


| Basic Information | |
|---|---|
| Family ID | F019848 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 227 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MPLPMLVIVILVSAGCVVFLVQQVRTLRRRKRNLEHWEKDEPLEGVGDWD |
| Number of Associated Samples | 168 |
| Number of Associated Scaffolds | 227 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.47 % |
| % of genes near scaffold ends (potentially truncated) | 33.04 % |
| % of genes from short scaffolds (< 2000 bps) | 83.70 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.330 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.811 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.802 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.101 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 227 Family Scaffolds |
|---|---|---|
| PF01149 | Fapy_DNA_glyco | 30.40 |
| PF00756 | Esterase | 17.62 |
| PF06831 | H2TH | 16.30 |
| PF12850 | Metallophos_2 | 10.57 |
| PF01966 | HD | 3.08 |
| PF00588 | SpoU_methylase | 3.08 |
| PF03781 | FGE-sulfatase | 0.88 |
| PF12627 | PolyA_pol_RNAbd | 0.44 |
| PF08281 | Sigma70_r4_2 | 0.44 |
| PF00027 | cNMP_binding | 0.44 |
| PF07992 | Pyr_redox_2 | 0.44 |
| PF00676 | E1_dh | 0.44 |
| PF00557 | Peptidase_M24 | 0.44 |
| PF02954 | HTH_8 | 0.44 |
| PF12779 | WXXGXW | 0.44 |
| PF02452 | PemK_toxin | 0.44 |
| PF00246 | Peptidase_M14 | 0.44 |
| PF02518 | HATPase_c | 0.44 |
| PF03979 | Sigma70_r1_1 | 0.44 |
| PF15731 | MqsA_antitoxin | 0.44 |
| PF02148 | zf-UBP | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 227 Family Scaffolds |
|---|---|---|---|
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 46.70 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 3.08 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 3.08 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 3.08 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.44 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.44 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.44 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.44 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.33 % |
| Unclassified | root | N/A | 24.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908008|FWIREl_GJ4R3DH01DQ8ZK | Not Available | 505 | Open in IMG/M |
| 3300000956|JGI10216J12902_102128734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300002568|C688J35102_119332800 | Not Available | 675 | Open in IMG/M |
| 3300004047|Ga0055499_10010572 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300004047|Ga0055499_10076114 | Not Available | 585 | Open in IMG/M |
| 3300004058|Ga0055498_10151505 | Not Available | 506 | Open in IMG/M |
| 3300004114|Ga0062593_101551183 | Not Available | 716 | Open in IMG/M |
| 3300004156|Ga0062589_100275062 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300004463|Ga0063356_100028373 | All Organisms → cellular organisms → Bacteria | 5359 | Open in IMG/M |
| 3300004463|Ga0063356_101139766 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300004479|Ga0062595_100911299 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300005179|Ga0066684_10780457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 633 | Open in IMG/M |
| 3300005329|Ga0070683_100154410 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
| 3300005329|Ga0070683_100300160 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300005329|Ga0070683_101382605 | Not Available | 677 | Open in IMG/M |
| 3300005330|Ga0070690_100002868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 9295 | Open in IMG/M |
| 3300005331|Ga0070670_100076623 | All Organisms → cellular organisms → Bacteria | 2873 | Open in IMG/M |
| 3300005331|Ga0070670_100211599 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300005332|Ga0066388_107665955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 541 | Open in IMG/M |
| 3300005338|Ga0068868_101732847 | Not Available | 589 | Open in IMG/M |
| 3300005341|Ga0070691_10321674 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300005341|Ga0070691_11006932 | Not Available | 520 | Open in IMG/M |
| 3300005353|Ga0070669_100061086 | All Organisms → cellular organisms → Bacteria | 2768 | Open in IMG/M |
| 3300005356|Ga0070674_102226385 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005364|Ga0070673_100109668 | All Organisms → cellular organisms → Bacteria | 2287 | Open in IMG/M |
| 3300005365|Ga0070688_100527135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300005367|Ga0070667_100067610 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
| 3300005436|Ga0070713_100708756 | Not Available | 961 | Open in IMG/M |
| 3300005436|Ga0070713_101641477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 624 | Open in IMG/M |
| 3300005437|Ga0070710_10616157 | Not Available | 757 | Open in IMG/M |
| 3300005450|Ga0066682_10704946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300005455|Ga0070663_101977778 | Not Available | 524 | Open in IMG/M |
| 3300005457|Ga0070662_100878962 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005466|Ga0070685_10347259 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300005471|Ga0070698_101660593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 591 | Open in IMG/M |
| 3300005529|Ga0070741_10381959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1299 | Open in IMG/M |
| 3300005530|Ga0070679_100119897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2616 | Open in IMG/M |
| 3300005535|Ga0070684_100007692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8404 | Open in IMG/M |
| 3300005535|Ga0070684_101347259 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005535|Ga0070684_101715508 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005535|Ga0070684_102295975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300005539|Ga0068853_101661498 | Not Available | 619 | Open in IMG/M |
| 3300005543|Ga0070672_100121920 | All Organisms → cellular organisms → Bacteria | 2135 | Open in IMG/M |
| 3300005543|Ga0070672_100254041 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300005543|Ga0070672_101920398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300005548|Ga0070665_100754643 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005563|Ga0068855_100550167 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300005564|Ga0070664_102000955 | Not Available | 550 | Open in IMG/M |
| 3300005564|Ga0070664_102301262 | Not Available | 511 | Open in IMG/M |
| 3300005614|Ga0068856_100280307 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300005614|Ga0068856_101654801 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005614|Ga0068856_102012208 | Not Available | 588 | Open in IMG/M |
| 3300005615|Ga0070702_100722152 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300005616|Ga0068852_100286413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1590 | Open in IMG/M |
| 3300005618|Ga0068864_101338448 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005713|Ga0066905_101679646 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005764|Ga0066903_100151768 | All Organisms → cellular organisms → Bacteria | 3331 | Open in IMG/M |
| 3300005764|Ga0066903_101780333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300005764|Ga0066903_105309783 | Not Available | 681 | Open in IMG/M |
| 3300005993|Ga0080027_10378368 | Not Available | 569 | Open in IMG/M |
| 3300006031|Ga0066651_10791748 | Not Available | 514 | Open in IMG/M |
| 3300006046|Ga0066652_100076234 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300006237|Ga0097621_100247476 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300006844|Ga0075428_100307158 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300006854|Ga0075425_102446382 | Not Available | 579 | Open in IMG/M |
| 3300006904|Ga0075424_100951521 | Not Available | 916 | Open in IMG/M |
| 3300006969|Ga0075419_10784709 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300009093|Ga0105240_10054733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4998 | Open in IMG/M |
| 3300009094|Ga0111539_10050495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4955 | Open in IMG/M |
| 3300009094|Ga0111539_11140521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300009094|Ga0111539_12176497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 643 | Open in IMG/M |
| 3300009156|Ga0111538_13971503 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009177|Ga0105248_10974841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300009609|Ga0105347_1079178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300010047|Ga0126382_11194820 | Not Available | 681 | Open in IMG/M |
| 3300010047|Ga0126382_12005454 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010362|Ga0126377_10619488 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300010366|Ga0126379_10101525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 2561 | Open in IMG/M |
| 3300010371|Ga0134125_10213294 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
| 3300010397|Ga0134124_11308097 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300010398|Ga0126383_10166671 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300010399|Ga0134127_10060497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3172 | Open in IMG/M |
| 3300010399|Ga0134127_10302062 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300010399|Ga0134127_10402487 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300010401|Ga0134121_10236220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1594 | Open in IMG/M |
| 3300010401|Ga0134121_12183297 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300010401|Ga0134121_12385489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300010869|Ga0126359_1550943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 1356 | Open in IMG/M |
| 3300010869|Ga0126359_1611861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300010869|Ga0126359_1732100 | Not Available | 540 | Open in IMG/M |
| 3300010877|Ga0126356_11419733 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300011439|Ga0137432_1165366 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300011440|Ga0137433_1001505 | All Organisms → cellular organisms → Bacteria | 9657 | Open in IMG/M |
| 3300012204|Ga0137374_10054924 | All Organisms → cellular organisms → Bacteria | 4059 | Open in IMG/M |
| 3300012231|Ga0137465_1028619 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300012353|Ga0137367_10096602 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
| 3300012469|Ga0150984_106266014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 516 | Open in IMG/M |
| 3300012685|Ga0137397_10310897 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300012898|Ga0157293_10181692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300012923|Ga0137359_10788641 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012944|Ga0137410_11609045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 569 | Open in IMG/M |
| 3300012955|Ga0164298_11639145 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012957|Ga0164303_11460683 | Not Available | 514 | Open in IMG/M |
| 3300012960|Ga0164301_11776422 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 517 | Open in IMG/M |
| 3300012982|Ga0168317_1095394 | Not Available | 656 | Open in IMG/M |
| 3300013297|Ga0157378_12021094 | Not Available | 626 | Open in IMG/M |
| 3300014318|Ga0075351_1189657 | Not Available | 516 | Open in IMG/M |
| 3300014745|Ga0157377_10549280 | Not Available | 816 | Open in IMG/M |
| 3300014969|Ga0157376_12193556 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300015200|Ga0173480_10576927 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300015245|Ga0137409_10195381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 1825 | Open in IMG/M |
| 3300015371|Ga0132258_10288849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4028 | Open in IMG/M |
| 3300015371|Ga0132258_10323557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 3802 | Open in IMG/M |
| 3300015371|Ga0132258_11133861 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300015371|Ga0132258_11753748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1565 | Open in IMG/M |
| 3300015371|Ga0132258_12108597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300015372|Ga0132256_101033609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 937 | Open in IMG/M |
| 3300015372|Ga0132256_101684986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300015373|Ga0132257_101198602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300015373|Ga0132257_104292442 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300015374|Ga0132255_100639622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
| 3300015374|Ga0132255_101934330 | Not Available | 897 | Open in IMG/M |
| 3300015374|Ga0132255_105943740 | Not Available | 516 | Open in IMG/M |
| 3300016357|Ga0182032_11901444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 521 | Open in IMG/M |
| 3300016404|Ga0182037_10943137 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300017965|Ga0190266_10025190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 1810 | Open in IMG/M |
| 3300018060|Ga0187765_11106328 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300018067|Ga0184611_1282414 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300018073|Ga0184624_10104593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300018073|Ga0184624_10144041 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300018081|Ga0184625_10098346 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300018083|Ga0184628_10013080 | All Organisms → cellular organisms → Bacteria | 4026 | Open in IMG/M |
| 3300018476|Ga0190274_10952237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300018476|Ga0190274_11243396 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300018476|Ga0190274_13380784 | Not Available | 538 | Open in IMG/M |
| 3300018481|Ga0190271_11356392 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 831 | Open in IMG/M |
| 3300019356|Ga0173481_10884759 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300019361|Ga0173482_10275132 | Not Available | 729 | Open in IMG/M |
| 3300019361|Ga0173482_10701326 | Not Available | 523 | Open in IMG/M |
| 3300020005|Ga0193697_1006845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2779 | Open in IMG/M |
| 3300020016|Ga0193696_1055120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300020076|Ga0206355_1202967 | Not Available | 666 | Open in IMG/M |
| 3300020582|Ga0210395_10282598 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300021384|Ga0213876_10145555 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300022756|Ga0222622_10069053 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300022756|Ga0222622_10075989 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
| 3300022915|Ga0247790_10049639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300024055|Ga0247794_10170448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300024186|Ga0247688_1034246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300024187|Ga0247672_1005100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2123 | Open in IMG/M |
| 3300024284|Ga0247671_1063162 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300024317|Ga0247660_1049435 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300025271|Ga0207666_1006297 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300025315|Ga0207697_10203738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300025898|Ga0207692_10577947 | Not Available | 720 | Open in IMG/M |
| 3300025901|Ga0207688_10728904 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300025903|Ga0207680_10232623 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300025912|Ga0207707_10880468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 741 | Open in IMG/M |
| 3300025914|Ga0207671_10587791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 887 | Open in IMG/M |
| 3300025916|Ga0207663_11700737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 508 | Open in IMG/M |
| 3300025918|Ga0207662_10819479 | Not Available | 657 | Open in IMG/M |
| 3300025925|Ga0207650_10022604 | All Organisms → cellular organisms → Bacteria | 4452 | Open in IMG/M |
| 3300025925|Ga0207650_10110865 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
| 3300025926|Ga0207659_10811750 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300025926|Ga0207659_11132521 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300025928|Ga0207700_11323887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 641 | Open in IMG/M |
| 3300025930|Ga0207701_11361401 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300025930|Ga0207701_11728250 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300025944|Ga0207661_10312617 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300025944|Ga0207661_11202188 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300025944|Ga0207661_11223737 | Not Available | 691 | Open in IMG/M |
| 3300025945|Ga0207679_11191711 | Not Available | 699 | Open in IMG/M |
| 3300025957|Ga0210089_1009817 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300025960|Ga0207651_10146477 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300025960|Ga0207651_11612518 | Not Available | 584 | Open in IMG/M |
| 3300026041|Ga0207639_11854849 | Not Available | 564 | Open in IMG/M |
| 3300026067|Ga0207678_11505909 | Not Available | 594 | Open in IMG/M |
| 3300026075|Ga0207708_11485887 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 595 | Open in IMG/M |
| 3300026078|Ga0207702_11193209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300026088|Ga0207641_10471368 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300026088|Ga0207641_11624925 | Not Available | 648 | Open in IMG/M |
| 3300026089|Ga0207648_10035670 | All Organisms → cellular organisms → Bacteria | 4382 | Open in IMG/M |
| 3300026095|Ga0207676_10716129 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300026095|Ga0207676_12112037 | Not Available | 562 | Open in IMG/M |
| 3300026215|Ga0209849_1008586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1654 | Open in IMG/M |
| 3300026281|Ga0209863_10012635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2656 | Open in IMG/M |
| 3300026281|Ga0209863_10071492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300026557|Ga0179587_10937192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 571 | Open in IMG/M |
| 3300027874|Ga0209465_10000349 | All Organisms → cellular organisms → Bacteria | 21893 | Open in IMG/M |
| 3300027907|Ga0207428_10113647 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| 3300028380|Ga0268265_12140180 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300030336|Ga0247826_10616941 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300031240|Ga0265320_10160293 | Not Available | 1013 | Open in IMG/M |
| 3300031366|Ga0307506_10068242 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300031538|Ga0310888_10818877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300031543|Ga0318516_10221845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1093 | Open in IMG/M |
| 3300031543|Ga0318516_10390278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 802 | Open in IMG/M |
| 3300031562|Ga0310886_10139747 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300031572|Ga0318515_10272894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300031668|Ga0318542_10357917 | Not Available | 751 | Open in IMG/M |
| 3300031716|Ga0310813_10243678 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300031716|Ga0310813_11172078 | Not Available | 707 | Open in IMG/M |
| 3300031716|Ga0310813_11505834 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 626 | Open in IMG/M |
| 3300031720|Ga0307469_11553545 | Not Available | 635 | Open in IMG/M |
| 3300031740|Ga0307468_101345061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 653 | Open in IMG/M |
| 3300031740|Ga0307468_101347188 | Not Available | 653 | Open in IMG/M |
| 3300031765|Ga0318554_10502781 | Not Available | 686 | Open in IMG/M |
| 3300031799|Ga0318565_10434824 | Not Available | 635 | Open in IMG/M |
| 3300031879|Ga0306919_10574322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300031947|Ga0310909_10559210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 957 | Open in IMG/M |
| 3300031996|Ga0308176_12326055 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300032067|Ga0318524_10386413 | Not Available | 729 | Open in IMG/M |
| 3300032261|Ga0306920_100929013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
| 3300032261|Ga0306920_102485913 | Not Available | 713 | Open in IMG/M |
| 3300032896|Ga0335075_10742784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 933 | Open in IMG/M |
| 3300032954|Ga0335083_10002254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 25646 | Open in IMG/M |
| 3300032955|Ga0335076_10115093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2614 | Open in IMG/M |
| 3300032955|Ga0335076_10368035 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300032955|Ga0335076_10821787 | Not Available | 811 | Open in IMG/M |
| 3300032955|Ga0335076_11457826 | Not Available | 571 | Open in IMG/M |
| 3300032955|Ga0335076_11471906 | Not Available | 567 | Open in IMG/M |
| 3300033004|Ga0335084_12460209 | Not Available | 501 | Open in IMG/M |
| 3300033290|Ga0318519_10306703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300033412|Ga0310810_11253555 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300034818|Ga0373950_0000003 | All Organisms → cellular organisms → Bacteria | 541085 | Open in IMG/M |
| 3300034818|Ga0373950_0107014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.17% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.20% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.76% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.76% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.32% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.44% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.44% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.44% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.44% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908008 | Soil microbial communities from sample at FACE Site Metagenome WIR_Elev2 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIREl_04883940 | 2124908008 | Soil | MPLPMIVIVAIVSLGAVVFLVQQVRTLRRQKRNLKHWERDEPLEGVGDWD |
| JGI10216J12902_1021287341 | 3300000956 | Soil | MPLVVIVIVTLVSAGCAAFLVSQVRALRRQKRNLKHWENNEPLEGVGDWD* |
| C688J35102_1193328002 | 3300002568 | Soil | MPLPMLIIVIVVGAGCVAFLIKQVRTLQRRKRNIRHWEKGEPLEGVGDWD* |
| Ga0055499_100105722 | 3300004047 | Natural And Restored Wetlands | MPLPMIIIVTLVSAGCVAFLVAQVRSLRRQKRNLEHWEKGEPLEGVGDWD* |
| Ga0055499_100761141 | 3300004047 | Natural And Restored Wetlands | MPLPMLVIVILVGAGCVVFLVQQVRSLRRQKRNLRHWEKGEPLEGVGD |
| Ga0055498_101515052 | 3300004058 | Natural And Restored Wetlands | MPLPMLIIIILVSAGCVVFVVQQVRALRRQKRNLKHWEKGEPLEGVGDWD* |
| Ga0062593_1015511831 | 3300004114 | Soil | MSIPMLVVIIVVGAGCIVWLAQQVRALRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0062589_1002750622 | 3300004156 | Soil | MPLPMLIVAILVGAGCVVFLVQQVRTLLRRKRNIRHWEKGEPLEGVGDWD* |
| Ga0063356_1000283738 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPLPMLVIIIVVGGGCVAFLVQQVRSLRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0063356_1011397662 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPIPAAIALTITVIGAVAFLTNGIRALRRRKRNLEHWEKGEPLEGVGDWD* |
| Ga0062595_1009112991 | 3300004479 | Soil | LVIIIVVGGGCVAFLVQQVRSLRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0066684_107804572 | 3300005179 | Soil | MPLPMLIVVVLVSAGCVVWLVRQVRSLRRQKRNLEHWEKGEPLEGVGDWD* |
| Ga0070683_1001544103 | 3300005329 | Corn Rhizosphere | MPLPMLIIVILVSAGCVVFLVQQVRALQRRKRNIRHWEKDEPLEGTGDWD* |
| Ga0070683_1003001603 | 3300005329 | Corn Rhizosphere | MLIIVVLVSAGCVVWLAQQVRKLRRQKRNMRHWEKGEPLEGVGDWD* |
| Ga0070683_1013826052 | 3300005329 | Corn Rhizosphere | MPLPALIIVILVSIGAVIWLGFQVRTMRRQKRNLVHWEKGEPLEGVGDWD* |
| Ga0070690_1000028683 | 3300005330 | Switchgrass Rhizosphere | MPLPMLIIVILVSAGCVVFLMQQVRALRRRRRNLKHWENGEPLEGTGDWD* |
| Ga0070670_1000766233 | 3300005331 | Switchgrass Rhizosphere | VPMLIIVVLVSAGCVVFLVQQVRDLRRKKRNLEHWEKGEPLEGVGDWD* |
| Ga0070670_1002115993 | 3300005331 | Switchgrass Rhizosphere | MPLHFVVIVTLVSAGCVVFLVQQVRHLLRKKRNLKHFEKGEPLEGVGDWD* |
| Ga0066388_1076659551 | 3300005332 | Tropical Forest Soil | IALVSAGCAAFLVQQVRTLARRRRNLRHWEKDEPLEGRPGDWD* |
| Ga0068868_1017328472 | 3300005338 | Miscanthus Rhizosphere | MPLPALIAVVLVTVGCLVFLGNQIRTLRRRKRNLEHWEKGEPLEGTGDWD* |
| Ga0070691_103216742 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPMIIIVTLVSAGCVAFLVSQIRSLRRRKRNLKHWENNEPLEGVGDWD* |
| Ga0070691_110069322 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIPMLVVIIVVGAGCIVWLAQQVRALRRQKRNLRHWEKGEPLEGVG |
| Ga0070669_1000610864 | 3300005353 | Switchgrass Rhizosphere | ILVGAGCIAFLTHQVRTLLRRKRNLRHWEKGEPLEGVGDWD* |
| Ga0070674_1022263852 | 3300005356 | Miscanthus Rhizosphere | MPLPMIIIVVLVGAGCVVFLVQQVRNLRRQKRNLKHWEKGEPLEGVGDWD* |
| Ga0070673_1001096683 | 3300005364 | Switchgrass Rhizosphere | MPLPMIIIVVLVGAGCVVFLVQQVRNLRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0070688_1005271351 | 3300005365 | Switchgrass Rhizosphere | MPLPMLIIVVLVGAGCIAFLIQQVRTLLRRKRNMCHWEKGEPLEGVGDWD* |
| Ga0070667_1000676102 | 3300005367 | Switchgrass Rhizosphere | MPLPMLVIIILVGAGCIAFLTHQVRTLLRRKRNLRHWEKGEPLEGVGDWD* |
| Ga0070713_1007087562 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPALIIVVLVSIGAVVYLVFQVRNLRRQKRNLKHWEKGEPLEGVGDWD* |
| Ga0070713_1016414771 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LIIVVLVSIGAVVWLAFQVRNLRRQKRNLKHWEKGEPLEGVGDWD* |
| Ga0070710_106161571 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPMLIIVVIVSAGCVVWLVRQVKALRRQKRNLEHWEKGEPLEGVGEWD* |
| Ga0066682_107049462 | 3300005450 | Soil | MPLPMLIVALLVSAGCVVWLVRQVRELRRRKRNLEHWEKGEPLEGVGDWD* |
| Ga0070663_1019777781 | 3300005455 | Corn Rhizosphere | MPVQFKVIVTLVVIGCLLFLANGIRTLRRRKRNLEHWEKGEPLEGGVDDW* |
| Ga0070662_1008789621 | 3300005457 | Corn Rhizosphere | AFMPLPMLVIIILVGAGCIAFLTHQVRTLLRRKRNLRHWEKGEPLEGVGDWD* |
| Ga0070685_103472593 | 3300005466 | Switchgrass Rhizosphere | MLIIVILVSAGCVVFLVKQVRTLRRRKRNLEHWEKNEPLEGVGDWD* |
| Ga0070698_1016605931 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPMIVIVTLVSAGCVVFLVSQIRSLRRRKRNLKHWENNEPLEGVGDWD* |
| Ga0070741_103819592 | 3300005529 | Surface Soil | MPLPVIFIVGLVTAGCVVFLALQVRDLRRRRRNLRHWEKDEPLEGVTDWD* |
| Ga0070679_1001198974 | 3300005530 | Corn Rhizosphere | MPLPALIVVILVSIGAVVHLVFQVRSLRRQKRNLEHWEKGEPLEGVGEWD* |
| Ga0070684_1000076929 | 3300005535 | Corn Rhizosphere | MPLPMLILVILVGAGCIAFLIQGVRTLLRRKRNMRHWEKGEPLEGVGDWD* |
| Ga0070684_1013472592 | 3300005535 | Corn Rhizosphere | MPAQFKVIVTLVVIGCVLFLANGIRTLRRRKRNLEHWEKGEPLEGVDDW* |
| Ga0070684_1017155081 | 3300005535 | Corn Rhizosphere | RKFKLKAMPLPMLIIVILVGAGCIAFLIQQVRTLLRRKRNMRHWEKGEPLEGVGDWD* |
| Ga0070684_1022959751 | 3300005535 | Corn Rhizosphere | FKVIVTLVVIGCVLFLANGIRTLRRRKRNLEHWEKGEPLEGGVDDW* |
| Ga0068853_1016614982 | 3300005539 | Corn Rhizosphere | ALIAVVLVTAGCLVFLGNQIRTLRRRKRNLEHWEKGEPLEGTGDWD* |
| Ga0070672_1001219203 | 3300005543 | Miscanthus Rhizosphere | MPLHFVVIVALVSAGCVVFLVQQVRELLRKKRNLKHYEKGEPLEGVGDWD* |
| Ga0070672_1002540413 | 3300005543 | Miscanthus Rhizosphere | MPLPMLIIVILVSAGCVVFLVKQVRTLRRRKRNLEHWEKNEPLEGVGDWD* |
| Ga0070672_1019203982 | 3300005543 | Miscanthus Rhizosphere | MPLQFKVIVTLVVIGCLAFLANGIRTLRRRKRNLEHWEKGEPLEGVDDW* |
| Ga0070665_1007546431 | 3300005548 | Switchgrass Rhizosphere | AGCVVFLVKQVRTLRRRKRNLEHWEKNEPLEGVGDWD* |
| Ga0068855_1005501672 | 3300005563 | Corn Rhizosphere | MPLPALIVVTLVSIGAVVYLIVQVRTLRRQKRNLEHWEKGEPLEGVGDWD* |
| Ga0070664_1020009552 | 3300005564 | Corn Rhizosphere | MPLPMLIVAILVGAGCVVFLVQQVRTLLRRKRNIRHWEKGEPL |
| Ga0070664_1023012621 | 3300005564 | Corn Rhizosphere | MPAQFKVIVTLVVIGCVLFLANGIRTLRRRKRNLEHWEKGEPLEGVGDWD* |
| Ga0068856_1002803073 | 3300005614 | Corn Rhizosphere | MPLPALIVVTLVSIGAVVYLIVQVRTLRRQKRNLEHWEKGEPLEGVG |
| Ga0068856_1016548012 | 3300005614 | Corn Rhizosphere | MPLPALIIVILVSIGAVVWLGFQVRTLRRQKRNRIHWEKGEPLEGVGDWD* |
| Ga0068856_1020122081 | 3300005614 | Corn Rhizosphere | MPLPMIVIVAIVSLGAVVFLVQQVRSLRRRKRNLKHWERNEPLE |
| Ga0070702_1007221523 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPMLIIVILVSAGCVVFLVRQVRALRRQKRNMRHWEKGEPLEGVGDWD* |
| Ga0068852_1002864132 | 3300005616 | Corn Rhizosphere | MPLPALIAVVLVTVGCLVFLGNQVRTLRRRKRNLEHWEKGEPLEGTGDWD* |
| Ga0068864_1013384482 | 3300005618 | Switchgrass Rhizosphere | VKVQTRRMSIPMLVVIIVVGAGCIVWLAQQVRALRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0066905_1016796462 | 3300005713 | Tropical Forest Soil | MPLPMLIIVILVSAGCVVFLVQQVRTLRRQKRNLKHWEKGEPLEGTGDWD* |
| Ga0066903_1001517685 | 3300005764 | Tropical Forest Soil | MPLPMLIIAVLVSAGCAVWLFKQVQALRRRKRNLEHWEKGEPLEGVGDWD* |
| Ga0066903_1017803331 | 3300005764 | Tropical Forest Soil | LAKRLVQTGVVPVAVIVIVCLVSTGCVIWLANQIRSLRRQRRNLRHWEKDEPLEGTGDWD |
| Ga0066903_1053097832 | 3300005764 | Tropical Forest Soil | MPVPVIVILVIVSAGCVAFLANGVRALRRRRRNLKHWENDEPLEGTGEWD* |
| Ga0080027_103783681 | 3300005993 | Prmafrost Soil | MPLPAVVAVTIAVIGSAAFLTNTVRTMLRRRRNMKHWEKGEPLEGGIGEWD* |
| Ga0066651_107917481 | 3300006031 | Soil | MPLPMLIIVIVVGAGCVAFLVKQVRTLQRRKRNIRHWEKGEPLEGVGEWD* |
| Ga0066652_1000762344 | 3300006046 | Soil | MPLPMLIIVIVVSAGCVVFLAQQIRTLRRRKRNLEHWEKGEPLEDVGDWD* |
| Ga0097621_1002474763 | 3300006237 | Miscanthus Rhizosphere | MPLPMLIIVVIVSAGCVVWLVRQVRALRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0075428_1003071583 | 3300006844 | Populus Rhizosphere | MPLPMIVIVVLVGAGCVVFLVQQVRNLRRQKRNLKHWEKGEPLEGVGDWD* |
| Ga0075425_1024463822 | 3300006854 | Populus Rhizosphere | MVIIVILVSAGCVVFLVRQVRELRRQKRNLEHWEKGEPLEGVGEWD* |
| Ga0075424_1009515211 | 3300006904 | Populus Rhizosphere | TRRMPLPMLIIVILVSAGCVVFLMQQVRALRRRRRNLKHWENGEPLEGTGDWD* |
| Ga0075419_107847092 | 3300006969 | Populus Rhizosphere | MPLPMIVIVVLVGAGCVVFLVQQVRILRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0105240_100547333 | 3300009093 | Corn Rhizosphere | MPLPAIVAVTVVSIGCAVFLGNGVRSLRRRRRNLRHWEKGEPLEGVGDWD* |
| Ga0111539_100504956 | 3300009094 | Populus Rhizosphere | MIVIVVLVGAGCVVFLVQQVRNLRRQKRNLKHWEKGEPLEGVGDWD* |
| Ga0111539_111405212 | 3300009094 | Populus Rhizosphere | MPLPMLVIVILVSAGCVVFLVQQVRTLRRRKRNLEHWEKDEPLEGVGDWD* |
| Ga0111539_121764972 | 3300009094 | Populus Rhizosphere | MIIIVVLVGAGCVVFLVQQVRNLRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0111538_139715032 | 3300009156 | Populus Rhizosphere | MPLPMLVIVILVSAGCVVFLAQQVRTLRRRKRNLEHWEKDEPLEGVGDWD* |
| Ga0105248_109748411 | 3300009177 | Switchgrass Rhizosphere | MPLPMVIIVILVSAGCVVFLMQQVRALRRRRRNLKHWENGEPLEGTGDWD* |
| Ga0105347_10791781 | 3300009609 | Soil | MIIIVVLVGAGCVVFLVQQVRTLRRQKRNLKHWEKGEPLEGVGDWD* |
| Ga0126382_111948201 | 3300010047 | Tropical Forest Soil | MPLPILIIVILVSAGCLVFLVQQVRALRRRKRNLEHWEKNEPLEGVGDWD* |
| Ga0126382_120054541 | 3300010047 | Tropical Forest Soil | ILVSAGCVVFLAQQVRALRRRKRNLEHWEKGEPLEGVGDWD* |
| Ga0126377_106194883 | 3300010362 | Tropical Forest Soil | MPVPMLIIVILVSAGCVVFLVQQVRSLRRQKRNLKHWEKGEPLEGVGDWD* |
| Ga0126379_101015252 | 3300010366 | Tropical Forest Soil | MPVPAIVIVVLVSVGCVVFLANQIRTLRRRQRNLKHWERDEPLEGHGGDWD* |
| Ga0134125_102132942 | 3300010371 | Terrestrial Soil | MPLPALIVVLLVSIGAVVHLVFQVRALRRQKRNLEHWEKGEPLEGVGDWD* |
| Ga0134124_113080972 | 3300010397 | Terrestrial Soil | MPLPVIFIVGLVTAGCVVFLALQVRDLRRRRRNLRHWERDEPLEGVTDWD* |
| Ga0126383_101666711 | 3300010398 | Tropical Forest Soil | PKVQTGSMPLPMLIIVVLVSAGCVVWLVRQVQALRRQKRNLEHWEKGEPLEGVGDWD* |
| Ga0134127_100604971 | 3300010399 | Terrestrial Soil | MSIPMLVVIIVVGAGCIVWLAQQVRALRRQKRNLRHWEKGEP |
| Ga0134127_103020623 | 3300010399 | Terrestrial Soil | IPMLVVIIVVGAGCIVWLAQQVRALRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0134127_104024872 | 3300010399 | Terrestrial Soil | MPLLMKILVILVSAGCVVFLVQQVRALRRRKRNLEHWEKGEPLEGVGDWD* |
| Ga0134121_102362203 | 3300010401 | Terrestrial Soil | MPLPMLIIVILVSAGCVVFLMQQVRALRRRRRNLKHWENGEPLEGVGDWD* |
| Ga0134121_121832971 | 3300010401 | Terrestrial Soil | AGMPLHFKVIVALVVIGCVAFLVNGVLTLRRRKRNLAHWEKGEPLEGVGDWD* |
| Ga0134121_123854892 | 3300010401 | Terrestrial Soil | MPLPMIVIVAIVAVGCVVFLVQQVRSLRRQKRNLKHWERDEPLEGVGDWD* |
| Ga0126359_15509432 | 3300010869 | Boreal Forest Soil | MPVPAIVAVTLVSIGCAVFLSNGIRTLRRRKRNLEHYEKGEPLEGGRDDWD* |
| Ga0126359_16118611 | 3300010869 | Boreal Forest Soil | MPLPAIVAVSIAVAGSAVFLTNTIRDLRRRKRNLEHYEKGEPLEGGADDWD* |
| Ga0126359_17321002 | 3300010869 | Boreal Forest Soil | MPLPAIVAVSVAVAGSVVFLTNSVRTLRRRKRNLVHWEKGEPLEGGADDWD* |
| Ga0126356_114197332 | 3300010877 | Boreal Forest Soil | MPVPAIVAVTIAVIGSLVFLGNGVRTLRRRKRNLEHWEKGEPLEGVGDWD* |
| Ga0137432_11653661 | 3300011439 | Soil | MIIIVALVGSGCVVFLVQQVRNLRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0137433_10015059 | 3300011440 | Soil | MIIIVVLVGAGCVVFLVQQVRALRRQKRNLEHWEKGEPLEGVGDWD* |
| Ga0137374_100549245 | 3300012204 | Vadose Zone Soil | MPVPMIVITVIVSIGCVLFLVAQVRTLRRRKRNLEHWEKGEPLEGVGEWD* |
| Ga0137465_10286192 | 3300012231 | Soil | MIIIVVLVGSGCVVFLVQQVRNLRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0137367_100966022 | 3300012353 | Vadose Zone Soil | MPLPMLIIVIVVGAGCIAFLVKQVRTLQRRKRNIRHWEKGEPLEGVGDWD* |
| Ga0150984_1062660142 | 3300012469 | Avena Fatua Rhizosphere | PAAVALTITVIGAAAFLANGIRTLRRRKRNLAHWEKGEPLEGVGDWD* |
| Ga0137397_103108972 | 3300012685 | Vadose Zone Soil | MPLPAIVAVSLAVIGSAVFLGNGIRQLRRRKRNLEHWEKGEPLEGVGDWD* |
| Ga0157293_101816921 | 3300012898 | Soil | MPLPMLIVAILVGAGCVVFLVQQVRTLLRRKRNIRHWEKGEPLEGVGDW |
| Ga0137359_107886411 | 3300012923 | Vadose Zone Soil | TRSVQTLRMPVPAIVLVTVVSLGCVLFIAQQVRTLRRRKRNLRHWEKGEPLEGVGDWD* |
| Ga0137410_116090451 | 3300012944 | Vadose Zone Soil | AVSLAVIGSAVFLGNGIRQLRRRKRNLEHWEKGEPLEGVGDWD* |
| Ga0164298_116391452 | 3300012955 | Soil | MPLPMLIIVIVVGAGCVAFLIKQVGTLPRRKRNIRHWEKGEPLEGVGDWD* |
| Ga0164303_114606831 | 3300012957 | Soil | PAPVQTRPMPLPMIVIVAIVSLGAVVFLAQQVRSLRRRKRNLKHWERNEPLEGVGDWD* |
| Ga0164301_117764221 | 3300012960 | Soil | PLPMLIIVILVSAGCVVFLVQQVRALQRRKRNLRHWEKGEPLEGTGDWD* |
| Ga0168317_10953942 | 3300012982 | Weathered Mine Tailings | MPVPALVAVVLVSIGAVVWLVFQVRTLRRQKRNLQHWEKGEPLEGVGDWD* |
| Ga0157378_120210942 | 3300013297 | Miscanthus Rhizosphere | MPLPALIAVSIAVIGSTVFLANGVRTLRRRRRNLEHWEKGEPLEGVGDWD* |
| Ga0075351_11896572 | 3300014318 | Natural And Restored Wetlands | MLVIIVVVGAGCIVWLVQQVRSLRRQKRNLRHWEKGEPLEGVGDWD* |
| Ga0157377_105492802 | 3300014745 | Miscanthus Rhizosphere | MPLPAAVALTITVVGCAAFLTNGIRALRRRKRNLEHWKKGEPLEGVGDWD* |
| Ga0157376_121935561 | 3300014969 | Miscanthus Rhizosphere | MLIIVVLVGAGCIAFLIQQVRTLLRRKRNMRHWEKGEPLEGVGDWD* |
| Ga0173480_105769272 | 3300015200 | Soil | MPLPMLIIVILVSAGCVVFLARQVRTLRRRKRNLEHWEKDEPLEGVGDWD* |
| Ga0137409_101953813 | 3300015245 | Vadose Zone Soil | MPLPAIVAVSIAVIGSAVFLGNGIRTLRRRKRNLEHWEKGEPLEGVGDWD* |
| Ga0137409_103082313 | 3300015245 | Vadose Zone Soil | MPLPAIVAVTIAVIGATVFLANGVRTLRRRKRNLAHWEKGEPLEGVGDWD* |
| Ga0132258_102888493 | 3300015371 | Arabidopsis Rhizosphere | MPLPMLVIIILVSAGCVVFLAQQVRTLRRRKRNLEHWEKGEPLEDVGDWD* |
| Ga0132258_103235574 | 3300015371 | Arabidopsis Rhizosphere | MPLQFKVIVTVVVIGCVLFLANGIRTLRRRKRNLEHWEKGEPLEGGVDDW* |
| Ga0132258_111338612 | 3300015371 | Arabidopsis Rhizosphere | MPLPMLVIVIIVSAGCVVFLARQVRTLRRRKRNLKHWENGEPLEGTGDWD* |
| Ga0132258_117537482 | 3300015371 | Arabidopsis Rhizosphere | MPLPMLVIVILVSAGCVVFLVQQVRALRRQKRNMKHWEKGEPLEGTGDWD* |
| Ga0132258_121085972 | 3300015371 | Arabidopsis Rhizosphere | MPVHFKVIVTLVVIGCLLFLANGVRTLRRRKRNLEHWEKGEPLEGGVDDW* |
| Ga0132256_1010336092 | 3300015372 | Arabidopsis Rhizosphere | MPLPVIVVVAIVSLGAVVFLVQQVRSLRRRKRNLKHWERNEPLEGVGDWD* |
| Ga0132256_1016849861 | 3300015372 | Arabidopsis Rhizosphere | MPLPMLIIVILVSAGCVVFLVRGVRTLRRQKRNIKHWEKGEPLEGVGDWD* |
| Ga0132257_1011986021 | 3300015373 | Arabidopsis Rhizosphere | MPLPMLVIVIIVSAGCVVFLARQVRTLRRRKRNLKHWENGEPL |
| Ga0132257_1042924421 | 3300015373 | Arabidopsis Rhizosphere | RVMPLPMLVIVILVSAGCVVFLVQQVRTLRRRKRHLEHWEKDEPLEGVGDWD* |
| Ga0132255_1006396221 | 3300015374 | Arabidopsis Rhizosphere | MPLPMLVIIILVSAGCVVFLAQQVRPLRRRKRNLEHWEKGEPLEDVGDWD* |
| Ga0132255_1019343302 | 3300015374 | Arabidopsis Rhizosphere | MPAHFKVIVTLVVIGCLVFLANGIRTLRRRKRNLERWEKGEPLEGVDDW* |
| Ga0132255_1059437402 | 3300015374 | Arabidopsis Rhizosphere | LIIVILVSAGCVVFLMQQVRALRRRRRNLKHWENGEPLEGTGDWD* |
| Ga0182032_119014441 | 3300016357 | Soil | LVVLGCVVWLTRQVRELRRQKRNLIHWEKGEPLEGAGDWD |
| Ga0182037_109431372 | 3300016404 | Soil | MPLPAIVAVSITVIGSVVFLGNGIRTLRRRKRNLEHWKKGEPLEGVGDWD |
| Ga0190266_100251902 | 3300017965 | Soil | MPLPMMVIVVLVSAGCVVFLVQQVRDLRRKKRNLKHFEKGEPLEGVGDWD |
| Ga0187765_111063282 | 3300018060 | Tropical Peatland | MLVIVLLVSAGCVVWLVRQVRTLRRQKRNLRHWEKGEPLEGVGDWD |
| Ga0184611_12824142 | 3300018067 | Groundwater Sediment | MPLHFVVIVALVSAGCVVFLVQQVRHLLRKKRNLKHFERGEPLEGVGDWD |
| Ga0184624_101045932 | 3300018073 | Groundwater Sediment | MPLPMLIIVIVVGAGCVVFLVQQVRTLQRRKRNIRHWEKGEPLEGVGDWD |
| Ga0184624_101440412 | 3300018073 | Groundwater Sediment | MPLHFVVIVALVSAGCVVFLVQQVRELLRKKRNLKHYEKGEPLEGVGDWD |
| Ga0184625_100983462 | 3300018081 | Groundwater Sediment | MPLSMLIIVIVVGAGCIVFLVKQVRTLQRRKRNIRHWEKGEPLEGVGDWD |
| Ga0184628_100130804 | 3300018083 | Groundwater Sediment | MPLPMIIIVVLVGAGCVVFLVQQVRTLRRQKRNLKHWEKGEPLEGVGDWD |
| Ga0190274_109522372 | 3300018476 | Soil | MPLPMLVIVILVSAGCVVFLAQQVRTLRRRKRNLEHWEKDEPLEGVGDWD |
| Ga0190274_112433962 | 3300018476 | Soil | MPLQFKVIVTLVVIGCLAFLANGIRTLRRRKRNLEHWEKGEPLEGVDDW |
| Ga0190274_133807842 | 3300018476 | Soil | MPLHFVVIVALVSAGCVLFLVQQVRELLRKKRNLKHFEKGEPLEGVGDWD |
| Ga0190271_113563922 | 3300018481 | Soil | MPLPMIIIVVLVGAGCVVFLVQQVRMLRRQKRNLKHWEKGEPLEGVGDWD |
| Ga0173481_108847592 | 3300019356 | Soil | MPLPMIVIVVLVGAGCVVFLVQQVRTLRRQKRNLKHWEKGEPLEGVGDWD |
| Ga0173482_102751322 | 3300019361 | Soil | MSIPMLVVIIVVGAGCIVWLAQQVRALRRQKRNLRHWEKGEPLEGVGDWD |
| Ga0173482_107013262 | 3300019361 | Soil | MPLPMLILVILVGAGCIAFLIQGVRTLLRRKRNMRHWEKGEPLEGVGDWD |
| Ga0193697_10068454 | 3300020005 | Soil | MPLPMLVVIVLVSAGCLVFLVRGVRDLRRKKRNLEHYEKGEPLAG |
| Ga0193696_10551201 | 3300020016 | Soil | MPLPMLVVIVLVSAGCLVFLVRGVRDLRRKKRNLEHYEKGEPLEGVG |
| Ga0206355_12029671 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPALIVVTLVSIGAVVYLIHQVRTLRRQKRNLEHWEKGEPLEGVGDWD |
| Ga0210395_102825983 | 3300020582 | Soil | CSAFIASQVRTLRRRKRNLAHWEKDEPLEGVGDWD |
| Ga0213876_101455552 | 3300021384 | Plant Roots | MPLPMLIIVILVGAGCIAFLIQQVRTLMRRKRNIRHWEKGEPLEGVGDWD |
| Ga0222622_100690532 | 3300022756 | Groundwater Sediment | MPLPMLVIVILVSAGCVVFLVQQIRTLRRRKRNLEHWEKDEPLEGVGDWD |
| Ga0222622_100759891 | 3300022756 | Groundwater Sediment | MPLPMIVIVVLVGAGCVVFLVQQVRNLRRQKRNLRHWEKGEPLEGVGDWD |
| Ga0247790_100496392 | 3300022915 | Soil | MPVHFKVILTLVVIGCVLFLANGIRTIRRRKRNLEHWEKGEPLEGGVDDW |
| Ga0247794_101704482 | 3300024055 | Soil | MPLPMLIVAILVGAGCVVFLVQQVRTLLRRKRNIRHWEKGEPLEGVGDWD |
| Ga0247688_10342461 | 3300024186 | Soil | MPLPMLIVVILVGAGCVAFLTQQVRTLLRRKRNIRHWE |
| Ga0247672_10051002 | 3300024187 | Soil | MPLPMLIVVILVGAGCVAFLTQQVRTLLRRKRNIRHWEKGEPLEGVGDWD |
| Ga0247671_10631622 | 3300024284 | Soil | AFMPLPMLIVVILVGAGCVAFLTQQVRTLLRRKRNIRHWEKGEPLEGVGDWD |
| Ga0247660_10494352 | 3300024317 | Soil | LIVVILVGAGCVAFLTQQVRTLLRRKRNIRHWEKGEPLEGVGDWD |
| Ga0207666_10062972 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPMLVIIILVGAGCIAFLTHQVRTLLRRKRNLRHWEKGEPLEGVGDWD |
| Ga0207697_102037382 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPMLIIVVLVGAGCIAFLIQQVRTLLRRKRNMRHWEKGEPLEGVGDWD |
| Ga0207692_105779472 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPMLIIVVIVSAGCVVWLVRQVKALRRQKRNLEHWEKGEPLEGVGE |
| Ga0207688_107289041 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | AFMPLPMLVIIILVGAGCIAFLTHQVRTLLRRKRNLRHWEKGEPLEGVGDWD |
| Ga0207680_102326232 | 3300025903 | Switchgrass Rhizosphere | MPLPMLIIVILVSAGCVVFLMQQVRALRRRRRNLKHWENGEPLEGTGDWD |
| Ga0207707_108804682 | 3300025912 | Corn Rhizosphere | VQTEDMPLPMLIIVILVSAGCVVFLVQQVRALQRRKRNIRHWEKDEPLEGTGDWD |
| Ga0207671_105877911 | 3300025914 | Corn Rhizosphere | FMPLPAIVAVTVVSIGCAVFLGNGVRSLRRRRRNLRHWEKGEPLEGVGDWD |
| Ga0207663_117007372 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RRPGSNCASMPLPALIIVVLVSIGAVVYLVFQVRNLRRQKRNLKHWEKGEPLEGVGDWD |
| Ga0207662_108194791 | 3300025918 | Switchgrass Rhizosphere | VKVQTRRMSIPMLVVIIVVGAGCIVWLAQQVRALRRQKRNLRHWEKGEPLEGVGDWD |
| Ga0207650_100226044 | 3300025925 | Switchgrass Rhizosphere | MPLHFVVIVTLVSAGCVVFLVQQVRHLLRKKRNLKHFEKGEPLEGVGDWD |
| Ga0207650_101108652 | 3300025925 | Switchgrass Rhizosphere | VPMLIIVVLVSAGCVVFLVQQVRDLRRKKRNLEHWEKGEPLEGVGDWD |
| Ga0207659_108117502 | 3300025926 | Miscanthus Rhizosphere | MIVIVVLVGAGCVVFLVQQVRTLRRQKRNLKHWEKGEPLEGVGDWD |
| Ga0207659_111325212 | 3300025926 | Miscanthus Rhizosphere | MPLPMLVIIIVVGGGCVAFLVQQVRSLRRQKRNLRHWEKGEPLEGVGDWD |
| Ga0207700_113238872 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PGSNCASMPLPALIIVVLVSIGAVVYLVFQVRNLRRQKRNLKHWEKGEPLEGVGDWD |
| Ga0207701_113614012 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPMLIIVILVSAGCVVFLVKQVRTLRRRKRNLEHWEKNEPLEGVGDWD |
| Ga0207701_117282501 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | QTVRKMPLGFKIVVALVSLGCIIFLVGQVRTLRRQKRNLEHWEKGEPLEGVGDWD |
| Ga0207661_103126172 | 3300025944 | Corn Rhizosphere | MPLPMLIVAILVGAGCVVFLVQQVRTLLRRKRNIRHWERGEPLEGVGDWD |
| Ga0207661_112021882 | 3300025944 | Corn Rhizosphere | MPLPMLIIVILVSAGCVVFLVQQVRALQRRKRNIRHWEKDEPLEGTGDWD |
| Ga0207661_112237371 | 3300025944 | Corn Rhizosphere | MPLPALIIVILVSIGAVIWLGFQVRTMRRQKRNLVHWEKGEPLEGVGDWD |
| Ga0207679_111917111 | 3300025945 | Corn Rhizosphere | MPAQFKVIVTLVVIGCVLFLANGIRTLRRRKRNLEHWEKGEPLEGVDDW |
| Ga0210089_10098172 | 3300025957 | Natural And Restored Wetlands | MLIIIILVSAGCVVFVVQQVRALRRQKRNLKHWEKGEPLEGVGDWD |
| Ga0207651_101464772 | 3300025960 | Switchgrass Rhizosphere | MPLPMIIIVVLVGAGCVVFLVQQVRNLRRQKRNLRHWEKGEPLEGVGDWD |
| Ga0207651_116125182 | 3300025960 | Switchgrass Rhizosphere | MPLPMLIIVILVSAGCVVFLMQQVRALRRRRRNLKHWENGEPLEGTGD |
| Ga0207639_118548492 | 3300026041 | Corn Rhizosphere | AVWQTACMPVQFKVIVTLVVIGCLLFLANGIRTLRRRKRNLEHWEKGEPLEGGVDDW |
| Ga0207678_115059092 | 3300026067 | Corn Rhizosphere | MPVQFKVIVTLVVIGCLLFLANGIRTLRRRKRNLEHWEKGEPLEGGVDDW |
| Ga0207708_114858871 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | AGCVVFLVQQVRTLRRQKRNLKHWEKGEPLEGVGDWD |
| Ga0207702_111932092 | 3300026078 | Corn Rhizosphere | MPLPALIIVILVSIGAVVWLGFQVRTLRRQKRNRIHWEKGEPLEGVGDWD |
| Ga0207641_104713683 | 3300026088 | Switchgrass Rhizosphere | MPLPMLVIVILVSAGCVVFLVQQVRTLRRRKRNLEHWEKNEPLEGVGDWD |
| Ga0207641_116249252 | 3300026088 | Switchgrass Rhizosphere | MIIIVVLVGAGCVVFLVQQVRNLRRQKRNLRHWEKGEPLEGVGDWD |
| Ga0207648_100356701 | 3300026089 | Miscanthus Rhizosphere | MPLPMLVIIILVGAGCIAFLTHQVRTLLRRKRNLRHWEKGEPLE |
| Ga0207676_107161291 | 3300026095 | Switchgrass Rhizosphere | MLVVIIVVGAGCIVWLAQQVRALRRQKRNLRHWEKGEPLEGVGDWD |
| Ga0207676_121120372 | 3300026095 | Switchgrass Rhizosphere | MPLQFKVIVTLVVIGCLLFLANGIRTLRRRKRNLEHWEKGEPLEGVGDWD |
| Ga0209849_10085863 | 3300026215 | Soil | MPLPAIVAVSLAVIGSAVFLGNGIRTLRRRKRNLEHWEKNEPLEGVGDWD |
| Ga0209863_100126354 | 3300026281 | Prmafrost Soil | MPLPAIVAVSLAVIGSAVFLGNGIRTLRRRKRNLEHYEKGEPLEGVGDWD |
| Ga0209863_100714921 | 3300026281 | Prmafrost Soil | MPVPAIVAVTLVSIGCAVFLSNGIRTLRRRKRNLEHYEKGEPLEGGRDDWD |
| Ga0179587_109371922 | 3300026557 | Vadose Zone Soil | AFEKCAVQTACMPLPAIVAVSLAVIGSAVFLGNGIRQLRRRKRNLEHWEKGEPLEGVGDW |
| Ga0209465_1000034913 | 3300027874 | Tropical Forest Soil | MPLPMLIIAVLVSAGCAVWLFKQVQALRRRKRNLEHWEKGEPLEGVGDWD |
| Ga0207428_101136472 | 3300027907 | Populus Rhizosphere | MPLPMIVIVVLVGAGCVVFLVQQVRNLRRQKRNLKHWEKGEPLEGVGDWD |
| Ga0268265_121401802 | 3300028380 | Switchgrass Rhizosphere | LVGAGCIAFLTHQVRTLLRRKRNLRHWEKGEPLEGVGDWD |
| Ga0247826_106169412 | 3300030336 | Soil | MLVIVVLVSAGCLVFLIRGVRDLRRRKRNLEHFEKGEPLEGVGDWD |
| Ga0265320_101602932 | 3300031240 | Rhizosphere | MPLPAIVAVSITVIGSVVFLGNGIRTLRRRKRNLERWKKGEPLEGVGDWD |
| Ga0307506_100682422 | 3300031366 | Soil | MPLHFKVIVTLVVIGCVAFLVNGVRTLRRRKRNLAHWEKGEPLEGVDDWD |
| Ga0310888_108188772 | 3300031538 | Soil | MPLPMLVIIILVGAGCIAFLTHQVRTLLRRKRNLRHWEK |
| Ga0318516_102218452 | 3300031543 | Soil | MPLPALIIVVAVSIGCVIFLVQQVRNLRRQKRNLEHWEKGEPLEGVGDWD |
| Ga0318516_103902781 | 3300031543 | Soil | SLPRKDKLNPMPLAVKVIVALVVLGCVVWLTRQVRELRRQKRNLIHWEKGEPLEGAGDWD |
| Ga0310886_101397471 | 3300031562 | Soil | RVQTAFMPLPMLVIIILVGAGCIAFLTHQVRTLLRRKRNLRHWEKGEPLEGVGDWD |
| Ga0318515_102728941 | 3300031572 | Soil | MPLPALIIVAVVSIGCVIFLVQQVRNLRRQKRNLEHWEKGEPLEGVGD |
| Ga0318542_103579172 | 3300031668 | Soil | MPLPALIIVAVVSIGCVIFLVQQVRNLRRQKRNLEHWEKGEPLEGVGDWD |
| Ga0310813_102436783 | 3300031716 | Soil | MPLPMLIIVILVSAGCVVFLVRQVRALRRQKRNMRHWEKGEPLEGVGDWD |
| Ga0310813_111720782 | 3300031716 | Soil | MPLPMLIIVILVSAGCVVFLVQQVRALQRRKRNIRHWEKDE |
| Ga0310813_115058342 | 3300031716 | Soil | RMPLPMLIIVVLVSAGCVVWLAQQVRKLRRQKRNMRHWEKGEPLEGVGDWD |
| Ga0307469_115535451 | 3300031720 | Hardwood Forest Soil | MPLPMIVIVAVVSIGAIVFLVQQVRNLRRQKRNLKHWERNEPLEGVGDWD |
| Ga0307468_1013450612 | 3300031740 | Hardwood Forest Soil | MLIIVIVVGAGCVVFLVQQVRTLQRRKRNIRHWEKGEPLEGVGDWD |
| Ga0307468_1013471881 | 3300031740 | Hardwood Forest Soil | MPLPMIIIVTLVSAGCVAFLVFQVRSLRRQKRNLKHWENNEPLEGVGD |
| Ga0318554_105027811 | 3300031765 | Soil | ITVIGSIVFLGNGIRTLRRRKRNLEHWKKGEPLEGVGDWD |
| Ga0318565_104348242 | 3300031799 | Soil | MPLPALIIVVIVSAGCVVFLVRQVRNLRRQKRNLEHWEKGEPLEGVGEWD |
| Ga0306919_105743221 | 3300031879 | Soil | MPLAVKVIVALVVLGCVVWLTRQVRELRRQKRNLIHWEKGEPLEGAGDWD |
| Ga0310909_105592101 | 3300031947 | Soil | VQTRFMPLPALIIVVAVSIGCVIFLVQQVRNLRRQKRNLEHWEKGEPLEGVGDWD |
| Ga0308176_123260552 | 3300031996 | Soil | MPMPMLVVIILVSAGCVVFLVQQVRDLRRKKRNLEHYEKGEPLEGVGDWD |
| Ga0318524_103864132 | 3300032067 | Soil | MPLPAIVAVSITVIGAVVFLGNGIRTLRRRRRNMEHWKKGEPLEGVGDWD |
| Ga0306920_1009290132 | 3300032261 | Soil | MPLFAAVALTITVAGSVAFLANSVRQLRRRKRNLEHWEKGEPLEGVGDWD |
| Ga0306920_1024859132 | 3300032261 | Soil | SITVIGSIVFLGNGIRTLRRRKRNLEHWKKGEPLEGVGDWD |
| Ga0335075_107427842 | 3300032896 | Soil | MPLPALIAVALVSIGCLVFLFRQVRSLRRQKRNLAHWEKDEPLEGVGDWD |
| Ga0335083_100022547 | 3300032954 | Soil | MPLPALIIVLLVSLGCVVWLVFQVRNLRRQKRNLEHWEKGEPLEGVGDWD |
| Ga0335076_101150933 | 3300032955 | Soil | MPLPALIIVVLVSAGAVVYLIGQVRNLRRQKRNLQHWERGEPLEGAGDWD |
| Ga0335076_103680351 | 3300032955 | Soil | MPVPAIVIVVLVSAGCVAFLANQVRTLRRRRRNLKHWENNEPLEGTGEWD |
| Ga0335076_108217872 | 3300032955 | Soil | MPVPAIVIIALVSMGCVVFLGNQIRTLRRRRRNLKHWENDEPLEGTGDWD |
| Ga0335076_114578262 | 3300032955 | Soil | PVQTARMPIPAAVALTITVAGAVAFLANGIRALRRRKRNLEHWEKGEPLEGVGDWD |
| Ga0335076_114719061 | 3300032955 | Soil | PLPALIIVLLVSLGSVVYLVFQVRNLRRRKRNLEHWEKGEPLEGVGEWD |
| Ga0335084_124602092 | 3300033004 | Soil | MPLPMIIIVILVGAGCVVFLVQQVRSLRRQKRNLRHWEKGEPLEGVGDWD |
| Ga0318519_103067032 | 3300033290 | Soil | MPLPALIIVVAVSIGCVIFLVQQVRNLRRQKRNLEHWEKGEPLEVA |
| Ga0310810_112535551 | 3300033412 | Soil | PLPMVIIVILVSAGCVVFLVRQVRELRRQKRNLEHWEKGEPLEGVGEWD |
| Ga0373950_0000003_219085_219237 | 3300034818 | Rhizosphere Soil | MPIPAAVAVTIAVIGGVVFLANGVRTLRRRKRNLVHWEKGEPLEGVGDWD |
| Ga0373950_0107014_213_365 | 3300034818 | Rhizosphere Soil | MPLPAIVAVSIAVIGGVAFLTNGVRALRRRKRNLERWEKGEPLEGVGDWD |
| ⦗Top⦘ |