3300012900 | Soil | LQDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0157302_102559261 | 3300012915 | Soil | ILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0137394_107414351 | 3300012922 | Vadose Zone Soil | AKISDVVKITIYICSPHDVPKARNLLQTYFAGNPPGSTLCILRGLANPNFLLEVEAIAAV |
| Ga0137416_101906092 | 3300012927 | Vadose Zone Soil | MAKITIYLCNPHDVPKARGILQTYFAGHPSGSTLCIPRGLANPNFLLEIEAIAAV* |
| Ga0126375_109416861 | 3300012948 | Tropical Forest Soil | NILKTWFAGHAPGSTLCILRGLANPNFLVEIEAIAAV* |
| Ga0164302_109372572 | 3300012961 | Soil | CNPHDVPKARGILSDYFGETPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0126369_107056581 | 3300012971 | Tropical Forest Soil | ICNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0164308_112587701 | 3300012985 | Soil | TKVTIYICNPHDVPKARGILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0164305_115660571 | 3300012989 | Soil | TIYICNPHDVPKARGILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0164305_121228462 | 3300012989 | Soil | HDVPKARGILSDYFGETPPASTLCILRGLANPNFLLEIEAIAAV* |
| Ga0157373_100906591 | 3300013100 | Corn Rhizosphere | ARSILQDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0075314_11446761 | 3300014265 | Natural And Restored Wetlands | PKARALIQTWFGEHPPGSTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0075321_10391091 | 3300014300 | Natural And Restored Wetlands | KITIYICNPHDVPKARGILQTYFSDHPPGSTLCVLRGLANPNFLVEIEAIAAV* |
| Ga0075323_11057661 | 3300014301 | Natural And Restored Wetlands | RGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0163163_100029151 | 3300014325 | Switchgrass Rhizosphere | QDYFGDHPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0180068_10594612 | 3300014864 | Soil | SDVTKVTIYICHPHDVPKARGILYEYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0157379_102248161 | 3300014968 | Switchgrass Rhizosphere | TIYICNPHDVPKARGILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0173480_111677911 | 3300015200 | Soil | KARRILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0180070_10341862 | 3300015251 | Soil | VPKARGILYEYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0132258_129225624 | 3300015371 | Arabidopsis Rhizosphere | SDVTKVTIYICNPHDVTKARRILTDYFGSNPPGSTLCVLRGLANPNFLLEVEAIAAV* |
| Ga0132258_137243951 | 3300015371 | Arabidopsis Rhizosphere | ARSILQGYFGGDPPASTLCVLRGLANPNFLLEIEAIAAV* |
| Ga0132255_1012075901 | 3300015374 | Arabidopsis Rhizosphere | ARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV* |
| Ga0182041_105824111 | 3300016294 | Soil | DVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0182041_121337351 | 3300016294 | Soil | LETYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0182033_10000003102 | 3300016319 | Soil | AILQEYFGDSPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0182033_104417492 | 3300016319 | Soil | YICNPHDVPKARGILQTYFAGQPPASTLCILRGLANSNFLLEIEAIAAV |
| Ga0182033_105942832 | 3300016319 | Soil | YICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0182035_121016832 | 3300016341 | Soil | RGVLQTYFAGNPPGSTLCILRGLANPNLLLEIEAIAAV |
| Ga0182034_100287796 | 3300016371 | Soil | VTKITIYICNPHDVPKARGILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0182040_104964081 | 3300016387 | Soil | PKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0182037_101986281 | 3300016404 | Soil | KARGILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0182039_112264551 | 3300016422 | Soil | KVTIYICNPHDVAKARRILETYFGGHPPGSTLCIVRGLANPNFLLEIEAIAAV |
| Ga0190266_107691791 | 3300017965 | Soil | NPHDVPKARAILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0187777_110592741 | 3300017974 | Tropical Peatland | NPHDVPKARAILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0187777_113685691 | 3300017974 | Tropical Peatland | IYICNPHDVPKARAILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0184608_101637661 | 3300018028 | Groundwater Sediment | NPHDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0184625_106263361 | 3300018081 | Groundwater Sediment | KVTIYICNPHDVPKARGILFDYFGETPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0066662_120559901 | 3300018468 | Grasslands Soil | DVPKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0173481_103241443 | 3300019356 | Soil | VPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0173479_108633172 | 3300019362 | Soil | PHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0222621_11043031 | 3300021510 | Groundwater Sediment | KARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0126371_105481532 | 3300021560 | Tropical Forest Soil | LQTYFAGQPPASTLCILRGLANPNFLLEIEAIAWV |
| Ga0126371_124458462 | 3300021560 | Tropical Forest Soil | HDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0193698_10354031 | 3300021968 | Soil | HDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0193742_11679351 | 3300021976 | Soil | VNPHDVPKARAVLQTYFEGNPPGSTLCILRGLAHPDFLLEIEAIAAV |
| Ga0247747_10406831 | 3300022737 | Soil | NPHDVRKARGVLKQYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0247797_10005141 | 3300023057 | Soil | RSILRDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0247791_10359463 | 3300023062 | Soil | IYLCNPHDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0207697_104986452 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPVSSKARAILSDYFGEHPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0207654_100147871 | 3300025911 | Corn Rhizosphere | HDVPKARSILQDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0207707_102303271 | 3300025912 | Corn Rhizosphere | FILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0207671_113796952 | 3300025914 | Corn Rhizosphere | TIYICNPHDVPKARGILNDYFGENPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0207663_100160543 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | NDVPKARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0207650_114078411 | 3300025925 | Switchgrass Rhizosphere | ICNPHDVPKARSILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0207644_113428722 | 3300025931 | Switchgrass Rhizosphere | PHDVPKARGILQSYFGSNPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0207686_115728302 | 3300025934 | Miscanthus Rhizosphere | IYICNPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0207665_102073191 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RNILHTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0207665_105651033 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VPKARGILQTYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0207711_103498941 | 3300025941 | Switchgrass Rhizosphere | VTIYICDPHDVPKARSILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0207711_119194602 | 3300025941 | Switchgrass Rhizosphere | VTIYICNPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0207678_104362231 | 3300026067 | Corn Rhizosphere | KARGILFDHFGKHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0209153_12349701 | 3300026312 | Soil | CNPHDVPKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0207758_10287291 | 3300026895 | Tropical Forest Soil | TKITIYICNPHDVAKARRILERYFGDHPPGSTLCVVRGLANPNFLLEIEAIAAV |
| Ga0207948_10360531 | 3300027174 | Forest Soil | KILATYFAGNPPGSTLCILRGLANPNFLLEIEAIAVV |
| Ga0207617_1054562 | 3300027428 | Soil | SILQDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0209466_10151631 | 3300027646 | Tropical Forest Soil | LQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0208989_101055071 | 3300027738 | Forest Soil | KARSLLQTYFGEHPPGSTLCILRGLAHPNLLLEIEAIAAV |
| Ga0209382_105504434 | 3300027909 | Populus Rhizosphere | NVLQTYFAGHPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0137415_104646062 | 3300028536 | Vadose Zone Soil | MAKITIYLCNPHDVSKARCILQTYFSGHPPGSTLCIPRGLANPNFLLEIEAIAAV |
| Ga0307295_101654782 | 3300028708 | Soil | HDVPKARGIMQTYFAGHPRGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0307301_102413391 | 3300028719 | Soil | ARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0307315_101860573 | 3300028721 | Soil | LLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0307316_103478231 | 3300028755 | Soil | DVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0307294_100319743 | 3300028810 | Soil | PHDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0307277_101414891 | 3300028881 | Soil | VKITIYICSPHDVPKARGLLQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0307495_102005751 | 3300031199 | Soil | PKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0307496_100394482 | 3300031200 | Soil | ILHDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0307506_103444192 | 3300031366 | Soil | VTIYICNPHDVPKARGILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0170818_1026739975 | 3300031474 | Forest Soil | IYICNPHDVPKARSILQDYFGGDPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0318534_106014731 | 3300031544 | Soil | NQHDVPKARGILETYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0318538_101059493 | 3300031546 | Soil | PKARAILQEYFGDSPPASTLCMLRGLANPNFLLEIEAIAAV |
| Ga0318538_104019511 | 3300031546 | Soil | CNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0307408_1024291231 | 3300031548 | Rhizosphere | RAILSDYFGEHPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0318528_102818831 | 3300031561 | Soil | LERYFGGHPPGSTLCVVRGLANPNFLLEIEAIAAV |
| Ga0318560_100621162 | 3300031682 | Soil | LQTYFVGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0318496_101971521 | 3300031713 | Soil | TIYICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0318493_103030512 | 3300031723 | Soil | RRILETYFAGNPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0318494_104632443 | 3300031751 | Soil | KARGLLQKYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0307477_103063541 | 3300031753 | Hardwood Forest Soil | ARGILQTYFAGHPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0318535_100291431 | 3300031764 | Soil | IYICNPHDVPKARGILQTYFAGQPPASTLCILRGLANSNFLLEIEAIAAV |
| Ga0318535_105670042 | 3300031764 | Soil | LQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0318554_102166931 | 3300031765 | Soil | PKARGILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0318521_103740622 | 3300031770 | Soil | VPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0318529_101115792 | 3300031792 | Soil | PHDVPKARGILQTYFVGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0310917_104479202 | 3300031833 | Soil | GLLQKYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0310904_101626801 | 3300031854 | Soil | RAILQEHFGDNPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0310904_109662812 | 3300031854 | Soil | KVTIYICNPHDVPKARGILSDYFGETPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0318527_103892042 | 3300031859 | Soil | QHDVPKARGVLQTYFAGHPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0306925_101548491 | 3300031890 | Soil | ITIYICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0310893_100522522 | 3300031892 | Soil | LQEYFRDNPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0318551_100702433 | 3300031896 | Soil | IYICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0318551_108190282 | 3300031896 | Soil | VPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0306923_106040251 | 3300031910 | Soil | AILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0306923_124607631 | 3300031910 | Soil | RGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0318531_102658493 | 3300031981 | Soil | VPKARGLLQKYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0307416_1005832812 | 3300032002 | Rhizosphere | DVSKARGVLKQYFGKHPPGSTLCILRGLAHPNFLLEIEAIAAV |
| Ga0310897_101225122 | 3300032003 | Soil | HDVPKARGILFDYFGETPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0318562_103967462 | 3300032008 | Soil | IYICNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0310911_109225981 | 3300032035 | Soil | ICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0318545_103490402 | 3300032042 | Soil | IYICNPHDVAKARRILERYFGGHPPGSTLCVVRGLANPNFLLEIEAIAAV |
| Ga0318556_101055632 | 3300032043 | Soil | QHDVPKARGILETYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0318575_104226971 | 3300032055 | Soil | ITIYICNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV |
| Ga0318524_102743061 | 3300032067 | Soil | TKITIYICNPHDVPKARGLLQKYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0310890_106460011 | 3300032075 | Soil | PKARGILQSYFGSNPPGSTLCVLRGLANPNFLLEIEATAAV |
| Ga0310890_107952651 | 3300032075 | Soil | YLCNPHDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0318518_100568421 | 3300032090 | Soil | IYICNQHDVPKARGVLQTYFAGHPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0318577_106014652 | 3300032091 | Soil | VPKARAILQEYFGDSPPASTLCVLRGLANPNFLLEIEAIAAV |
| Ga0310895_100626723 | 3300032122 | Soil | DVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV |
| Ga0310914_103078392 | 3300033289 | Soil | VPKARGILETYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV |
| Ga0214471_107791351 | 3300033417 | Soil | FIVNPHDVPKARGILQNYFAGNPPGSTLCVLRGLANANFLVEVEAIAAV |
| Ga0247830_102195902 | 3300033551 | Soil | IYLCNPHDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV |
| ⦗Top⦘ |