


| Basic Information | |
|---|---|
| Family ID | F019372 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 230 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MPLFWLFAEAAVNPKYIAEYVFPGVITGYFTHLEYVKLAP |
| Number of Associated Samples | 154 |
| Number of Associated Scaffolds | 230 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.22 % |
| % of genes near scaffold ends (potentially truncated) | 93.91 % |
| % of genes from short scaffolds (< 2000 bps) | 94.35 % |
| Associated GOLD sequencing projects | 144 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.609 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.261 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.043 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.826 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.71% β-sheet: 0.00% Coil/Unstructured: 85.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 230 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 44.78 |
| PF00528 | BPD_transp_1 | 9.57 |
| PF02585 | PIG-L | 2.61 |
| PF13586 | DDE_Tnp_1_2 | 1.30 |
| PF00005 | ABC_tran | 1.30 |
| PF04909 | Amidohydro_2 | 1.30 |
| PF13565 | HTH_32 | 0.87 |
| PF13280 | WYL | 0.87 |
| PF00355 | Rieske | 0.87 |
| PF13546 | DDE_5 | 0.87 |
| PF13408 | Zn_ribbon_recom | 0.43 |
| PF13191 | AAA_16 | 0.43 |
| PF05532 | CsbD | 0.43 |
| PF06441 | EHN | 0.43 |
| PF13610 | DDE_Tnp_IS240 | 0.43 |
| PF13302 | Acetyltransf_3 | 0.43 |
| PF01609 | DDE_Tnp_1 | 0.43 |
| PF00890 | FAD_binding_2 | 0.43 |
| PF00589 | Phage_integrase | 0.43 |
| PF07929 | PRiA4_ORF3 | 0.43 |
| PF02796 | HTH_7 | 0.43 |
| PF01632 | Ribosomal_L35p | 0.43 |
| PF13358 | DDE_3 | 0.43 |
| PF12762 | DDE_Tnp_IS1595 | 0.43 |
| PF11848 | DUF3368 | 0.43 |
| PF03717 | PBP_dimer | 0.43 |
| PF00487 | FA_desaturase | 0.43 |
| PF12759 | HTH_Tnp_IS1 | 0.43 |
| PF02515 | CoA_transf_3 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 230 Family Scaffolds |
|---|---|---|---|
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 2.61 |
| COG0291 | Ribosomal protein L35 | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.43 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.43 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.43 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.43 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.43 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.43 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.43 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.43 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.43 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.61 % |
| Unclassified | root | N/A | 7.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_11625529 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 608 | Open in IMG/M |
| 3300000955|JGI1027J12803_108531671 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 665 | Open in IMG/M |
| 3300004463|Ga0063356_104039684 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 631 | Open in IMG/M |
| 3300004643|Ga0062591_102681950 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 526 | Open in IMG/M |
| 3300005186|Ga0066676_10093942 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300005332|Ga0066388_103860382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 765 | Open in IMG/M |
| 3300005332|Ga0066388_106988373 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 568 | Open in IMG/M |
| 3300005441|Ga0070700_100563232 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 887 | Open in IMG/M |
| 3300005445|Ga0070708_100443453 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1224 | Open in IMG/M |
| 3300005471|Ga0070698_101626127 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 598 | Open in IMG/M |
| 3300005540|Ga0066697_10679380 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 565 | Open in IMG/M |
| 3300005552|Ga0066701_10756307 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 581 | Open in IMG/M |
| 3300005553|Ga0066695_10324134 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 969 | Open in IMG/M |
| 3300005554|Ga0066661_10224913 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1163 | Open in IMG/M |
| 3300005561|Ga0066699_11228465 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 514 | Open in IMG/M |
| 3300005713|Ga0066905_100187329 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1533 | Open in IMG/M |
| 3300005713|Ga0066905_101654764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 587 | Open in IMG/M |
| 3300005718|Ga0068866_11240956 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 539 | Open in IMG/M |
| 3300005764|Ga0066903_104110259 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300005764|Ga0066903_105519131 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 667 | Open in IMG/M |
| 3300005764|Ga0066903_107161415 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005764|Ga0066903_107533853 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 561 | Open in IMG/M |
| 3300005764|Ga0066903_107825073 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 549 | Open in IMG/M |
| 3300005764|Ga0066903_108547852 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 522 | Open in IMG/M |
| 3300005937|Ga0081455_10019356 | All Organisms → cellular organisms → Bacteria | 6442 | Open in IMG/M |
| 3300005937|Ga0081455_10097253 | All Organisms → cellular organisms → Bacteria | 2373 | Open in IMG/M |
| 3300005937|Ga0081455_10690446 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 652 | Open in IMG/M |
| 3300006049|Ga0075417_10260128 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 834 | Open in IMG/M |
| 3300006173|Ga0070716_101017475 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 656 | Open in IMG/M |
| 3300006194|Ga0075427_10068007 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 632 | Open in IMG/M |
| 3300006797|Ga0066659_11709911 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 531 | Open in IMG/M |
| 3300006844|Ga0075428_100209031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2109 | Open in IMG/M |
| 3300006846|Ga0075430_100391099 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300006852|Ga0075433_11743226 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 536 | Open in IMG/M |
| 3300006880|Ga0075429_100144054 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2085 | Open in IMG/M |
| 3300006880|Ga0075429_100946184 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 753 | Open in IMG/M |
| 3300006880|Ga0075429_101543472 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 577 | Open in IMG/M |
| 3300006904|Ga0075424_102225760 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 577 | Open in IMG/M |
| 3300006969|Ga0075419_10284920 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1111 | Open in IMG/M |
| 3300007076|Ga0075435_101203933 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 663 | Open in IMG/M |
| 3300007265|Ga0099794_10482742 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 651 | Open in IMG/M |
| 3300009012|Ga0066710_102774659 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 694 | Open in IMG/M |
| 3300009012|Ga0066710_103072566 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300009012|Ga0066710_103558694 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 588 | Open in IMG/M |
| 3300009038|Ga0099829_10425258 | Not Available | 1099 | Open in IMG/M |
| 3300009038|Ga0099829_11269001 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 609 | Open in IMG/M |
| 3300009089|Ga0099828_10570352 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300009090|Ga0099827_10357349 | Not Available | 1243 | Open in IMG/M |
| 3300009090|Ga0099827_11197923 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 660 | Open in IMG/M |
| 3300009090|Ga0099827_11597479 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 568 | Open in IMG/M |
| 3300009094|Ga0111539_11272564 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 854 | Open in IMG/M |
| 3300009094|Ga0111539_13115207 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 535 | Open in IMG/M |
| 3300009100|Ga0075418_11009714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 900 | Open in IMG/M |
| 3300009100|Ga0075418_12240335 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 596 | Open in IMG/M |
| 3300009100|Ga0075418_12554487 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 557 | Open in IMG/M |
| 3300009137|Ga0066709_100310655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2146 | Open in IMG/M |
| 3300009137|Ga0066709_102358508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300009147|Ga0114129_10291985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2175 | Open in IMG/M |
| 3300009147|Ga0114129_10963585 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1077 | Open in IMG/M |
| 3300009147|Ga0114129_12486983 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 619 | Open in IMG/M |
| 3300009156|Ga0111538_10119708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3344 | Open in IMG/M |
| 3300009156|Ga0111538_10551416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1461 | Open in IMG/M |
| 3300009156|Ga0111538_11100912 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1004 | Open in IMG/M |
| 3300009156|Ga0111538_11646999 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300009156|Ga0111538_12747525 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 617 | Open in IMG/M |
| 3300009162|Ga0075423_12477720 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 566 | Open in IMG/M |
| 3300009444|Ga0114945_10168247 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1262 | Open in IMG/M |
| 3300009444|Ga0114945_10339318 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 890 | Open in IMG/M |
| 3300009691|Ga0114944_1193962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 810 | Open in IMG/M |
| 3300009691|Ga0114944_1214216 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 773 | Open in IMG/M |
| 3300009691|Ga0114944_1285082 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 676 | Open in IMG/M |
| 3300009792|Ga0126374_10897551 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 686 | Open in IMG/M |
| 3300009792|Ga0126374_10985208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 660 | Open in IMG/M |
| 3300009792|Ga0126374_11176320 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 613 | Open in IMG/M |
| 3300009792|Ga0126374_11811438 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 511 | Open in IMG/M |
| 3300009814|Ga0105082_1032512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 835 | Open in IMG/M |
| 3300009816|Ga0105076_1031305 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 939 | Open in IMG/M |
| 3300009816|Ga0105076_1088033 | Not Available | 592 | Open in IMG/M |
| 3300009820|Ga0105085_1019299 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1179 | Open in IMG/M |
| 3300009820|Ga0105085_1127208 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 515 | Open in IMG/M |
| 3300009822|Ga0105066_1171746 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 504 | Open in IMG/M |
| 3300010038|Ga0126315_10291912 | Not Available | 1004 | Open in IMG/M |
| 3300010038|Ga0126315_10494898 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 779 | Open in IMG/M |
| 3300010042|Ga0126314_10611645 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 795 | Open in IMG/M |
| 3300010043|Ga0126380_11357199 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300010046|Ga0126384_10370110 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1201 | Open in IMG/M |
| 3300010046|Ga0126384_10780982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
| 3300010046|Ga0126384_12438717 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 507 | Open in IMG/M |
| 3300010047|Ga0126382_11829448 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 572 | Open in IMG/M |
| 3300010047|Ga0126382_11902729 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 563 | Open in IMG/M |
| 3300010047|Ga0126382_12491486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 504 | Open in IMG/M |
| 3300010145|Ga0126321_1319906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 500 | Open in IMG/M |
| 3300010326|Ga0134065_10363285 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 572 | Open in IMG/M |
| 3300010333|Ga0134080_10123541 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1081 | Open in IMG/M |
| 3300010359|Ga0126376_10804777 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 918 | Open in IMG/M |
| 3300010359|Ga0126376_11253339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300010359|Ga0126376_12665364 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 549 | Open in IMG/M |
| 3300010359|Ga0126376_12954097 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 525 | Open in IMG/M |
| 3300010360|Ga0126372_11227503 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 775 | Open in IMG/M |
| 3300010360|Ga0126372_12384036 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 579 | Open in IMG/M |
| 3300010361|Ga0126378_11642882 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010361|Ga0126378_12937920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 544 | Open in IMG/M |
| 3300010362|Ga0126377_10866947 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300010362|Ga0126377_11472475 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 754 | Open in IMG/M |
| 3300010362|Ga0126377_12972909 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 547 | Open in IMG/M |
| 3300010362|Ga0126377_13073672 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 539 | Open in IMG/M |
| 3300010366|Ga0126379_11156786 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 880 | Open in IMG/M |
| 3300010366|Ga0126379_11511056 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 777 | Open in IMG/M |
| 3300010391|Ga0136847_10052481 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2121 | Open in IMG/M |
| 3300010391|Ga0136847_12534785 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 540 | Open in IMG/M |
| 3300010398|Ga0126383_12191815 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 639 | Open in IMG/M |
| 3300010398|Ga0126383_13451198 | Not Available | 516 | Open in IMG/M |
| 3300011429|Ga0137455_1259487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 512 | Open in IMG/M |
| 3300012202|Ga0137363_10866404 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 767 | Open in IMG/M |
| 3300012204|Ga0137374_10810137 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 694 | Open in IMG/M |
| 3300012204|Ga0137374_10947410 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012206|Ga0137380_10171419 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300012209|Ga0137379_10579246 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1029 | Open in IMG/M |
| 3300012210|Ga0137378_10406723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1262 | Open in IMG/M |
| 3300012210|Ga0137378_10689537 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 932 | Open in IMG/M |
| 3300012212|Ga0150985_104800480 | Not Available | 715 | Open in IMG/M |
| 3300012351|Ga0137386_10098641 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2064 | Open in IMG/M |
| 3300012354|Ga0137366_10349447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → unclassified Nostoc → Nostoc sp. CHAB 5836 | 1082 | Open in IMG/M |
| 3300012354|Ga0137366_10432976 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 955 | Open in IMG/M |
| 3300012355|Ga0137369_10479137 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 883 | Open in IMG/M |
| 3300012355|Ga0137369_10925742 | Not Available | 584 | Open in IMG/M |
| 3300012357|Ga0137384_10281547 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1384 | Open in IMG/M |
| 3300012357|Ga0137384_11014310 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012359|Ga0137385_10491344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1039 | Open in IMG/M |
| 3300012359|Ga0137385_10557839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 966 | Open in IMG/M |
| 3300012359|Ga0137385_11244282 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 606 | Open in IMG/M |
| 3300012359|Ga0137385_11646413 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 506 | Open in IMG/M |
| 3300012361|Ga0137360_10901909 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 762 | Open in IMG/M |
| 3300012361|Ga0137360_11244315 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 644 | Open in IMG/M |
| 3300012410|Ga0134060_1103183 | Not Available | 502 | Open in IMG/M |
| 3300012922|Ga0137394_10878129 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 749 | Open in IMG/M |
| 3300012930|Ga0137407_10379985 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1305 | Open in IMG/M |
| 3300012930|Ga0137407_11558283 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 629 | Open in IMG/M |
| 3300012944|Ga0137410_10031275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 3719 | Open in IMG/M |
| 3300012944|Ga0137410_10182168 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1617 | Open in IMG/M |
| 3300012944|Ga0137410_11603874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 570 | Open in IMG/M |
| 3300012948|Ga0126375_10069284 | Not Available | 1970 | Open in IMG/M |
| 3300012948|Ga0126375_10385102 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300012948|Ga0126375_11724508 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 544 | Open in IMG/M |
| 3300012971|Ga0126369_10731462 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1068 | Open in IMG/M |
| 3300012971|Ga0126369_11849825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 692 | Open in IMG/M |
| 3300012972|Ga0134077_10583343 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 504 | Open in IMG/M |
| 3300015245|Ga0137409_10685339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 858 | Open in IMG/M |
| 3300015371|Ga0132258_12428084 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300015372|Ga0132256_101172427 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 882 | Open in IMG/M |
| 3300016387|Ga0182040_11936124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 506 | Open in IMG/M |
| 3300016404|Ga0182037_10875953 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300017656|Ga0134112_10517386 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 507 | Open in IMG/M |
| 3300017965|Ga0190266_10296933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300017997|Ga0184610_1096669 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 932 | Open in IMG/M |
| 3300018056|Ga0184623_10099568 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina → unclassified Nitrospina → Nitrospina sp. | 1342 | Open in IMG/M |
| 3300018056|Ga0184623_10379708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 627 | Open in IMG/M |
| 3300018063|Ga0184637_10300294 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 973 | Open in IMG/M |
| 3300018076|Ga0184609_10498910 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 555 | Open in IMG/M |
| 3300018078|Ga0184612_10265944 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 884 | Open in IMG/M |
| 3300018079|Ga0184627_10432539 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 684 | Open in IMG/M |
| 3300018084|Ga0184629_10598093 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 563 | Open in IMG/M |
| 3300018466|Ga0190268_11822097 | Not Available | 550 | Open in IMG/M |
| 3300019208|Ga0180110_1222142 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 532 | Open in IMG/M |
| 3300019212|Ga0180106_1261948 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300019228|Ga0180119_1194675 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 854 | Open in IMG/M |
| 3300019228|Ga0180119_1374454 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300019229|Ga0180116_1058825 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 659 | Open in IMG/M |
| 3300019232|Ga0180114_1235375 | Not Available | 830 | Open in IMG/M |
| 3300019233|Ga0184645_1007586 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300019238|Ga0180112_1361508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1957 | Open in IMG/M |
| 3300019249|Ga0184648_1149986 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1213 | Open in IMG/M |
| 3300019249|Ga0184648_1272709 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 626 | Open in IMG/M |
| 3300019249|Ga0184648_1317719 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1663 | Open in IMG/M |
| 3300019254|Ga0184641_1008745 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 508 | Open in IMG/M |
| 3300019254|Ga0184641_1109136 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 515 | Open in IMG/M |
| 3300019255|Ga0184643_1176455 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 545 | Open in IMG/M |
| 3300019259|Ga0184646_1389740 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 739 | Open in IMG/M |
| 3300019279|Ga0184642_1649557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 665 | Open in IMG/M |
| 3300019458|Ga0187892_10227795 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300020065|Ga0180113_1104046 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 815 | Open in IMG/M |
| 3300020067|Ga0180109_1049807 | Not Available | 579 | Open in IMG/M |
| 3300020193|Ga0194131_10191450 | Not Available | 971 | Open in IMG/M |
| 3300022563|Ga0212128_10094210 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1934 | Open in IMG/M |
| 3300025149|Ga0209827_11001597 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 885 | Open in IMG/M |
| 3300025157|Ga0209399_10147911 | Not Available | 946 | Open in IMG/M |
| 3300025936|Ga0207670_10422213 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300025961|Ga0207712_10048813 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2946 | Open in IMG/M |
| 3300026075|Ga0207708_10650069 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 897 | Open in IMG/M |
| 3300026313|Ga0209761_1186778 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 932 | Open in IMG/M |
| 3300027056|Ga0209879_1067268 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300027655|Ga0209388_1011255 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2413 | Open in IMG/M |
| 3300027655|Ga0209388_1176485 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 598 | Open in IMG/M |
| 3300027655|Ga0209388_1191806 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 568 | Open in IMG/M |
| 3300027750|Ga0209461_10042707 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300027875|Ga0209283_10389250 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 910 | Open in IMG/M |
| 3300027880|Ga0209481_10379364 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 723 | Open in IMG/M |
| 3300027882|Ga0209590_10420858 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 863 | Open in IMG/M |
| 3300027903|Ga0209488_10791523 | Not Available | 673 | Open in IMG/M |
| 3300027903|Ga0209488_11114248 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 538 | Open in IMG/M |
| 3300027907|Ga0207428_11279980 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 508 | Open in IMG/M |
| 3300027909|Ga0209382_10608288 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1189 | Open in IMG/M |
| 3300027961|Ga0209853_1003136 | All Organisms → cellular organisms → Bacteria | 5049 | Open in IMG/M |
| 3300028536|Ga0137415_11354068 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 532 | Open in IMG/M |
| 3300030570|Ga0247647_1042066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 925 | Open in IMG/M |
| 3300030570|Ga0247647_1185663 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300030576|Ga0247644_1103894 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 637 | Open in IMG/M |
| 3300030634|Ga0247636_10143998 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 711 | Open in IMG/M |
| 3300030902|Ga0308202_1049508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 767 | Open in IMG/M |
| 3300030903|Ga0308206_1132923 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 585 | Open in IMG/M |
| 3300031092|Ga0308204_10311731 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 530 | Open in IMG/M |
| 3300031093|Ga0308197_10404688 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 535 | Open in IMG/M |
| 3300031094|Ga0308199_1031906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 952 | Open in IMG/M |
| 3300031094|Ga0308199_1086085 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 672 | Open in IMG/M |
| 3300031228|Ga0299914_11255647 | Not Available | 590 | Open in IMG/M |
| 3300031573|Ga0310915_10524000 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 842 | Open in IMG/M |
| 3300031740|Ga0307468_102286000 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 525 | Open in IMG/M |
| 3300031744|Ga0306918_10672018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 811 | Open in IMG/M |
| 3300031744|Ga0306918_10774177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300031820|Ga0307473_10927518 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 631 | Open in IMG/M |
| 3300031897|Ga0318520_10195033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1192 | Open in IMG/M |
| 3300031910|Ga0306923_11012318 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300032002|Ga0307416_103211188 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 547 | Open in IMG/M |
| 3300032075|Ga0310890_11595643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 539 | Open in IMG/M |
| 3300032163|Ga0315281_12028637 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 549 | Open in IMG/M |
| 3300032180|Ga0307471_103710419 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 540 | Open in IMG/M |
| 3300032261|Ga0306920_104286573 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 513 | Open in IMG/M |
| 3300033811|Ga0364924_152793 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 545 | Open in IMG/M |
| 3300034662|Ga0314783_018298 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1108 | Open in IMG/M |
| 3300034674|Ga0314799_030627 | Not Available | 605 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 7.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.35% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 3.48% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.48% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.30% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.30% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.30% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.87% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.43% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.43% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.43% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.43% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.43% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.43% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030570 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030576 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb9 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030634 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034674 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_116255291 | 3300000550 | Soil | REIGDHKFQEFADMPLFWLYAEAGVHPQYVAEYIFPGSITGFFTHLEYVKLAP* |
| JGI1027J12803_1085316711 | 3300000955 | Soil | ADMPLFWLYAEAGVHPKYVAEYIFPGSITGFFTHLEYVKLVP* |
| Ga0063356_1040396841 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IPLFWLYAEAVLNPKYIAEYTFPGIVTGFFTHLEYIKPTP* |
| Ga0062591_1026819501 | 3300004643 | Soil | KFQEFAEMPLFWLYAEASVHPTYVAEYIFPGSITGFFTHLEYVKLAP* |
| Ga0066676_100939423 | 3300005186 | Soil | TEFAEIPLFWLFAEAAVNPKYIAEYVFPGVITGSFTHLEYVKPAP* |
| Ga0066388_1038603821 | 3300005332 | Tropical Forest Soil | KFNEFADMPLFWLFAEAGVNPKYISEYTFPGSITGFFTHLEYIKLAQ* |
| Ga0066388_1069883732 | 3300005332 | Tropical Forest Soil | KFNEFAEIPLFWLYADAAVNPKYVAEYTFPGVITGYFTHLEYVRLAP* |
| Ga0070700_1005632324 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | PLFWLFAEATVNPKYVAEYTFPGVITGVFTHLEYVKLASE* |
| Ga0070708_1004434531 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | HKFTEFAEIPLFWLFAEAAVNPKYIAEYAFPGVITGYFTHLEYVKLAP* |
| Ga0070698_1016261272 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GDHKFTEFAEIPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYVKLAP* |
| Ga0066697_106793802 | 3300005540 | Soil | FAEATVNPKYVAEYVFPGVITGSFTHLEYVKPAP* |
| Ga0066701_107563071 | 3300005552 | Soil | EIGDHKFNEFAAMPLFFLYADAAVNPKYVAEYTFPGVITGYFTHLEYVKLTP* |
| Ga0066695_103241341 | 3300005553 | Soil | AEIPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0066661_102249131 | 3300005554 | Soil | EIPLFWLFAEAAVNPKYIAEYVFPGVITGSFTHLEYVKPAP* |
| Ga0066699_112284651 | 3300005561 | Soil | EFAEMPMFWLFAEAVVNPKYIAEYVFPGVITGFFTHLEYVKLAP* |
| Ga0066905_1001873292 | 3300005713 | Tropical Forest Soil | DHKFTEFAEMPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLTP* |
| Ga0066905_1016547642 | 3300005713 | Tropical Forest Soil | DHKFYEFADMPLFWLRAEAGVNPKYISEYTFPGSITGFFTHLEYVKLVQ* |
| Ga0068866_112409561 | 3300005718 | Miscanthus Rhizosphere | AEIPLFWLYADAAVNPKYVAEYVFPGVITGYFTHLEYVKLAP* |
| Ga0066903_1041102593 | 3300005764 | Tropical Forest Soil | TEFADIPLFWLFAEATVNPKYVAEYVFPGVITGSFTHLEYIKLAP* |
| Ga0066903_1055191311 | 3300005764 | Tropical Forest Soil | KFTEFADIPLFWLFAEATVNPKYVAEYVFPGVITGSFTHLEYIRLAP* |
| Ga0066903_1071614152 | 3300005764 | Tropical Forest Soil | FWLFAEAAVNPRVIAEYVFPGSIPGFYTHLEYIKLAP* |
| Ga0066903_1075338532 | 3300005764 | Tropical Forest Soil | FNEFAEIPLFWLYADAAVNPKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0066903_1078250731 | 3300005764 | Tropical Forest Soil | AEIPLFWLYADAAVNPKYIAEYVFPGVITGYFTHLEYVKLAP* |
| Ga0066903_1085478521 | 3300005764 | Tropical Forest Soil | DIPLFWLFAEATANPKYVAEYVFPGVITGYFTHLEYIRLAP* |
| Ga0081455_100193566 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LFAEATANPKYVAEYVFPGVITGYFTHLEYIRLAL* |
| Ga0081455_100972535 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LFWLFAEATANPKYVAEYVFPGVITGYFTHLEYIRLAP* |
| Ga0081455_106904461 | 3300005937 | Tabebuia Heterophylla Rhizosphere | PLFWLFAEAAVNPKYVAEYTFPGVITGYFSHLEYVKLAP* |
| Ga0075417_102601282 | 3300006049 | Populus Rhizosphere | KFNEFAEIPLFWLYADAAVNPKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0070716_1010174751 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | IPLFWLYAEATLNPKYVAEYTFPGIVTGFFTHLEYIKPAP* |
| Ga0075427_100680071 | 3300006194 | Populus Rhizosphere | EIGDHKFDAFAEIPMFWLFAEAAVNPKYIAEYAFPGVITGSFTHLEYIKVAQ* |
| Ga0066659_117099111 | 3300006797 | Soil | LFAEAVVNPKYVAEYVFPGVITGFFTHLEYVKLAQ* |
| Ga0075428_1002090313 | 3300006844 | Populus Rhizosphere | PLAALFADAAINPKFIAEYTFPGIITGFYTHLEYVKLAP* |
| Ga0075430_1003910992 | 3300006846 | Populus Rhizosphere | EFAEMALFWLFAEVAVNPRVIAEYVFPGSIPGFYTHLEYIKLAP* |
| Ga0075433_117432261 | 3300006852 | Populus Rhizosphere | QEFADMPLFWLYAEAGVHPAYVAEYIFPGSITGFFTHLEYVKPAP* |
| Ga0075429_1001440542 | 3300006880 | Populus Rhizosphere | HKFNEFAEMALFWLFAEVAVNPRVIAEYVFPGSIPGFYTHLEYIKLAP* |
| Ga0075429_1009461841 | 3300006880 | Populus Rhizosphere | KFNEFAEMALFWLFAEVAVNPRVIAEYVFPGSIPGFYTHLEYIKLAP* |
| Ga0075429_1015434722 | 3300006880 | Populus Rhizosphere | MPLFWLYAEAGVHPKYVAEYIFPGSITGFFTHLEYVKLAP* |
| Ga0075424_1022257602 | 3300006904 | Populus Rhizosphere | MFWLYAEAVVNPKYIAEYVFPGVITGFFTHLEYVQLAQ* |
| Ga0075419_102849202 | 3300006969 | Populus Rhizosphere | WLYADAAVNPKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0075435_1012039331 | 3300007076 | Populus Rhizosphere | MPLFWLFAEAAVNPKYIAEYVFPGVITGYFTHLEYVKLAP* |
| Ga0099794_104827421 | 3300007265 | Vadose Zone Soil | HKFTEFAEIPLFWLFAEATVNPKYIAEYVFPGVITGYYTHLEYIKLAP* |
| Ga0066710_1027746592 | 3300009012 | Grasslands Soil | MFWLFAEAAVNPKYIAEYVFPGVITGSFTHLEYIKVAQ |
| Ga0066710_1030725661 | 3300009012 | Grasslands Soil | NEFAEMALFWLFAEVAVNPRVIAEYVFPGSIPGFYTHLEYIKLAP |
| Ga0066710_1035586942 | 3300009012 | Grasslands Soil | PLFWLFAEATVNPKYVAEYTYPGVSTGYSSHLEYIKLAP |
| Ga0099829_104252582 | 3300009038 | Vadose Zone Soil | MPLFLLYAEAGVNPKYIAEYIFPGSITGFFTHLEYIKLAQ* |
| Ga0099829_112690012 | 3300009038 | Vadose Zone Soil | NEFASMPLFFLYADAAVNPKYIAEYVFPGVITGFFTHLEYVKLAP* |
| Ga0099828_105703521 | 3300009089 | Vadose Zone Soil | EIPMFWLFAEAIVNPKYIAEYVFPGVITGSFTHLEYIKVAQ* |
| Ga0099827_103573494 | 3300009090 | Vadose Zone Soil | PLFWLFAEAAVNPKYVAEYVFPGVITGSFTHLEYVKPAP* |
| Ga0099827_111979232 | 3300009090 | Vadose Zone Soil | EFAEIPLFWLDAEAAVNPKYIAEYTFPGIITGYFTHLEYVKLAP* |
| Ga0099827_115974792 | 3300009090 | Vadose Zone Soil | FAEAAVNPKYIAEYVFPGVITGFFTHLEYIKLAP* |
| Ga0111539_112725642 | 3300009094 | Populus Rhizosphere | LFWLFAEAAVNPKYVAEYTFPGVITGYFPHLEYVKLAP* |
| Ga0111539_131152071 | 3300009094 | Populus Rhizosphere | GDHKFQEFADMPLFWLYAEAGVHPQYVAEYIFPGSITGFFTHLEYVKLAP* |
| Ga0075418_110097142 | 3300009100 | Populus Rhizosphere | DMPMFWLRAEAGVNPKYISEYTFPGSITGFFTHLEYLKLAQ* |
| Ga0075418_122403351 | 3300009100 | Populus Rhizosphere | HKFNEFAEIPLFWLYADAAVNPKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0075418_125544872 | 3300009100 | Populus Rhizosphere | LFAEAAVNPKYVAEYTFPGVITGYFSHLEYVKLAP* |
| Ga0066709_1003106551 | 3300009137 | Grasslands Soil | KFNEFADMPLFWLFAEAGVNPKYIVEYTFPGNITGFFTHLEYIKLAQ* |
| Ga0066709_1023585082 | 3300009137 | Grasslands Soil | WLDAEAVVNPKYIAEYTFPGVITGYFTHLEYVRLAP* |
| Ga0114129_102919853 | 3300009147 | Populus Rhizosphere | FNEFADMPLFWLFAEAGVNPKYIAEYVFPGSITGFFTHLEYIKLAQ* |
| Ga0114129_109635851 | 3300009147 | Populus Rhizosphere | EFAEIPMFWLFAEATVNPRYVAEYTFPGVITGYFTHLEYIKLAP* |
| Ga0114129_124869832 | 3300009147 | Populus Rhizosphere | TEFAEIPLFWLFAEAAVNPKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0111538_101197085 | 3300009156 | Populus Rhizosphere | LFAEAGVNPKYIAEYTFPGSITGFFTHLEYITLAQ* |
| Ga0111538_105514163 | 3300009156 | Populus Rhizosphere | FQEFVDMPLFWLYAEAGVHPKYVAEYIFPGSITGFFTHLEYVKLAP* |
| Ga0111538_111009121 | 3300009156 | Populus Rhizosphere | SEFAEMPMFWLYAEAVVNPKYIAEYVFPGVITGFFTHLEYVQLAQ* |
| Ga0111538_116469991 | 3300009156 | Populus Rhizosphere | FQEFADMPLFWLYAEAGVHPTYVAEYIFPGSITGFFTHLEYVKLAP* |
| Ga0111538_127475251 | 3300009156 | Populus Rhizosphere | QKFQEFAEMPLFWLFAEAAVNPKVVAEYVFPGSIPGFYTHLEYIKLAP* |
| Ga0075423_124777202 | 3300009162 | Populus Rhizosphere | PMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0114945_101682472 | 3300009444 | Thermal Springs | PLFWLFAEATVNPKYVAEYVFPGVITGYYTHLEYIRLAP* |
| Ga0114945_103393182 | 3300009444 | Thermal Springs | FAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0114944_11939621 | 3300009691 | Thermal Springs | PMFWLLAEATVNPKFVAEYVFPGSITGFFTHLEYVKLAP* |
| Ga0114944_12142162 | 3300009691 | Thermal Springs | SEIPLFWLFAEAAVNPKYIAEYVFPGIITGYYTHLEHIKLAP* |
| Ga0114944_12850822 | 3300009691 | Thermal Springs | LFAEAAINPKFIAAYVFPGVITGYYTHLEYIKLAP* |
| Ga0126374_108975511 | 3300009792 | Tropical Forest Soil | AEIPLFWLYADAAVNPKYIAEYAFPGIVTGFFTHLEYVKLVP* |
| Ga0126374_109852082 | 3300009792 | Tropical Forest Soil | FWLRAEAGVNPKYVAEYHFPGSITGFFTHLEYVKLAQ* |
| Ga0126374_111763202 | 3300009792 | Tropical Forest Soil | DHKFTEFADILLFWLFAEATANPKYVAEYVFPGVITGYFTHLEYIRLAP* |
| Ga0126374_118114381 | 3300009792 | Tropical Forest Soil | SAEASVHPQYVAEYIFPGSITGFFTHLEYVKLAP* |
| Ga0105082_10325122 | 3300009814 | Groundwater Sand | DHKFNEFADMPLFLLYAEAGVNPKYIAEYIFPGSITGFFTHLEYIKLAQ* |
| Ga0105076_10313051 | 3300009816 | Groundwater Sand | IPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLVP* |
| Ga0105076_10880332 | 3300009816 | Groundwater Sand | MFWLLAEAVVNPKFITEYVFPGSITGFFTHLEYIKLAQ* |
| Ga0105085_10192991 | 3300009820 | Groundwater Sand | NEFAEIPLFWLYAEATVNPKYIAEYTFPGVITGYFTHLEYVRLAP* |
| Ga0105085_11272082 | 3300009820 | Groundwater Sand | DIPLFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLVP* |
| Ga0105066_11717461 | 3300009822 | Groundwater Sand | EIGDHKFTEFAEMPMFWLFAEAAVNPKYIAEYVFPGVITGYFTHLEHIKLVP* |
| Ga0126315_102919122 | 3300010038 | Serpentine Soil | PLFWLFAEAGVNPKYISEYTFPGSITGFFTHLEYIKLAQ* |
| Ga0126315_104948981 | 3300010038 | Serpentine Soil | AEMPLFWLFAEAAVNPRVIEEYVFPGSIAGFYTHLEYLKLAP* |
| Ga0126314_106116451 | 3300010042 | Serpentine Soil | EFAEMPMFWLYAEAVVNPKYIAEYVFPGVITGFFTHLEYVKLAQ* |
| Ga0126380_113571992 | 3300010043 | Tropical Forest Soil | VNPKFIADYEFPGTIVGYFTHLEYIKLTPQAGGR* |
| Ga0126384_103701101 | 3300010046 | Tropical Forest Soil | EIGDYKFNEFAEMPMFWLFAEAVVNPKYIAEYVFPGVITGFFTHLEYVKLAQ* |
| Ga0126384_107809822 | 3300010046 | Tropical Forest Soil | MPLFWLFAEAAVNPKYIADYVFPGIITGFYTHLEYVKLAP* |
| Ga0126384_124387171 | 3300010046 | Tropical Forest Soil | GDHKFQEFADMPLFWLYAEAGVHPTYVTEYIFPGSITGFFTHLEYVKLAP* |
| Ga0126382_118294481 | 3300010047 | Tropical Forest Soil | IGDHKFTEFAEIPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0126382_119027292 | 3300010047 | Tropical Forest Soil | EFAEIPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0126382_124914861 | 3300010047 | Tropical Forest Soil | HKFYEFAEMPLFWLRAEAGVNPKYVAEYNFPGSITGYFTHLEYVKLTQ* |
| Ga0126321_13199061 | 3300010145 | Soil | EIPLAALFADAAVNPKFIADYTFPGVITGFYTHLEYIKLVP* |
| Ga0134065_103632852 | 3300010326 | Grasslands Soil | FWLFAEAAVNPKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0134080_101235411 | 3300010333 | Grasslands Soil | VEEFAEIPLFWLYAEATLNPKYVAEYTFPGIVTGFFTHLEYIKPAP* |
| Ga0126376_108047771 | 3300010359 | Tropical Forest Soil | FNEFAEIPLFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYVKLAP* |
| Ga0126376_112533391 | 3300010359 | Tropical Forest Soil | LFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0126376_126653642 | 3300010359 | Tropical Forest Soil | ADMPLFWLFAEAGVNPKYIAEYTFPGSITGFFTHLEYIKLAP* |
| Ga0126376_129540972 | 3300010359 | Tropical Forest Soil | AEMPMFWLFAEAVVNPKYIAEYVFPGVITGFFTHLEYVKLAQ* |
| Ga0126372_112275032 | 3300010360 | Tropical Forest Soil | AEIPLFWLYADAAVNPKYIAEYTFPGVITGYFTHLEYVKLVQ* |
| Ga0126372_123840362 | 3300010360 | Tropical Forest Soil | DYKFNEFAEMPMFWLFAEAVVNPKYVAEYVFPGVITGFFTHLEYVKLAQ* |
| Ga0126378_116428822 | 3300010361 | Tropical Forest Soil | FLQSYRKAFWLFAEAAVNPKYVAEYTFPGVITGFFTHLEYIKLAP* |
| Ga0126378_129379201 | 3300010361 | Tropical Forest Soil | TSYADMPLFWLFAEAAVNPKYIADYVFPGIITGFYTHLEYVKLAP* |
| Ga0126377_108669472 | 3300010362 | Tropical Forest Soil | MPLFWLSAEAGVHPQYVAEYIFPGSITGFFTHLEYVKPAP* |
| Ga0126377_114724752 | 3300010362 | Tropical Forest Soil | EIPLFWLYADAAMNPKYIADYSFPGIVTGFFTHLEYVKLAP* |
| Ga0126377_129729092 | 3300010362 | Tropical Forest Soil | FWLYADAAVNPKYIAEYTFPGIVTGFFTHLEYVKLAP* |
| Ga0126377_130736721 | 3300010362 | Tropical Forest Soil | IPLFWLYADAAVNPKYIAEYTFPGTITGYFTHLEYVKLAP* |
| Ga0126379_111567862 | 3300010366 | Tropical Forest Soil | FWLYADAAVNPKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0126379_115110562 | 3300010366 | Tropical Forest Soil | MPMFWLFAEAVVNPKYIAEYVFPGVITGFFTHLEYVKLAQ* |
| Ga0136847_100524811 | 3300010391 | Freshwater Sediment | NFNEFADMPLFWLFADATINPKFISEYVFTGIITGYYTHLEYIKLAQ* |
| Ga0136847_125347852 | 3300010391 | Freshwater Sediment | FNEFADIPLFWLFGDATINPKFISDYVFTGIITGYYTHLEYIKLAQ* |
| Ga0126383_121918151 | 3300010398 | Tropical Forest Soil | MFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0126383_134511982 | 3300010398 | Tropical Forest Soil | EFAEIPMFWLFAEATVNPKYVAEYVFPGVITGYFTHLEYVKLAP* |
| Ga0137455_12594871 | 3300011429 | Soil | MFWLFAEASVNPRYIAEYAFPGVITGSFTHLEYIKVAH* |
| Ga0137363_108664041 | 3300012202 | Vadose Zone Soil | EIPLFWLFAEATVNPKYIAEYTFPGVITGYFSHLEYVKLVP* |
| Ga0137374_108101372 | 3300012204 | Vadose Zone Soil | EMPLFWLFAEAAVNPKYIAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0137374_109474101 | 3300012204 | Vadose Zone Soil | GDHKFNEFAEMALFWLYAEVAVNPRVIAEYVFPGSIPGFYTHLEYIKLAP* |
| Ga0137380_101714193 | 3300012206 | Vadose Zone Soil | EFAEIPLFWLFAEATVHPKYIAEYVFPGVITGYYTHLEYIKLAP* |
| Ga0137379_105792461 | 3300012209 | Vadose Zone Soil | GDHKFTEFAEMALFWLFAEVAVNPRVIAEYVFPGSIPGFYTHLEYIKLAP* |
| Ga0137378_104067231 | 3300012210 | Vadose Zone Soil | EFAEIPLFWLYAEAVLNPKYIAEYTFPGIVTGFFTHLEYIKPAP* |
| Ga0137378_106895372 | 3300012210 | Vadose Zone Soil | WLFAEAAVNPKYVAEYVFPGVITGSFTHLEYVKPAP* |
| Ga0150985_1048004802 | 3300012212 | Avena Fatua Rhizosphere | AQFADATVNPKYIAEYTFPGVITGFYTHLEYIKLVP* |
| Ga0137386_100986413 | 3300012351 | Vadose Zone Soil | WLYAEVAVNPRVIAEYVFPGSIPGFYTHLEYVKLAP* |
| Ga0137366_103494473 | 3300012354 | Vadose Zone Soil | EFAEIPMFWLFAEAAVNPKYIAEYVFPGVITGSFTHLEYVKVAQ* |
| Ga0137366_104329761 | 3300012354 | Vadose Zone Soil | HKFTEFAEMPMFWLFAEAAVNPKYIAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0137369_104791371 | 3300012355 | Vadose Zone Soil | EFAEIPLVWLFAEATVNPKYIAEYVFPGVITGYFTHLEYVRLAP* |
| Ga0137369_109257422 | 3300012355 | Vadose Zone Soil | AALFADAAINPKFIAEYTFPGMITGFYTHLEYIKLVP* |
| Ga0137384_102815472 | 3300012357 | Vadose Zone Soil | FWLYAEAAVNSKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0137384_110143101 | 3300012357 | Vadose Zone Soil | LFWLFAEVAVNPRVIAEYVFPGSIPGFYTHLEYIKLAP* |
| Ga0137385_104913442 | 3300012359 | Vadose Zone Soil | KFDAFAEIPMFWLFAEAAVNPEYIAEYVFPGVITGSFTHLEYIKVAQ* |
| Ga0137385_105578392 | 3300012359 | Vadose Zone Soil | EEFAEITMCWLDAEAVVNPKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0137385_112442821 | 3300012359 | Vadose Zone Soil | FTEFAEIPLFWLFAEAVVNPKYIAEYVFPGVITGSFTHLEYVKPAP* |
| Ga0137385_116464131 | 3300012359 | Vadose Zone Soil | EFAEIPLFWLYADAAVNPKYVAEYVFPGVITGYFTHLEYVKLAP* |
| Ga0137360_109019092 | 3300012361 | Vadose Zone Soil | EIGDHKFTEFAEMPMFWLFAEAAVNPKYIAEYVFPGVITGYFTHLEYVKLAP* |
| Ga0137360_112443152 | 3300012361 | Vadose Zone Soil | EMALFWLFAEAAVNPRVIAEYVFPGSIPGFYTHLEYVKLAP* |
| Ga0134060_11031832 | 3300012410 | Grasslands Soil | LFAEAGVNPKYISEYTFPGSITGFFTHLEYIKLAQ* |
| Ga0137394_108781292 | 3300012922 | Vadose Zone Soil | AEIPLFWLFAEATVNPKYIAEYTFPGVITGYFSHLEYVKLVP* |
| Ga0137407_103799852 | 3300012930 | Vadose Zone Soil | FAEIPLFWLFAEAAVNPKYVAEYVFPGVITGSFTHLEYVKPAP* |
| Ga0137407_115582831 | 3300012930 | Vadose Zone Soil | IPLFWLFAEATVNPKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0137410_100312751 | 3300012944 | Vadose Zone Soil | HKFNEFADMPLFWLFAEAGVNPKYIAEYTFPGSITGFFTHLEYIKLVQ* |
| Ga0137410_101821682 | 3300012944 | Vadose Zone Soil | EIPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLVP* |
| Ga0137410_116038742 | 3300012944 | Vadose Zone Soil | DEFAEIPMFWLFAEAAVNPKYIAEYAFPGVITGSFTHLEYIKVAQ* |
| Ga0126375_100692841 | 3300012948 | Tropical Forest Soil | LFAEATANPKYVAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0126375_103851022 | 3300012948 | Tropical Forest Soil | PLFWLSAEAGVHPTYVAEYIFPGSITGFFTHLEYVKLAP* |
| Ga0126375_117245083 | 3300012948 | Tropical Forest Soil | LFAEATVNPKYVAEYTFPGVITGVFTHLEYVKLASE* |
| Ga0126369_107314621 | 3300012971 | Tropical Forest Soil | LFWLFAEATVNPKYVAEYVFPGVITGYFTHLEYIRLAP* |
| Ga0126369_118498252 | 3300012971 | Tropical Forest Soil | LRAEAGVNPKYIAEYTFPGSITGFFTHLEYVKLVQ* |
| Ga0134077_105833431 | 3300012972 | Grasslands Soil | GDHKFTEFAEMPMFWLFAEAAVNPKYIAEYVFPGVITGYFTHLEYIKLAP* |
| Ga0137409_106853392 | 3300015245 | Vadose Zone Soil | FADMPLFLLYAEAGVNPKYIAEYNFPGSITGFFTHLEYLKLAQ* |
| Ga0132258_124280842 | 3300015371 | Arabidopsis Rhizosphere | HKFQAFADMPLFWLSAEAGVHPQYVAAYIFPGSITGFFTHLEYVKLAP* |
| Ga0132256_1011724272 | 3300015372 | Arabidopsis Rhizosphere | EIPLFWLYADAAVNPKYIAEYTFPGVITGYFTHLEYVKLAP* |
| Ga0182040_119361242 | 3300016387 | Soil | TAFAEMPMFWLFAEATVNPKYIADYVFPGVITGYFTHLEYIKLTP |
| Ga0182037_108759532 | 3300016404 | Soil | AEIPLFWLFAEATANPKYVAEYVFPGVITGYFTHLEYIKLAP |
| Ga0134112_105173862 | 3300017656 | Grasslands Soil | MPLFWLFAEAAVNLKYIAEYVFPGVITGYFTHLEYIKLAP |
| Ga0190266_102969334 | 3300017965 | Soil | FWLFAEATVNPKYVAEYTFPGVITGVFTHLEYVKLASE |
| Ga0184610_10966692 | 3300017997 | Groundwater Sediment | IPLFWLFAEATVNPKYVAEYVFPGVITGYFSHLEYIKLAP |
| Ga0184623_100995682 | 3300018056 | Groundwater Sediment | FAEIPMFWLFAEAAVNPRYIAEYVFPGVITGSFTHLEYIKVAQ |
| Ga0184623_103797081 | 3300018056 | Groundwater Sediment | IPLFWLFAEATVNPKFIADYEFPGTIVGYFTHLEYIRLAP |
| Ga0184637_103002941 | 3300018063 | Groundwater Sediment | DHKFTEFAEIPLFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIRLAP |
| Ga0184609_104989102 | 3300018076 | Groundwater Sediment | IGDHGFNEFASMPLFFLYADAAVNPKYVAEYVFPGVITGYFTHLEYIKLAP |
| Ga0184612_102659441 | 3300018078 | Groundwater Sediment | MFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP |
| Ga0184627_104325392 | 3300018079 | Groundwater Sediment | PLFFLYADAAVNPKYVAEYTFPGVITGFFTHLEYVKLAQ |
| Ga0184629_105980931 | 3300018084 | Groundwater Sediment | EIPLFWLFAEAAVNPKYIAEYTFPGVITGYFTHLEYVKLAP |
| Ga0190268_118220971 | 3300018466 | Soil | IGDHKFNEFADMPLFLLFAEAGVNPKYIAEYNFPGSITGFFTHLEYLKLAQ |
| Ga0180110_12221421 | 3300019208 | Groundwater Sediment | EFAALPLFFLYADAAVNPKYIAEYVFPGVITGFFTHLEYVKLVQ |
| Ga0180106_12619481 | 3300019212 | Groundwater Sediment | FAEMPMFWLFAQAVVNPKYVAEYVFPGVITGFFTHLEYVKLVQ |
| Ga0180119_11946751 | 3300019228 | Groundwater Sediment | TEFAEMPMFWLFAQAVVNPKYVAEYVFPGVITGFFTHLEYVKLVQ |
| Ga0180119_13744542 | 3300019228 | Groundwater Sediment | VNHKFDEFAEIPMFWLFAEASVNPRYITEYAFPGVITGSFTHLEYIKVAR |
| Ga0180116_10588252 | 3300019229 | Groundwater Sediment | FLYADASINPKYIAEYVFPGVITGFFTHLEYIKLVP |
| Ga0180114_12353752 | 3300019232 | Groundwater Sediment | DMPLFWLYAEAGVNPKYIAEYIFPGSITGFFTHLEYIKLAQ |
| Ga0184645_10075863 | 3300019233 | Groundwater Sediment | FAEIPMFWLFAEAAVNPKYIAEYVFPGVITGSFTHLEYIKVAQ |
| Ga0180112_13615081 | 3300019238 | Groundwater Sediment | NEFAEMPLFLLYAEAGVNPKYIAEYNFPGSITGFFTHLEYLKLAQ |
| Ga0184648_11499861 | 3300019249 | Groundwater Sediment | PMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP |
| Ga0184648_12727092 | 3300019249 | Groundwater Sediment | FNEFASMPLFFLYADAAVNPKYIAEYVFPGVITGFFTHLEYIKLAQ |
| Ga0184648_13177191 | 3300019249 | Groundwater Sediment | NEFASIPLFFLYADAAVNPKYVAEYTFPGVITGFFTHLEYVKLAQ |
| Ga0184641_10087452 | 3300019254 | Groundwater Sediment | EIGDYKFTEFAEMPMFWLFAEATVNPKYVAEYTFPGVITGFFTHLEYVKLAQ |
| Ga0184641_11091362 | 3300019254 | Groundwater Sediment | LFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP |
| Ga0184643_11764552 | 3300019255 | Groundwater Sediment | FNEFAEIPLFWLYAEAAVNPKDIAEYTFPGIITGFFTHLEYVKLAP |
| Ga0184646_13897402 | 3300019259 | Groundwater Sediment | HKFNEFAEIPLFWLYAEAAVNPKYIAEYTFPGVITGYFSHLEYVKLAP |
| Ga0184642_16495572 | 3300019279 | Groundwater Sediment | MPLFLLFAEAGVNPKYIAEYVFPGSITGFFTHLEYIKLAQ |
| Ga0187892_102277952 | 3300019458 | Bio-Ooze | LFAEATLNPKYVAEYTFPGVITGFFTHLEYVKPVQ |
| Ga0180113_11040461 | 3300020065 | Groundwater Sediment | YKFTEFAEMPMFWLFAQAVVNPKYIAEYTFPGVITGFFTHLEYVKLVQ |
| Ga0180109_10498071 | 3300020067 | Groundwater Sediment | MPLFLLYAEAGVNPKYIAEYNFPGSITGFFTHLEYLKLAQ |
| Ga0194131_101914502 | 3300020193 | Freshwater Lake | PLFFLYADAAVNPKYVAEYTFPGVITGFFTHLEYVKLVQ |
| Ga0212128_100942101 | 3300022563 | Thermal Springs | PLFWLFAEAAVNPKYIAEYVFPGIITGYYTHLEYIKLAP |
| Ga0209827_110015972 | 3300025149 | Thermal Springs | DLRFNEFSEIPLFWLFAEAAVNPKYIAEYVFPGIITGYYTHLEHIKLAP |
| Ga0209399_101479112 | 3300025157 | Thermal Springs | FSDIPLFWFSAEAAVNPRFIAEYVFPGIITGFYTHLEYIKLAQ |
| Ga0207670_104222131 | 3300025936 | Switchgrass Rhizosphere | REIGDHKFQEFADMPLFWLYAEAGVHPAYVAEYIFPGSITGFFTHLEYVKLAP |
| Ga0207712_100488133 | 3300025961 | Switchgrass Rhizosphere | GDHKVNEFAEIPLFWLYAEAAVNPKYIAEYTFPGIITGYFTHLEYVKLEP |
| Ga0207708_106500694 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | PLFWLFAEATVNPKYVAEYTFPGVITGVFTHLEYVKLASE |
| Ga0209761_11867782 | 3300026313 | Grasslands Soil | FWLFAEAAVNPKYIAEYVFPGVITGSFTHLEYVKPAP |
| Ga0209879_10672682 | 3300027056 | Groundwater Sand | LFWLFADATVNPRYIAEYVFPGVITGYYTHLEYIKLVP |
| Ga0209388_10112556 | 3300027655 | Vadose Zone Soil | EFAEIPLFWLFAEAAVNPKYIAEYVFPGVITGSFTHLEYVKPAP |
| Ga0209388_11764852 | 3300027655 | Vadose Zone Soil | FWLFAEAAVNPRVIAEYVFPGSIPGFYTHLEYVKLAP |
| Ga0209388_11918061 | 3300027655 | Vadose Zone Soil | FAEIPLFWLFAEATVNPKYVAEYVFPGVITGSFTHLEYVKPVP |
| Ga0209461_100427071 | 3300027750 | Agave | TEFAEMPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLVP |
| Ga0209283_103892501 | 3300027875 | Vadose Zone Soil | AEIPLFWLFAEATVNPKYIAEYTFPGVITGYFTHLEYVKLAP |
| Ga0209481_103793641 | 3300027880 | Populus Rhizosphere | LFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLVP |
| Ga0209590_104208581 | 3300027882 | Vadose Zone Soil | IGDHKFTEFAEMPMFWLFAEAAVNPKYIAEYVFPGVITGYFTHLEYVKLAP |
| Ga0209488_107915231 | 3300027903 | Vadose Zone Soil | EFADMPLFWLFAEAGVNPKYIAEYTFPGSITGFFTHLEYIKLVQ |
| Ga0209488_111142482 | 3300027903 | Vadose Zone Soil | VTRVLGLGQFADIPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLVP |
| Ga0207428_112799801 | 3300027907 | Populus Rhizosphere | FWLFAEVAVNPRVIAEYVFPGSIPGFYTHLEYIKLAP |
| Ga0209382_106082882 | 3300027909 | Populus Rhizosphere | ASMPLFFLYADASINPKYIAEYVFPGVITGFFTHLEYVKLAQ |
| Ga0209853_10031361 | 3300027961 | Groundwater Sand | LFFLYADAAINPKYIAEYVFPGVITGFFTHLEYIKLAP |
| Ga0137415_113540681 | 3300028536 | Vadose Zone Soil | EFAEIPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLVP |
| Ga0247647_10420662 | 3300030570 | Soil | EMPLFLLYAEAGVNPKYIAEYNFPGSITGFFTHLEYLKLAQ |
| Ga0247647_11856631 | 3300030570 | Soil | LFAEASVNPRYIAEYAVAGEITGNITHMEYIKVAQ |
| Ga0247644_11038941 | 3300030576 | Soil | PLFWLFAEATVNPKYIAEYVFPGVITGYYTHLEYVRLAP |
| Ga0247636_101439981 | 3300030634 | Soil | YKFSEFAEMPMFWLFAQAVVNPKYVAEYVFPGVITGFFTHLEYVKLVQ |
| Ga0308202_10495082 | 3300030902 | Soil | PLFLLYAEAGVNPKYIAQYNFPGSITGFFTHLEYIQLAQ |
| Ga0308206_11329232 | 3300030903 | Soil | AEIPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLAP |
| Ga0308204_103117311 | 3300031092 | Soil | MPLFFLYADAAVNPKYIAEYVFPGVITGFFTHLEYVKLAP |
| Ga0308197_104046882 | 3300031093 | Soil | EFAEIPLFWLYADAAVNPKYIAEYTFPGIVTGFFTHLEYVKLAP |
| Ga0308199_10319062 | 3300031094 | Soil | GDHKFNEFADMPLFLLYAEAGVNPKYIAEYIFPGSITGFFTHLEYIKLAQ |
| Ga0308199_10860851 | 3300031094 | Soil | HKFNAFAEIPMFWLFAEAAVNPKYIAEYVFPGVITGSFTHLEYVKVAQ |
| Ga0299914_112556471 | 3300031228 | Soil | WLRAEAGVNPQYIAEYNFPGSITGFYTHLEYVKLVQ |
| Ga0310915_105240001 | 3300031573 | Soil | MPLFWLSAEAGVHPTYVAEYIFPGSITGFFTHLEYVKLAP |
| Ga0307468_1022860001 | 3300031740 | Hardwood Forest Soil | MPLFWLSAEAGVHPTHVAEYIFPGSITGFFTHLEYVKLVP |
| Ga0306918_106720182 | 3300031744 | Soil | HKFTEFAEIPMFWLFAEATVNPKYIAEYVFPGVITGYFTHLEYIKLTP |
| Ga0306918_107741772 | 3300031744 | Soil | EIPLFWLFAEATANPKYVAEYVFPGVITGYFTHLEYIKLAP |
| Ga0307473_109275182 | 3300031820 | Hardwood Forest Soil | MFWLYAEAVVNPKYIAEYVFPGVITGFFTHLEYVKLAQ |
| Ga0318520_101950332 | 3300031897 | Soil | MPLFWLYAEAGVHPQYVAEYIFPGSITGFFTHLEYVKLAP |
| Ga0306923_110123182 | 3300031910 | Soil | HKFQEFAEMPLFWLSAEAGVHPTYVADYIFPGSITGFFTHLEYVKLAP |
| Ga0307416_1032111881 | 3300032002 | Rhizosphere | KFNEFAEIPLFWLYADAAVNPKYIAEYTFPGIVTGFFTHLEYVKLAP |
| Ga0310890_115956432 | 3300032075 | Soil | NEFADMPLFWLRAEAGVNPKYISEYTFPGSITGFFTHLEYIKLVQ |
| Ga0315281_120286372 | 3300032163 | Sediment | MPLFWLFAEVAVNPKYVAEYVFPGVTTGFFTHLEYVKLAP |
| Ga0307471_1037104191 | 3300032180 | Hardwood Forest Soil | KFAEFAEIPMFWLFAEATVNPKYIAEYVFPGVITGSFTHLEYVKLAP |
| Ga0306920_1042865731 | 3300032261 | Soil | MPLFWLSAEAGVHPTYVADYIFPGSITGFFTHLEYVKLAP |
| Ga0364924_152793_3_119 | 3300033811 | Sediment | LFWLFAEATVNPKYVAEYVFPGVITGFFTHLEYVKLAP |
| Ga0314783_018298_3_119 | 3300034662 | Soil | LFWLYAEAGVHPKYVAEYIFPGSITGFFTHLEYVKLAP |
| Ga0314799_030627_491_604 | 3300034674 | Soil | FWLRAEAGVNPKYITEYTFPGSITGFFTHLEYIKLVQ |
| ⦗Top⦘ |