


| Basic Information | |
|---|---|
| Family ID | F019378 |
| Family Type | Metagenome |
| Number of Sequences | 230 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LPSGTVDEKLQREMIAVAAQRVKAAQPVPPERVFDFSFAQKVSESLR |
| Number of Associated Samples | 188 |
| Number of Associated Scaffolds | 230 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 89.13 % |
| % of genes from short scaffolds (< 2000 bps) | 82.61 % |
| Associated GOLD sequencing projects | 179 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.174 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.913 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.565 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.348 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 230 Family Scaffolds |
|---|---|---|
| PF01717 | Meth_synt_2 | 30.00 |
| PF09084 | NMT1 | 21.30 |
| PF00903 | Glyoxalase | 2.61 |
| PF03446 | NAD_binding_2 | 2.17 |
| PF00072 | Response_reg | 1.74 |
| PF00211 | Guanylate_cyc | 1.74 |
| PF01970 | TctA | 1.74 |
| PF14833 | NAD_binding_11 | 1.30 |
| PF03401 | TctC | 0.87 |
| PF07331 | TctB | 0.87 |
| PF01321 | Creatinase_N | 0.87 |
| PF04879 | Molybdop_Fe4S4 | 0.87 |
| PF00676 | E1_dh | 0.87 |
| PF00248 | Aldo_ket_red | 0.87 |
| PF03328 | HpcH_HpaI | 0.87 |
| PF13417 | GST_N_3 | 0.43 |
| PF00384 | Molybdopterin | 0.43 |
| PF01977 | UbiD | 0.43 |
| PF02146 | SIR2 | 0.43 |
| PF08240 | ADH_N | 0.43 |
| PF16864 | Dimerisation2 | 0.43 |
| PF07669 | Eco57I | 0.43 |
| PF09957 | VapB_antitoxin | 0.43 |
| PF13470 | PIN_3 | 0.43 |
| PF00873 | ACR_tran | 0.43 |
| PF00034 | Cytochrom_C | 0.43 |
| PF08281 | Sigma70_r4_2 | 0.43 |
| PF04055 | Radical_SAM | 0.43 |
| PF14076 | DUF4258 | 0.43 |
| PF00173 | Cyt-b5 | 0.43 |
| PF00892 | EamA | 0.43 |
| PF00596 | Aldolase_II | 0.43 |
| PF16868 | NMT1_3 | 0.43 |
| PF03886 | ABC_trans_aux | 0.43 |
| PF00005 | ABC_tran | 0.43 |
| PF01850 | PIN | 0.43 |
| PF00528 | BPD_transp_1 | 0.43 |
| PF05359 | DUF748 | 0.43 |
| PF02629 | CoA_binding | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 230 Family Scaffolds |
|---|---|---|---|
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 30.00 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 21.30 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 21.30 |
| COG1784 | TctA family transporter | General function prediction only [R] | 1.74 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.74 |
| COG3333 | TctA family transporter | General function prediction only [R] | 1.74 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.87 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.87 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.87 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.87 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.87 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.87 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.87 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.43 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.17 % |
| Unclassified | root | N/A | 37.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_7635_length_1586_cov_7.028373 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 2189573005|GZGK9D401CZE5F | Not Available | 517 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0384805 | Not Available | 514 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0449106 | Not Available | 555 | Open in IMG/M |
| 3300000550|F24TB_11042965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1038649 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300001431|F14TB_100189477 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300002124|C687J26631_10013954 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
| 3300002223|C687J26845_10134448 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300003373|JGI25407J50210_10180865 | Not Available | 520 | Open in IMG/M |
| 3300004067|Ga0055485_10214190 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300004114|Ga0062593_100808469 | Not Available | 933 | Open in IMG/M |
| 3300005174|Ga0066680_10945255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300005295|Ga0065707_10121512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2109 | Open in IMG/M |
| 3300005295|Ga0065707_10874910 | Not Available | 574 | Open in IMG/M |
| 3300005364|Ga0070673_100365442 | Not Available | 1283 | Open in IMG/M |
| 3300005444|Ga0070694_101742453 | Not Available | 530 | Open in IMG/M |
| 3300005526|Ga0073909_10014240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2479 | Open in IMG/M |
| 3300005544|Ga0070686_100584328 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005554|Ga0066661_10034200 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
| 3300005555|Ga0066692_10836082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300005568|Ga0066703_10753839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300005617|Ga0068859_100338736 | Not Available | 1598 | Open in IMG/M |
| 3300005713|Ga0066905_100554633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 965 | Open in IMG/M |
| 3300005713|Ga0066905_100764062 | Not Available | 835 | Open in IMG/M |
| 3300005713|Ga0066905_100867414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 788 | Open in IMG/M |
| 3300005713|Ga0066905_101837921 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005890|Ga0075285_1048125 | Not Available | 567 | Open in IMG/M |
| 3300005937|Ga0081455_11003654 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005981|Ga0081538_10204645 | Not Available | 805 | Open in IMG/M |
| 3300006046|Ga0066652_100521843 | Not Available | 1107 | Open in IMG/M |
| 3300006049|Ga0075417_10107219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1271 | Open in IMG/M |
| 3300006049|Ga0075417_10626194 | Not Available | 549 | Open in IMG/M |
| 3300006049|Ga0075417_10669614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300006049|Ga0075417_10688638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300006058|Ga0075432_10383685 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006058|Ga0075432_10519730 | Not Available | 533 | Open in IMG/M |
| 3300006173|Ga0070716_100165608 | Not Available | 1437 | Open in IMG/M |
| 3300006237|Ga0097621_100811390 | Not Available | 867 | Open in IMG/M |
| 3300006358|Ga0068871_101597400 | Not Available | 617 | Open in IMG/M |
| 3300006794|Ga0066658_10343257 | Not Available | 798 | Open in IMG/M |
| 3300006794|Ga0066658_10732876 | Not Available | 549 | Open in IMG/M |
| 3300006797|Ga0066659_10814346 | Not Available | 774 | Open in IMG/M |
| 3300006845|Ga0075421_101410372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300006845|Ga0075421_101592567 | Not Available | 711 | Open in IMG/M |
| 3300006846|Ga0075430_100191583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1699 | Open in IMG/M |
| 3300006847|Ga0075431_101298333 | Not Available | 689 | Open in IMG/M |
| 3300006852|Ga0075433_10394800 | Not Available | 1221 | Open in IMG/M |
| 3300006852|Ga0075433_10554970 | Not Available | 1010 | Open in IMG/M |
| 3300006852|Ga0075433_11287228 | Not Available | 634 | Open in IMG/M |
| 3300006903|Ga0075426_10018752 | All Organisms → cellular organisms → Bacteria | 4941 | Open in IMG/M |
| 3300006904|Ga0075424_100899079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 945 | Open in IMG/M |
| 3300006914|Ga0075436_100393017 | Not Available | 1004 | Open in IMG/M |
| 3300006969|Ga0075419_10647436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300007004|Ga0079218_10082841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2137 | Open in IMG/M |
| 3300007076|Ga0075435_100078374 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
| 3300009094|Ga0111539_10111196 | All Organisms → cellular organisms → Bacteria | 3215 | Open in IMG/M |
| 3300009094|Ga0111539_13430947 | Not Available | 509 | Open in IMG/M |
| 3300009111|Ga0115026_10819395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300009147|Ga0114129_13387104 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009156|Ga0111538_13174965 | Not Available | 573 | Open in IMG/M |
| 3300009157|Ga0105092_10307569 | Not Available | 895 | Open in IMG/M |
| 3300009162|Ga0075423_11252526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300009167|Ga0113563_11417927 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300009553|Ga0105249_11975683 | Not Available | 656 | Open in IMG/M |
| 3300009777|Ga0105164_10027110 | All Organisms → cellular organisms → Bacteria | 3185 | Open in IMG/M |
| 3300009792|Ga0126374_10003805 | All Organisms → cellular organisms → Bacteria | 5049 | Open in IMG/M |
| 3300009816|Ga0105076_1110728 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300009817|Ga0105062_1070801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 661 | Open in IMG/M |
| 3300009818|Ga0105072_1085265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300010043|Ga0126380_10471964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 954 | Open in IMG/M |
| 3300010043|Ga0126380_11859555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300010046|Ga0126384_10954784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 778 | Open in IMG/M |
| 3300010046|Ga0126384_11783747 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300010304|Ga0134088_10604646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300010358|Ga0126370_12169339 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010360|Ga0126372_10607046 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300010362|Ga0126377_11235151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300010362|Ga0126377_11454403 | Not Available | 759 | Open in IMG/M |
| 3300010391|Ga0136847_11581319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300010396|Ga0134126_13061210 | Not Available | 504 | Open in IMG/M |
| 3300010397|Ga0134124_11623250 | Not Available | 677 | Open in IMG/M |
| 3300010397|Ga0134124_12233969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300010399|Ga0134127_10335883 | Not Available | 1470 | Open in IMG/M |
| 3300010400|Ga0134122_10948213 | Not Available | 838 | Open in IMG/M |
| 3300010938|Ga0137716_10114818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1967 | Open in IMG/M |
| 3300011434|Ga0137464_1210258 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300011436|Ga0137458_1267356 | Not Available | 521 | Open in IMG/M |
| 3300011438|Ga0137451_1238779 | Not Available | 573 | Open in IMG/M |
| 3300011440|Ga0137433_1305303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300011444|Ga0137463_1017775 | All Organisms → cellular organisms → Bacteria | 2524 | Open in IMG/M |
| 3300012022|Ga0120191_10023180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 905 | Open in IMG/M |
| 3300012034|Ga0137453_1013484 | Not Available | 1211 | Open in IMG/M |
| 3300012035|Ga0137445_1075373 | Not Available | 676 | Open in IMG/M |
| 3300012167|Ga0137319_1093777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300012171|Ga0137342_1029832 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300012200|Ga0137382_11091015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300012200|Ga0137382_11117555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300012201|Ga0137365_11178146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300012204|Ga0137374_10026823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6395 | Open in IMG/M |
| 3300012209|Ga0137379_10580125 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300012354|Ga0137366_10853788 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012358|Ga0137368_10016726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 7126 | Open in IMG/M |
| 3300012361|Ga0137360_10358248 | Not Available | 1222 | Open in IMG/M |
| 3300012473|Ga0157340_1016469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300012509|Ga0157334_1002852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1232 | Open in IMG/M |
| 3300012515|Ga0157338_1025485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300012519|Ga0157352_1108443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300012532|Ga0137373_10944140 | Not Available | 629 | Open in IMG/M |
| 3300012918|Ga0137396_10321259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1145 | Open in IMG/M |
| 3300012929|Ga0137404_10930119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300012930|Ga0137407_10450124 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300012930|Ga0137407_10592769 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300012944|Ga0137410_11919496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
| 3300012948|Ga0126375_10656036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 810 | Open in IMG/M |
| 3300012971|Ga0126369_10752634 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300012971|Ga0126369_11682636 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012971|Ga0126369_11832320 | Not Available | 695 | Open in IMG/M |
| 3300012986|Ga0164304_10490536 | Not Available | 895 | Open in IMG/M |
| 3300013096|Ga0157307_1120221 | Not Available | 580 | Open in IMG/M |
| 3300014154|Ga0134075_10205523 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300014861|Ga0180061_1009284 | Not Available | 1334 | Open in IMG/M |
| 3300014878|Ga0180065_1160376 | Not Available | 518 | Open in IMG/M |
| 3300014884|Ga0180104_1044612 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300015264|Ga0137403_10760955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300015357|Ga0134072_10119193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 834 | Open in IMG/M |
| 3300015372|Ga0132256_103581700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300015374|Ga0132255_100373605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2070 | Open in IMG/M |
| 3300018031|Ga0184634_10358463 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300018053|Ga0184626_10086595 | Not Available | 1325 | Open in IMG/M |
| 3300018053|Ga0184626_10131104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300018054|Ga0184621_10225762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300018059|Ga0184615_10126192 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300018064|Ga0187773_10736274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300018075|Ga0184632_10139557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1068 | Open in IMG/M |
| 3300018075|Ga0184632_10427736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300018076|Ga0184609_10027251 | All Organisms → cellular organisms → Bacteria | 2321 | Open in IMG/M |
| 3300018076|Ga0184609_10492420 | Not Available | 559 | Open in IMG/M |
| 3300018078|Ga0184612_10209917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1011 | Open in IMG/M |
| 3300018078|Ga0184612_10375532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 718 | Open in IMG/M |
| 3300018084|Ga0184629_10495520 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300018089|Ga0187774_10013323 | All Organisms → cellular organisms → Bacteria | 3092 | Open in IMG/M |
| 3300018422|Ga0190265_12334311 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300018422|Ga0190265_13460965 | Not Available | 526 | Open in IMG/M |
| 3300018431|Ga0066655_10928375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 597 | Open in IMG/M |
| 3300018469|Ga0190270_10338840 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300018482|Ga0066669_11515223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300019879|Ga0193723_1133064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300019882|Ga0193713_1147886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300019882|Ga0193713_1175377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300019885|Ga0193747_1127473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300020022|Ga0193733_1037301 | Not Available | 1372 | Open in IMG/M |
| 3300020061|Ga0193716_1080606 | Not Available | 1441 | Open in IMG/M |
| 3300020186|Ga0163153_10017288 | All Organisms → cellular organisms → Bacteria | 6195 | Open in IMG/M |
| 3300021073|Ga0210378_10149286 | Not Available | 902 | Open in IMG/M |
| 3300021073|Ga0210378_10189961 | Not Available | 786 | Open in IMG/M |
| 3300021081|Ga0210379_10361442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300021081|Ga0210379_10429555 | Not Available | 585 | Open in IMG/M |
| 3300021344|Ga0193719_10113150 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300021560|Ga0126371_10950797 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300022208|Ga0224495_10201817 | Not Available | 830 | Open in IMG/M |
| 3300022534|Ga0224452_1200441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300022534|Ga0224452_1287020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300022756|Ga0222622_10837301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10242940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 711 | Open in IMG/M |
| 3300025159|Ga0209619_10136144 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300025165|Ga0209108_10134830 | Not Available | 1310 | Open in IMG/M |
| 3300025167|Ga0209642_10278837 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300025174|Ga0209324_10028295 | All Organisms → cellular organisms → Bacteria | 3848 | Open in IMG/M |
| 3300025322|Ga0209641_10297629 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300025906|Ga0207699_10871646 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300025912|Ga0207707_10016840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6368 | Open in IMG/M |
| 3300025923|Ga0207681_10053396 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
| 3300025930|Ga0207701_11043564 | Not Available | 679 | Open in IMG/M |
| 3300025931|Ga0207644_10990663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → unclassified Syntrophomonadaceae → Syntrophomonadaceae bacterium | 705 | Open in IMG/M |
| 3300025933|Ga0207706_10458903 | Not Available | 1102 | Open in IMG/M |
| 3300025940|Ga0207691_10314483 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1343 | Open in IMG/M |
| 3300025959|Ga0210116_1004318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2438 | Open in IMG/M |
| 3300026095|Ga0207676_10752079 | Not Available | 948 | Open in IMG/M |
| 3300026118|Ga0207675_100589729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1113 | Open in IMG/M |
| 3300026296|Ga0209235_1104603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1214 | Open in IMG/M |
| 3300026313|Ga0209761_1202565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 869 | Open in IMG/M |
| 3300026320|Ga0209131_1108966 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300026330|Ga0209473_1228656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 669 | Open in IMG/M |
| 3300026529|Ga0209806_1032568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2576 | Open in IMG/M |
| 3300026535|Ga0256867_10034118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2119 | Open in IMG/M |
| 3300026714|Ga0207567_101250 | Not Available | 553 | Open in IMG/M |
| 3300027722|Ga0209819_10323140 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300027815|Ga0209726_10434405 | Not Available | 604 | Open in IMG/M |
| 3300027873|Ga0209814_10531729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300027907|Ga0207428_10462438 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300027907|Ga0207428_10867482 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300027907|Ga0207428_10999480 | Not Available | 588 | Open in IMG/M |
| 3300027909|Ga0209382_10135273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2866 | Open in IMG/M |
| 3300027957|Ga0209857_1048315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300028802|Ga0307503_10292581 | Not Available | 814 | Open in IMG/M |
| 3300031548|Ga0307408_101441257 | Not Available | 649 | Open in IMG/M |
| 3300031720|Ga0307469_10080340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2206 | Open in IMG/M |
| 3300031720|Ga0307469_10440753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1125 | Open in IMG/M |
| 3300031740|Ga0307468_100262973 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300031740|Ga0307468_100906040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300031740|Ga0307468_102038495 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031754|Ga0307475_10163028 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300031824|Ga0307413_10562217 | Not Available | 927 | Open in IMG/M |
| 3300031854|Ga0310904_11083343 | Not Available | 574 | Open in IMG/M |
| 3300031943|Ga0310885_10513688 | Not Available | 654 | Open in IMG/M |
| 3300031962|Ga0307479_10575783 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032005|Ga0307411_11505634 | Not Available | 618 | Open in IMG/M |
| 3300032012|Ga0310902_11222400 | Not Available | 530 | Open in IMG/M |
| 3300032180|Ga0307471_101232564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 912 | Open in IMG/M |
| 3300032205|Ga0307472_100057832 | All Organisms → cellular organisms → Bacteria | 2460 | Open in IMG/M |
| 3300032205|Ga0307472_102757254 | Not Available | 502 | Open in IMG/M |
| 3300032421|Ga0310812_10444814 | Not Available | 584 | Open in IMG/M |
| 3300033417|Ga0214471_10435264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1054 | Open in IMG/M |
| 3300033433|Ga0326726_11708675 | Not Available | 613 | Open in IMG/M |
| 3300034151|Ga0364935_0176170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 683 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.09% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.35% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.74% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.30% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.30% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.30% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.87% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.87% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.87% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.43% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.43% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.43% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.43% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.43% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.43% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.43% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.43% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.43% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.43% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.43% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.43% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.43% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2189573005 | Grass soil microbial communities from Rothamsted Park, UK - FG3 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300002223 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2 | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026714 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A1a-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_00604470 | 2140918013 | Soil | XLSSGSVDEKLQREMIATAAQRVKPKNPVPPERVFDFSFAHKVADSLK |
| FG3_07429640 | 2189573005 | Grass Soil | DAALQFYLQTGIVDEKVRREMIAVAAHRVKPKEVPPPERVFDFSFAQKVSDSFK |
| ICChiseqgaiiDRAFT_03848052 | 3300000033 | Soil | MTXAXXFFLXSGSVDEKLQREMIATAAQRVKPKNPVPPERVFDFSFAHKVADSLK* |
| ICChiseqgaiiDRAFT_04491061 | 3300000033 | Soil | VDEKLQREMIITAAQRTKLAQPPLPERVFDFSFAQKVGETLK* |
| F24TB_110429652 | 3300000550 | Soil | KLQREMIAVAAQRVKPKELPPPERVFDFSFAQKVADSMK* |
| KanNP_Total_noBrdU_T14TCDRAFT_10386491 | 3300000596 | Soil | ALQYYLQSGIVDEKLQREMISVAAQRVKPXQPVPAERVFDFSLAQKVSESFR* |
| F14TB_1001894773 | 3300001431 | Soil | QSGIVDEKLQREMISVAAQRVKPAQPVPAERVFDFSLAQKVSESFR* |
| C687J26631_100139544 | 3300002124 | Soil | IRRVFLETGIVDEQLQREMIADASQRIKPLQPVPPERVFDFSFAQKGSRFPR* |
| C687J26845_101344482 | 3300002223 | Soil | LQREMIADASQRIKPLQPVPPERVFDFSFAQKGSRFPR* |
| JGI25407J50210_101808651 | 3300003373 | Tabebuia Heterophylla Rhizosphere | REMIAIASQRVKPAQPVPPERVFDFTFTQKLSYLSKQGL* |
| Ga0055485_102141901 | 3300004067 | Natural And Restored Wetlands | TSGTVDEKLQREMIATAAQRTKLAQPPAPERVFDFSFAQKVAESLK* |
| Ga0062593_1008084692 | 3300004114 | Soil | FLPSGSVDEKLQREMIATAAQRVKPKNPVPPERVFDFSFAHKVADSLK* |
| Ga0066680_109452552 | 3300005174 | Soil | EKLQREMIAVAAQRVKPTPSVTPERVFDFSFARKARETLR* |
| Ga0065707_101215121 | 3300005295 | Switchgrass Rhizosphere | FTERAYDAAVGGYVLTGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASLQ* |
| Ga0065707_108749101 | 3300005295 | Switchgrass Rhizosphere | GVVDEKVQREMIATAAERIKPKEAVPPERVFDFSFIQKVRDSVR* |
| Ga0070673_1003654422 | 3300005364 | Switchgrass Rhizosphere | YLTSGMVDEKVQREMIATAAERIKPKESVPPERVFDFSFIQKVRGSVR* |
| Ga0070694_1017424532 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SGAVDEKLQREMIAVAAQRIKPKEMAPPERVFDFSFALKVAETLR* |
| Ga0073909_100142401 | 3300005526 | Surface Soil | MIAVAAQRVKPKELPPPERVFDFSFAQKVSDSFK* |
| Ga0070686_1005843282 | 3300005544 | Switchgrass Rhizosphere | ATVQSYLVTGTLDEKLQRDMIAMAAERIKPKAPVAPDRVFDFSFARKAAEALR* |
| Ga0066661_100342004 | 3300005554 | Soil | GYLLSGVVDEKLQREMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR* |
| Ga0066692_108360821 | 3300005555 | Soil | LSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASLQ* |
| Ga0066703_107538391 | 3300005568 | Soil | YLPSGAVDERLQREMISVAAQRIKPKELAPHERVFDFSFASRVADSLK* |
| Ga0068859_1003387363 | 3300005617 | Switchgrass Rhizosphere | ATVDEKLQREMIAIAAQRIKPKDPVPPERVFDFSFAQKVAESFK* |
| Ga0066905_1005546331 | 3300005713 | Tropical Forest Soil | EAAAQGYVLSGVVDEKLQREMITSAAQRVKATPPALERVFDFSFARKASVTLP* |
| Ga0066905_1007640621 | 3300005713 | Tropical Forest Soil | ALQLYLATPTVDEKLQREMIATAAQRIKPKEVPPPERVFDFSFVQKVGESLK* |
| Ga0066905_1008674142 | 3300005713 | Tropical Forest Soil | TGAVDEKLQREMISVAAQRIKPKELPPPERVFEFSFALKVAESFK* |
| Ga0066905_1018379211 | 3300005713 | Tropical Forest Soil | AALQYYLPSGSVDETLQREMIAVAAQRVKTAQPPPPERVFDFSFAQKVSETLR* |
| Ga0075285_10481251 | 3300005890 | Rice Paddy Soil | EMIATAAQRLKPKDPVPPERVFDFSFAQKVAEASK* |
| Ga0081455_110036541 | 3300005937 | Tabebuia Heterophylla Rhizosphere | AAVQGYLLSGIVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKASETLR* |
| Ga0081538_102046451 | 3300005981 | Tabebuia Heterophylla Rhizosphere | EKLQREMISAAAQRVKVAPPPLGRVFDFSFARKVSDSLR* |
| Ga0066652_1005218431 | 3300006046 | Soil | REMIAIAAQRIKPKDPVSPERVFDFSFVQKVGESMK* |
| Ga0075417_101072192 | 3300006049 | Populus Rhizosphere | YVLSGLVDEKLQREMIASAAQRVKAASPAPERVFDFSFARKVSASLQ* |
| Ga0075417_106261941 | 3300006049 | Populus Rhizosphere | YLQTGTVDEKVQREMIAVAAQRIKPKELPPPERVFDFSFAQKVSDSLK* |
| Ga0075417_106696142 | 3300006049 | Populus Rhizosphere | DEKLQREMIASAAQRVKAAPPAPERVFDFSFARKVSASFQ* |
| Ga0075417_106886382 | 3300006049 | Populus Rhizosphere | DEKLQREMIASAAQRVKAAPPAPERVFDFSFARKVSASFR* |
| Ga0075432_103836851 | 3300006058 | Populus Rhizosphere | GIVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGEALR* |
| Ga0075432_105197301 | 3300006058 | Populus Rhizosphere | VDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRGSVR* |
| Ga0070716_1001656081 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GAVDEKLQREMIAVAAQRVKPTPSVTPERVFDFSFARKAGETLR* |
| Ga0097621_1008113902 | 3300006237 | Miscanthus Rhizosphere | GTVDEKVQREMIEVAAQRVKPKAPVTPDRVFDFSFAQKVTESFK* |
| Ga0068871_1015974001 | 3300006358 | Miscanthus Rhizosphere | VQSYLVTGTLDEKLQRDMIAMAAERIKPKAPVAPDRVFDFSFARKAAEALR* |
| Ga0066658_103432572 | 3300006794 | Soil | YYLMSGSVDEKLQREMIAVAAQRVKPKELAPPERVFDFSFVQKVSELFR* |
| Ga0066658_107328761 | 3300006794 | Soil | REMIATAAQRIKPKEPVPTERVFDLSFVQKVAESLK* |
| Ga0066659_108143461 | 3300006797 | Soil | YLQSATVDEKLQREMIAIASQRIRPKEPVPPERVFDFSIVQKVGESLK* |
| Ga0075421_1014103722 | 3300006845 | Populus Rhizosphere | DEPLQREMIAIAAQRVKPAHPVPPERVFDFSFVQKATQPLR* |
| Ga0075421_1015925672 | 3300006845 | Populus Rhizosphere | QREMIAVAAQRIKPKETAPPERVFDFSFALKVAESLR* |
| Ga0075430_1001915831 | 3300006846 | Populus Rhizosphere | LQFYLQSGVVDEKLQRDMIATAAQRVKPKDPIPPERVFDFSFAQKVADSMK* |
| Ga0075431_1012983333 | 3300006847 | Populus Rhizosphere | SGSVDEKLQREMIATAAQRVKPKDPVPPERVFDFSFAQRVAETLK* |
| Ga0075431_1020405841 | 3300006847 | Populus Rhizosphere | AERVYDAAVQGYLLTGSVDEKLQREMIADAARRIKPTQPVTPDRVFDFSFVQKVVETLR* |
| Ga0075433_103948001 | 3300006852 | Populus Rhizosphere | VVDEKVQREMIATAAERIKLKEAVPPERVFDFSFIQKVRDSVR* |
| Ga0075433_105549701 | 3300006852 | Populus Rhizosphere | QTPTVDEKLQREMIATAAQRIKPKEPVPTERVFDFSFVQKVAESLK* |
| Ga0075433_112872281 | 3300006852 | Populus Rhizosphere | LYLASGVVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDVK* |
| Ga0075425_1014382451 | 3300006854 | Populus Rhizosphere | VYDAAVQGYLLTGSVDEKLQREMIADAARRIKPTQPVTPDRVFDFSFVQKVVETLR* |
| Ga0075426_100187522 | 3300006903 | Populus Rhizosphere | VIRFSPAVHGYVLSGLIEEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASLQ* |
| Ga0075426_102916702 | 3300006903 | Populus Rhizosphere | ERAYDAAVQGYLLSGVVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGEALR* |
| Ga0075424_1008990792 | 3300006904 | Populus Rhizosphere | VDEKLQREMIAVAAQRIKLAQPVTPERVFDFSFAREAGEALR* |
| Ga0075436_1003930171 | 3300006914 | Populus Rhizosphere | VQLYLQTPTVDEKLQREMIAIAAQRIKPKEPVPTERVFDFSFVQKVAESFK* |
| Ga0075419_106474362 | 3300006969 | Populus Rhizosphere | SGVVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGEALR* |
| Ga0079218_100828411 | 3300007004 | Agricultural Soil | QRDMIATAAQRVKPKDPVPPERVFDFSFAQKVADSMK* |
| Ga0075435_1000783741 | 3300007076 | Populus Rhizosphere | LYLASGVVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDAAR* |
| Ga0099828_103418902 | 3300009089 | Vadose Zone Soil | DRFAERAYDAAVQGYLLSGVVDEKLQREMITVASQRIKPAQPVLPDRVFDFSFARKAGVTLR* |
| Ga0111539_101111964 | 3300009094 | Populus Rhizosphere | QLYLTSGMVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRGSVR* |
| Ga0111539_134309471 | 3300009094 | Populus Rhizosphere | KVQREMIATAAERIKPKEPVAPERVFDFSFIQKVRDSVR* |
| Ga0115026_108193951 | 3300009111 | Wetland | EAAVGYLSTSGIVDEKLQREMIVTAAQRTKLAQPPPPERVFDFSFAQKVGETLK* |
| Ga0114129_133871041 | 3300009147 | Populus Rhizosphere | REMISVAAQRIKKPQPVPPERVFDFSFAQKVSESLR* |
| Ga0111538_131749651 | 3300009156 | Populus Rhizosphere | QTGTVDEKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSFK* |
| Ga0105092_103075691 | 3300009157 | Freshwater Sediment | DMIATAAQRVKPKDPVPPERVFDFSFAQKVADSMK* |
| Ga0075423_112525263 | 3300009162 | Populus Rhizosphere | AYDAAVRGYVLSGLVDEKLQREMITAAAQRVKAAPPTSERVFDFSFARKVSASVQ* |
| Ga0113563_114179272 | 3300009167 | Freshwater Wetlands | SGLVDEKLQREMIAAAAQRIKPPEPVMPERVFDFSFARKVSESMR* |
| Ga0105104_108911111 | 3300009168 | Freshwater Sediment | TERAYEAAVQGYPLSGIVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGESLR* |
| Ga0105249_119756832 | 3300009553 | Switchgrass Rhizosphere | SGAVDEKLQREMIAVAAQRIKPKEIAPPERVFDFSFALKVAETLR* |
| Ga0105164_100271104 | 3300009777 | Wastewater | VYDAAVQGYLLSGVVDEKLQREMITVAAQRVKPQQPVTPERIFDFSFAHRVSEALR* |
| Ga0126374_100038057 | 3300009792 | Tropical Forest Soil | ETLQHEMIAVASQRAKPAHPVPPERVFDFSFAQKVGESLR* |
| Ga0105076_11107281 | 3300009816 | Groundwater Sand | VDDKLQREMITSAAQRVKAAPPTPERVFDFSFARKVSASLQ* |
| Ga0105062_10708011 | 3300009817 | Groundwater Sand | LQSGTVDEKLQREMIAVAAQRIKPAQPVPPERVFDFSFAQKATESLR* |
| Ga0105072_10852651 | 3300009818 | Groundwater Sand | DATMELYLSSHTVDEALQREMIAIAAQRVKPAQPVPPERVFDFSFTQKVSESLR* |
| Ga0126380_104719642 | 3300010043 | Tropical Forest Soil | IVDEKLQREMIAVAAQRVKLPQPVAPERVFDFSFARKASETLR* |
| Ga0126380_118595552 | 3300010043 | Tropical Forest Soil | SGTVDETLQHEMIAVASQRAKPAHPVPPERVFDFSFAQKVGESLR* |
| Ga0126384_109547842 | 3300010046 | Tropical Forest Soil | AYEAAVQGYLLSGIVDEKLQREMIAVAAQRVKPAQPVAPERVFDFSFARKASETLR* |
| Ga0126384_117837472 | 3300010046 | Tropical Forest Soil | LQYYLPSGSVDEKLQREMIAVAAQRIKTAQAPPPERVFDFSFAQKVSETLR* |
| Ga0134088_106046462 | 3300010304 | Grasslands Soil | DEKLQREMIAVAAQRVKPKELPPPERVFDFSFAQKVADTMK* |
| Ga0126370_121693391 | 3300010358 | Tropical Forest Soil | CLPSGTVDEKLQREMIVVAAQRIKPPQPVPPERVFDFSFAQKVSETLR* |
| Ga0126372_106070461 | 3300010360 | Tropical Forest Soil | QYYLPSGSVDEKLQREMIAVAAQRVKTAQPPPPERVFDFSFAQKVSETLR* |
| Ga0126377_112351512 | 3300010362 | Tropical Forest Soil | MITVAAQRIKPKELAPPERVFDFSFALKVAESFK* |
| Ga0126377_114544032 | 3300010362 | Tropical Forest Soil | LYLSSHAVDETLQREMIAIAAQRVKPAQLVPPERVFDFSFTQKVILPR* |
| Ga0136847_115813191 | 3300010391 | Freshwater Sediment | QREMIEVAAQRVKPKTPVPPERVFDFSFAQKVADSLR* |
| Ga0134126_130612101 | 3300010396 | Terrestrial Soil | REMISVAAQRVKPKGLPAPERVFDFSFAQKVSDSFK* |
| Ga0134124_116232502 | 3300010397 | Terrestrial Soil | DEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDSVR* |
| Ga0134124_122339692 | 3300010397 | Terrestrial Soil | PSGIVDEKLQREMIAVAAQRVKPSQPVGPERVFDFSFAQKVFESSR* |
| Ga0134127_103358831 | 3300010399 | Terrestrial Soil | IQLYLPSATVDEKLQREMIATAAQRIKAKEPVPPERVFDFTFVQKVGESLK* |
| Ga0134122_109482132 | 3300010400 | Terrestrial Soil | KVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSLK* |
| Ga0137716_101148183 | 3300010938 | Hot Spring Fe-Si Sediment | MVDEEVQRQMIADAAQRIKPAQPVTPERVFDFSFARQLSETLR* |
| Ga0137464_12102581 | 3300011434 | Soil | AATQGYLASGAVDEKLQRGMINLAAQRLKPPPQVAPERVFDFSFARKAAEGLR* |
| Ga0137458_12673561 | 3300011436 | Soil | TGTVDDKLQREMIATAAQRTKLAQPPPPERVFDFSFAQKIAETLR* |
| Ga0137451_12387792 | 3300011438 | Soil | QREMIASAAQRIKPPQPVTPERVFDFSFARAASDVLR* |
| Ga0137433_13053032 | 3300011440 | Soil | QRDMIAIASQCVKPAQPVPPERVFDFSFTQKVSESLR* |
| Ga0137463_10177754 | 3300011444 | Soil | EKVRREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSLK* |
| Ga0120191_100231802 | 3300012022 | Terrestrial | VDEKLQREMIAVAAQRIKPKELAPPERVFDFSFAQKVADAFK* |
| Ga0137453_10134841 | 3300012034 | Soil | QSGAVDEKVQREMIAAAAQRIKPKELAPPERVFDFSFARKVAETLK* |
| Ga0137445_10753732 | 3300012035 | Soil | DAAVQYYLQSGAVDEKVQREMIAVAAQRIKPKELAPPERVFDFSFARKVAETLK* |
| Ga0137319_10937772 | 3300012167 | Soil | VQTGAVDEKLQREMIATAAQRVKPKELAPPERVFDFSFALKVSDSLK* |
| Ga0137342_10298321 | 3300012171 | Soil | EAAVSGYLASGVVEVKLQREMIAVAAQRLKPPPAVTPERVFDFSFARKAGDNLR* |
| Ga0137382_110910152 | 3300012200 | Vadose Zone Soil | AYDAAVRGYVLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASVQ* |
| Ga0137382_111175552 | 3300012200 | Vadose Zone Soil | RGYVLSGLVDEKLQREMIASAAQRVKATAPTLERVFDFTFARKVSASLQ* |
| Ga0137365_111781462 | 3300012201 | Vadose Zone Soil | EMIAIAAQRVKPAHPVPPEQVFDFSFTQKVSESLR* |
| Ga0137374_100268237 | 3300012204 | Vadose Zone Soil | VDEKLQREMIAIASQRIKPKEPVPPERVFDFSIVQKVGESLK* |
| Ga0137379_105801252 | 3300012209 | Vadose Zone Soil | QREMIAVAAQRVKAAQPVPPERVFDFSFAQKVSESLR* |
| Ga0137366_108537881 | 3300012354 | Vadose Zone Soil | LPSGTVDEKLQREMIAVAAQRVKAAQPVPPERVFDFSFAQKVSESLR* |
| Ga0137368_100167261 | 3300012358 | Vadose Zone Soil | QSATVDEKLQREMIAIASQRTKPKEPVRPERVFDFSIVQKIGESLK* |
| Ga0137360_103582482 | 3300012361 | Vadose Zone Soil | AAVQGYLLSGIVDEKLQREMIAVAAQRVKPTPSVTPERVFDLSFARKAGETLR* |
| Ga0157340_10164691 | 3300012473 | Arabidopsis Rhizosphere | RGYVLSGLVDEKLQREMITAAAQRVRAAPPTPERVFDFSFARKVSASVP* |
| Ga0157334_10028523 | 3300012509 | Soil | FTERAYDAAVGGYVLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASVQ* |
| Ga0157338_10254852 | 3300012515 | Arabidopsis Rhizosphere | AVGGYVLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASLP* |
| Ga0157352_11084432 | 3300012519 | Unplanted Soil | VDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASVQ* |
| Ga0137373_109441402 | 3300012532 | Vadose Zone Soil | AYDASVRGYVLTGIVDEKLQREMITAAAQRVKAAPPTLERVFDFSFARKVSASLQ* |
| Ga0137396_103212592 | 3300012918 | Vadose Zone Soil | MIATAAQRIKPKEPVPTERVFDFSFVQKVAESLK* |
| Ga0137404_109301191 | 3300012929 | Vadose Zone Soil | ERAYNAAVRGYVLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASLQ* |
| Ga0137407_104501242 | 3300012930 | Vadose Zone Soil | VQLYLSTHTVDEPLQREMIAIAAQRVKPAHPVPPERVFDFSFVQKMTQPLR* |
| Ga0137407_105927691 | 3300012930 | Vadose Zone Soil | DEKLQREMIAVAAQRVKAAQPVPPERVFDFSFTQKVSESLR* |
| Ga0153915_100554751 | 3300012931 | Freshwater Wetlands | RAYDAAVQGYLLSGSVDEKLQREMIAVAAQRIKPAQPVPPERVFNFSFAQRVSESLR* |
| Ga0153915_103496861 | 3300012931 | Freshwater Wetlands | RAYDAAVQGYLLSGSVDEKLQREMIAVAAQRIKPAQPVPPVRVFNFSFAQRVSESLR* |
| Ga0137410_119194962 | 3300012944 | Vadose Zone Soil | AYDAAVQGYLLSGVVDEKLQREMIAVAAQRVKPTQPVTPERVFDFSFARKASEAFR* |
| Ga0126375_106560361 | 3300012948 | Tropical Forest Soil | QGYLLSGIVDEKLQREMIAVAAQRVKLAQSVTPERVFDFSFARKAGETLR* |
| Ga0126369_107526341 | 3300012971 | Tropical Forest Soil | KLQREMIAVAAQRVKPAQPVAPERVFDFSFARKASETIR* |
| Ga0126369_116826361 | 3300012971 | Tropical Forest Soil | CLPSGTVDEKLQREMIAVAAQRIKPPQPVPPERVFDFSFAQKVSESLR* |
| Ga0126369_118323201 | 3300012971 | Tropical Forest Soil | YLASGVVDEKVQREMITTAAERIKPKEPVPPERVFDFSFIQKVRDSVR* |
| Ga0164304_104905362 | 3300012986 | Soil | YEAAVQYYLQRGTVDQKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSFK* |
| Ga0157307_11202211 | 3300013096 | Soil | ALAFYLQSGVVDEKLQRDMIATAAQRVKPKDPVPPERVFDFSFAHKVADSMK* |
| Ga0134075_102055231 | 3300014154 | Grasslands Soil | TAAVQGYLLSGVVDEKVQREMITVAAQRVKPQQPVTPERVFDFSFARKISEAVR* |
| Ga0180061_10092841 | 3300014861 | Soil | VDEKLQREMIATAAQRTKLAQPPPPERVFDFSFAQKVGETHT* |
| Ga0180065_11603761 | 3300014878 | Soil | LQREMIAVAAQRIKPKELAAPERVFDFTFAQKVADSLK* |
| Ga0180104_10446121 | 3300014884 | Soil | VVEEKLQREMIAVAAQRLKPPPAVTPERVFDFSFARKAGDTLR* |
| Ga0137403_107609552 | 3300015264 | Vadose Zone Soil | MIAVAVQRVKAAQPVPPERVFDFSFAQKVSESLR* |
| Ga0134072_101191932 | 3300015357 | Grasslands Soil | EMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR* |
| Ga0132256_1035817002 | 3300015372 | Arabidopsis Rhizosphere | LQTGTVDEKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVAESMK* |
| Ga0132255_1003736054 | 3300015374 | Arabidopsis Rhizosphere | YLISGMVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRGSVR* |
| Ga0184634_103584632 | 3300018031 | Groundwater Sediment | MVDEKLQREMIASAAQRIKPTQPVTPERVFDFSFARKAGDALR |
| Ga0184626_100865951 | 3300018053 | Groundwater Sediment | LQSGAVDEKLQREMIAVAAQRIKPKELAPPDRVFDFSFAQKVADMPR |
| Ga0184626_101311043 | 3300018053 | Groundwater Sediment | REMIASAAQRVKAAPPAPERVFDFSFARKASATLQ |
| Ga0184621_102257623 | 3300018054 | Groundwater Sediment | VLSGLVDEKLQREMITAAAQRVKSASPTPERVFDFSFARKVSASVQ |
| Ga0184615_101261922 | 3300018059 | Groundwater Sediment | MVDKKLQREMIASAAQRIKPPQPLTPERVFDFTFARAASEALR |
| Ga0187773_107362741 | 3300018064 | Tropical Peatland | AVDEKLQREMIAVAAQRIKPARPVPPERVFDFSFAQKVSATLK |
| Ga0184632_100775343 | 3300018075 | Groundwater Sediment | ERVYDATMELYLSSHTVDETLQREMIAIAAQRVKPAHPVPPERVFDFSFTQKVSESLR |
| Ga0184632_101395572 | 3300018075 | Groundwater Sediment | GAVDEKLQREMISVAAQRIKPKELAPPERVFDFSFALRVADSFR |
| Ga0184632_104277362 | 3300018075 | Groundwater Sediment | DETLQREMIAIAAQRVKPAHPVPPERVFDFSFTQKLSESLR |
| Ga0184609_100272511 | 3300018076 | Groundwater Sediment | AVDEKLQREMISVAAQRIKPKDLAPPERVFDFSFALRVADSFK |
| Ga0184609_104924201 | 3300018076 | Groundwater Sediment | YYVQTGTVDEKLQREMIAVAAQRIKPKELAPPERVFDFSFAQKVADTLK |
| Ga0184612_102099171 | 3300018078 | Groundwater Sediment | REMIAIAAQRVKPAHPVPPERVFDFSFTQKLSGSLR |
| Ga0184612_103755323 | 3300018078 | Groundwater Sediment | TERSYDAAVQGYVLSGLVDEKLQREMIASAAQRVKAAPPAPERVFDFSFARKASATLQ |
| Ga0184629_104955201 | 3300018084 | Groundwater Sediment | ERAYEVATQGYSLTGVVDEKLQREMIAVAAQRVKSQPQLAPERIFDFSFARRASEGLR |
| Ga0187774_100133233 | 3300018089 | Tropical Peatland | GVVEDKLQRDMITLAAQRVKTSPPVPPERVFDFSFARKVGEALR |
| Ga0190265_123343112 | 3300018422 | Soil | YDAAVRGYVLSGLVDEKLQREMIASAAQRVKAAAPAPERVFDFSFARKVSASSQ |
| Ga0190265_134609652 | 3300018422 | Soil | REMIATAAQRVKPKDPVPPERVFDFTFAQKVADSIK |
| Ga0066655_109283752 | 3300018431 | Grasslands Soil | DEKLQKEMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR |
| Ga0190270_103388402 | 3300018469 | Soil | RFAERAYEAATHGYLANGMVDERLQREMIGLAAQRLKPPPQVAPERVFDFSSARKAAEEL |
| Ga0066669_115152232 | 3300018482 | Grasslands Soil | IYDAAVQLYLPSATVGEKLQREMIAIAAQRIKPKDPVSPERVFDFSFVQKVGESMK |
| Ga0193723_11330642 | 3300019879 | Soil | AVRGYVLSGLVDEKLQREMIASAAQRVKAAPPAPERVFDFSFARKVSASVQ |
| Ga0193713_11478861 | 3300019882 | Soil | REMIAVAAQRVKPKELPPHERVFDFSFASRVADSFK |
| Ga0193713_11753771 | 3300019882 | Soil | YVLTGLVDEKLQREMIASAAQRVKAAPPAPERVFDFSFARKVSASVQ |
| Ga0193747_11274732 | 3300019885 | Soil | VQREMIAVAAQRVKPKELPPHERVFDFTFASRVADSFK |
| Ga0193733_10373012 | 3300020022 | Soil | QRELIATAAQRIKPKEPVPTERVFDFSFVQKVAESLK |
| Ga0193716_10806062 | 3300020061 | Soil | REMIAIAAQRIKPKDPVPPERVFDFSFAQKVAESFK |
| Ga0163153_100172885 | 3300020186 | Freshwater Microbial Mat | GYLASAAVDEKLQREMIGLAAQRLKPPPQVAPERVFDFSFARKAAEGIR |
| Ga0210378_101492862 | 3300021073 | Groundwater Sediment | EMIATASQRIKPKEPVPVERVFDFSFVQRVGESLK |
| Ga0210378_101899611 | 3300021073 | Groundwater Sediment | QYYLQSGAVDEKLQREMIAVAAQRVKPKELAPPERVFDFNFAQKVADTLK |
| Ga0210379_103614422 | 3300021081 | Groundwater Sediment | LQREMIAIAAQRVKPAHPVSPERVFDFSFTQKVSESLR |
| Ga0210379_104295552 | 3300021081 | Groundwater Sediment | REMIAVAAQRIKPKELAPPERVFDFSFAQKITDSLR |
| Ga0193719_101131502 | 3300021344 | Soil | EKVQREMIAVAAQRVKPKELPPHERVFDFSFASRVADSFK |
| Ga0126371_109507972 | 3300021560 | Tropical Forest Soil | EMIAVAAQRVKLPQPVAAERVFDFSFARKASETLR |
| Ga0224495_102018171 | 3300022208 | Sediment | VQYYLTTGTVDDRLQREMIATAAQRTKLAQPPPPERVFDFSFAQKVGETLK |
| Ga0224452_12004411 | 3300022534 | Groundwater Sediment | SSHTVDETLQREMIAIAAQRVKPAHTVPPERVFEFSFAQKVSESLR |
| Ga0224452_12870202 | 3300022534 | Groundwater Sediment | IYDAALQYYLPSGAVDEKLQREMIAVAAQRVKAAQPVTPERVFDFSFAQKVSESLR |
| Ga0222622_108373011 | 3300022756 | Groundwater Sediment | EKLQREMIAVAAQRIKGAQPVPPERVFDFSFAQKVSESLR |
| (restricted) Ga0233424_102429402 | 3300023208 | Freshwater | QGYLLSGVVEEKLQREMIAVAAQRVKPAPPQIAPERVFEFTLARKAGESLR |
| Ga0209619_101361441 | 3300025159 | Soil | EQLQREMIADASQRIKPLQPVPPERVFDFSFAHKGSQFPR |
| Ga0209108_101348302 | 3300025165 | Soil | EMIATAAQRVKITNLPPLERVFDFNFAQKVADTLR |
| Ga0209642_102788372 | 3300025167 | Soil | EMIADASQRIKPLQPVPPERVFDFSFAHKGSQFPR |
| Ga0209324_100282954 | 3300025174 | Soil | REMITTAAQRVKITNLPPPERVFDFSFAQKVADTFK |
| Ga0209641_102976292 | 3300025322 | Soil | TGIVDEQLQREMIADASQRIKPLQPVPPERVFDFSFAQKGSRFPR |
| Ga0209342_102136702 | 3300025326 | Soil | RVYDAAVHYYLASGAVDEKLQREMIATAAQRVKITNLPPPERVFDFSFAQRVADSLR |
| Ga0207699_108716462 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | YLASGVVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDSVR |
| Ga0207707_100168401 | 3300025912 | Corn Rhizosphere | EKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRGSVR |
| Ga0207681_100533961 | 3300025923 | Switchgrass Rhizosphere | QREMIATAAERIKPKESVPPERVFDFSFIQKVRGSVR |
| Ga0207701_110435642 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | LQYYLQSGAVDEKLQREMIAVAAQRIKPKEIAPPERVFDFSFALKVAETLR |
| Ga0207644_109906631 | 3300025931 | Switchgrass Rhizosphere | GKERDHFVERAYAATVQSYLVTGTLDEKLQRDMIAMAAERIKPKAPVAPDRVFDFSFARKAAEALR |
| Ga0207706_104589032 | 3300025933 | Corn Rhizosphere | QTGTVDEKVQREMIAVVAQRVKPKELPPPERVFDFSFAQKVSDSFK |
| Ga0207691_103144833 | 3300025940 | Miscanthus Rhizosphere | VQAYLSSGIVDEKLQREMIAAASQRLKPAVSIAPERVFDFSSARMAGVGGK |
| Ga0210116_10043181 | 3300025959 | Natural And Restored Wetlands | EKLQREMIATAAQRTKLAQPPAPERVFDFSFAQKVAESLK |
| Ga0207676_107520792 | 3300026095 | Switchgrass Rhizosphere | YLTSGMVDEKVQREMIATAAERIKPKESVPPERVFDFSFIQKVRGSVR |
| Ga0207675_1005897293 | 3300026118 | Switchgrass Rhizosphere | GYLSVSGTVDEKLQREMIATAAQRTKLAQPPAPERVFDFSFAQRAGENLK |
| Ga0209235_11046031 | 3300026296 | Grasslands Soil | AVQGYLLSGVVDEKLQREMIAEAAQRIKPAQPVTPERVFDFSFARKAGEALR |
| Ga0209761_12025652 | 3300026313 | Grasslands Soil | QKEMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR |
| Ga0209131_11089661 | 3300026320 | Grasslands Soil | YDAAAEGYLPSGLVDEKLQREMIAAAVRRVKTAQVFAPDRVFDFGLARRAGEGLR |
| Ga0209473_12286561 | 3300026330 | Soil | LQKEMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR |
| Ga0209806_10325684 | 3300026529 | Soil | SGVVDEKLQKEMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR |
| Ga0256867_100341183 | 3300026535 | Soil | AVGYFLDSGTVDERLQREMIATAAQRLKIAQPAAPERVFDFSFAQKVADSFK |
| Ga0209156_100315781 | 3300026547 | Soil | RIYDAAIQYYLMSGSVDDKLQREMIAVAAQRVKPKELAPPERVFDFSFAQKVSEPLR |
| Ga0209577_102660311 | 3300026552 | Soil | TERAYDAATQGYLLSGVVDEKLQREMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR |
| Ga0207567_1012503 | 3300026714 | Soil | VQREMIATAAERIKPKEPVPPERVFDFSFIQKVRGSVR |
| Ga0209819_103231402 | 3300027722 | Freshwater Sediment | EKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGESLR |
| Ga0209726_104344052 | 3300027815 | Groundwater | REMIAVAAQRIKPKELAPPERVFDFSFAQKVAESLR |
| Ga0209814_105317291 | 3300027873 | Populus Rhizosphere | YVLSGLVDEKLQREMIASAAQRVKAASPAPERVFDFSFARKVSASLQ |
| Ga0207428_104624382 | 3300027907 | Populus Rhizosphere | QYYLPSGTVDEKLQREMIAVAAQRVKAPQPVPPERVFDFSFAQKVSESLR |
| Ga0207428_108059931 | 3300027907 | Populus Rhizosphere | APAVYDAAVQGYLLTGSVDEKLQREMIADAARRIKPTQPVTPDRVFDFSFVQKVVETLR |
| Ga0207428_108674821 | 3300027907 | Populus Rhizosphere | AYDAAVQGYLLSGVVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGEALR |
| Ga0207428_109994801 | 3300027907 | Populus Rhizosphere | SAAVQLYLASGVVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDAAR |
| Ga0209382_101352731 | 3300027909 | Populus Rhizosphere | YDAALQYYVQTGAVDEKLQREMIATAAQRVKPKELAPPERVFDFSFALKVSDSLK |
| Ga0209857_10483152 | 3300027957 | Groundwater Sand | VYDAALQYYLQSGTVDEKLQREMIAVAAQRIKPAQPVPPERVFDFSFAQKATESLR |
| Ga0307503_102925811 | 3300028802 | Soil | ALGYYLQSGTVDEKLQREMIAVAAQRIKPKEMAPPERVFDFSFAQKVAETFK |
| Ga0170824_1079315541 | 3300031231 | Forest Soil | RIYEAAVQYYLQTGTVDEKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSLK |
| Ga0307408_1014412571 | 3300031548 | Rhizosphere | LSTSGTVDEKLQREMITTAAQRTKLAQPPPPERVFDFSFAQRAGENLK |
| Ga0307469_100803401 | 3300031720 | Hardwood Forest Soil | QREMIAVAAQRIKLVQPVTPERVFDFSFARKAGEALR |
| Ga0307469_104407531 | 3300031720 | Hardwood Forest Soil | YEAAVKGYVLTGLVDEKLQREMITSAAQRVKAAAPAPERVFDFSFARKVSASLQ |
| Ga0307468_1002629731 | 3300031740 | Hardwood Forest Soil | PLQREMIAIAAQRVKPAHPVPPERVFDFSFVQKVTQPLR |
| Ga0307468_1009060403 | 3300031740 | Hardwood Forest Soil | AYDAAVRGYVLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASVP |
| Ga0307468_1020384951 | 3300031740 | Hardwood Forest Soil | AVQSYLLTGIVDEKLQREMIALSAQRLKPSQPITPERVFDFSAARKAGEGLR |
| Ga0307475_101630283 | 3300031754 | Hardwood Forest Soil | SGSVDETLQREMIAVAVERTKPPHPVPPERVFDFSLAQKVSETLR |
| Ga0307413_105622172 | 3300031824 | Rhizosphere | KLQRDMIATAAQRVKPKDPVAPERVFDFSFAQKVADSMK |
| Ga0310904_110833432 | 3300031854 | Soil | GTVDQKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSLK |
| Ga0310885_105136882 | 3300031943 | Soil | SGVVDEKLQRDMIATAAQRVKPKDPVPPERVFDFSFAHKVADSMK |
| Ga0307479_105757832 | 3300031962 | Hardwood Forest Soil | VDDRLQREMIAVAVQRIQPVPPVVPPERVFDFSFARRAGETLR |
| Ga0307411_115056341 | 3300032005 | Rhizosphere | QREMITTAAQRTKLAQPPPPERVFDFSFAQRAGENLK |
| Ga0310902_112224002 | 3300032012 | Soil | EMIAVAAQRIKPKELPPPERVFDFSFAQKVPESMK |
| Ga0307471_1012325641 | 3300032180 | Hardwood Forest Soil | VDEKVQREMIAVAAQRVKPKELPPHERVFDFTFASRVADSFK |
| Ga0307472_1000578324 | 3300032205 | Hardwood Forest Soil | ERTYDATAQAYLTSGVVDERLQREMIAVAAQRLKPQQPVAPERVFDFSFARKASEALL |
| Ga0307472_1027572542 | 3300032205 | Hardwood Forest Soil | YNAALQLFLLSGSVDETLQREMIAVAVERTKPPHPVPPERVFDFSLAQKVSETLR |
| Ga0310812_104448141 | 3300032421 | Soil | KVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDSVR |
| Ga0214471_104352641 | 3300033417 | Soil | VEEKLQREMIAVAAQRLKPPPAVTPERVFDFSFARKAGDTLR |
| Ga0326726_117086752 | 3300033433 | Peat Soil | PSGVVDGKIQREMIATAAQRVKPKEPVPPERVFDFTFAQKVADSLR |
| Ga0364935_0176170_564_683 | 3300034151 | Sediment | TLQREMIAIASQRVKPAHPVPPERVFDFSFTQKVSESLR |
| Ga0364931_0297585_362_535 | 3300034176 | Sediment | RIYDAALQYYVQTGAVDEKLQREMIATAAQRVKPKEVAPPERVFDFSFALKVSDSLK |
| ⦗Top⦘ |