


| Basic Information | |
|---|---|
| Family ID | F019367 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 230 |
| Average Sequence Length | 41 residues |
| Representative Sequence | STTLYQHQSTLRLMLKGLGVTVFPGAAASAPDMSEFFTP |
| Number of Associated Samples | 184 |
| Number of Associated Scaffolds | 230 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 95.22 % |
| % of genes from short scaffolds (< 2000 bps) | 87.83 % |
| Associated GOLD sequencing projects | 176 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.609 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (18.261 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.565 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.435 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 230 Family Scaffolds |
|---|---|---|
| PF02368 | Big_2 | 17.39 |
| PF16861 | Carbam_trans_C | 2.61 |
| PF07238 | PilZ | 1.74 |
| PF01411 | tRNA-synt_2c | 1.74 |
| PF00072 | Response_reg | 1.30 |
| PF00535 | Glycos_transf_2 | 1.30 |
| PF13860 | FlgD_ig | 1.30 |
| PF00150 | Cellulase | 1.30 |
| PF04185 | Phosphoesterase | 1.30 |
| PF11695 | DUF3291 | 1.30 |
| PF00196 | GerE | 0.87 |
| PF00149 | Metallophos | 0.87 |
| PF01019 | G_glu_transpept | 0.87 |
| PF10509 | GalKase_gal_bdg | 0.87 |
| PF03631 | Virul_fac_BrkB | 0.87 |
| PF02535 | Zip | 0.87 |
| PF02543 | Carbam_trans_N | 0.87 |
| PF00069 | Pkinase | 0.87 |
| PF04191 | PEMT | 0.43 |
| PF12728 | HTH_17 | 0.43 |
| PF13431 | TPR_17 | 0.43 |
| PF13401 | AAA_22 | 0.43 |
| PF12464 | Mac | 0.43 |
| PF01926 | MMR_HSR1 | 0.43 |
| PF14522 | Cytochrome_C7 | 0.43 |
| PF13414 | TPR_11 | 0.43 |
| PF07995 | GSDH | 0.43 |
| PF02321 | OEP | 0.43 |
| PF13229 | Beta_helix | 0.43 |
| PF07676 | PD40 | 0.43 |
| PF01618 | MotA_ExbB | 0.43 |
| PF13520 | AA_permease_2 | 0.43 |
| PF04679 | DNA_ligase_A_C | 0.43 |
| PF04476 | 4HFCP_synth | 0.43 |
| PF01553 | Acyltransferase | 0.43 |
| PF04519 | Bactofilin | 0.43 |
| PF08241 | Methyltransf_11 | 0.43 |
| PF03979 | Sigma70_r1_1 | 0.43 |
| PF02518 | HATPase_c | 0.43 |
| PF07730 | HisKA_3 | 0.43 |
| PF12663 | DUF3788 | 0.43 |
| PF04014 | MazE_antitoxin | 0.43 |
| PF07927 | HicA_toxin | 0.43 |
| PF00733 | Asn_synthase | 0.43 |
| PF10136 | SpecificRecomb | 0.43 |
| PF12867 | DinB_2 | 0.43 |
| PF13727 | CoA_binding_3 | 0.43 |
| PF04365 | BrnT_toxin | 0.43 |
| PF09678 | Caa3_CtaG | 0.43 |
| PF13527 | Acetyltransf_9 | 0.43 |
| PF14907 | NTP_transf_5 | 0.43 |
| PF08281 | Sigma70_r4_2 | 0.43 |
| PF04055 | Radical_SAM | 0.43 |
| PF02423 | OCD_Mu_crystall | 0.43 |
| PF00107 | ADH_zinc_N | 0.43 |
| PF05598 | DUF772 | 0.43 |
| PF04542 | Sigma70_r2 | 0.43 |
| PF07681 | DoxX | 0.43 |
| PF00027 | cNMP_binding | 0.43 |
| PF09860 | DUF2087 | 0.43 |
| PF13620 | CarboxypepD_reg | 0.43 |
| PF03481 | Sua5_C | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 230 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.48 |
| COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.74 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 1.30 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.30 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 1.30 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.87 |
| COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.87 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.87 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.87 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.87 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.43 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.43 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.43 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.43 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.43 |
| COG1891 | 4-(hydroxymethyl)-2-furancarboxaldehyde phosphate synthase MfnB | Coenzyme transport and metabolism [H] | 0.43 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.43 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.43 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.43 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.43 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.43 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.43 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.43 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.43 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.43 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.61 % |
| Unclassified | root | N/A | 7.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_83682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300002917|JGI25616J43925_10368487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 530 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10037333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1797 | Open in IMG/M |
| 3300004463|Ga0063356_105915792 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005166|Ga0066674_10100542 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300005434|Ga0070709_11718236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 512 | Open in IMG/M |
| 3300005440|Ga0070705_100364045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1059 | Open in IMG/M |
| 3300005444|Ga0070694_100864328 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 745 | Open in IMG/M |
| 3300005446|Ga0066686_11096014 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005447|Ga0066689_10193610 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300005447|Ga0066689_10500303 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 766 | Open in IMG/M |
| 3300005451|Ga0066681_10376802 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005455|Ga0070663_101170598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 674 | Open in IMG/M |
| 3300005466|Ga0070685_10070545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2069 | Open in IMG/M |
| 3300005518|Ga0070699_101031903 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005529|Ga0070741_10501529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300005534|Ga0070735_10467448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 752 | Open in IMG/M |
| 3300005536|Ga0070697_101462768 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005541|Ga0070733_10447371 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005552|Ga0066701_10066679 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
| 3300005552|Ga0066701_10081339 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300005552|Ga0066701_10201419 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300005552|Ga0066701_10449886 | Not Available | 799 | Open in IMG/M |
| 3300005555|Ga0066692_10994961 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005556|Ga0066707_10346563 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005557|Ga0066704_10350627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 989 | Open in IMG/M |
| 3300005563|Ga0068855_100482167 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300005568|Ga0066703_10046103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2424 | Open in IMG/M |
| 3300005574|Ga0066694_10305283 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005574|Ga0066694_10546788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300005598|Ga0066706_10532887 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005618|Ga0068864_102514329 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005764|Ga0066903_100871042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1624 | Open in IMG/M |
| 3300005764|Ga0066903_106852312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 592 | Open in IMG/M |
| 3300005885|Ga0075284_1014340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 928 | Open in IMG/M |
| 3300005899|Ga0075271_10014805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1401 | Open in IMG/M |
| 3300005921|Ga0070766_10032692 | All Organisms → cellular organisms → Bacteria | 2843 | Open in IMG/M |
| 3300006034|Ga0066656_10013236 | All Organisms → cellular organisms → Bacteria | 4231 | Open in IMG/M |
| 3300006034|Ga0066656_10670861 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 667 | Open in IMG/M |
| 3300006034|Ga0066656_11087773 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006052|Ga0075029_100340759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300006162|Ga0075030_100907810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 694 | Open in IMG/M |
| 3300006173|Ga0070716_101584444 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006175|Ga0070712_101167219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 669 | Open in IMG/M |
| 3300006755|Ga0079222_10001682 | All Organisms → cellular organisms → Bacteria | 6418 | Open in IMG/M |
| 3300006791|Ga0066653_10780381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
| 3300006794|Ga0066658_10246621 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300006796|Ga0066665_11304719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300006797|Ga0066659_10318736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1193 | Open in IMG/M |
| 3300006797|Ga0066659_10818029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 772 | Open in IMG/M |
| 3300006797|Ga0066659_10902179 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300006806|Ga0079220_10090725 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300006854|Ga0075425_101240370 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300006881|Ga0068865_100069492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 2492 | Open in IMG/M |
| 3300007076|Ga0075435_100530670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1018 | Open in IMG/M |
| 3300007255|Ga0099791_10060926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1699 | Open in IMG/M |
| 3300009012|Ga0066710_100997003 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300009012|Ga0066710_102382422 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300009012|Ga0066710_102493454 | Not Available | 748 | Open in IMG/M |
| 3300009012|Ga0066710_103093131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 644 | Open in IMG/M |
| 3300009012|Ga0066710_103696370 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300009038|Ga0099829_11405078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 577 | Open in IMG/M |
| 3300009090|Ga0099827_11306892 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
| 3300009101|Ga0105247_10908485 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300009137|Ga0066709_100614773 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300009137|Ga0066709_102474653 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300009137|Ga0066709_102544081 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300009177|Ga0105248_10497169 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300010140|Ga0127456_1240856 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300010303|Ga0134082_10336175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 637 | Open in IMG/M |
| 3300010322|Ga0134084_10242183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 648 | Open in IMG/M |
| 3300010323|Ga0134086_10171286 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 800 | Open in IMG/M |
| 3300010325|Ga0134064_10103474 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 940 | Open in IMG/M |
| 3300010326|Ga0134065_10193653 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300010333|Ga0134080_10437368 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300010335|Ga0134063_10385386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 685 | Open in IMG/M |
| 3300010337|Ga0134062_10035611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1979 | Open in IMG/M |
| 3300010359|Ga0126376_11115196 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300010359|Ga0126376_12278807 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010371|Ga0134125_12176778 | Not Available | 603 | Open in IMG/M |
| 3300010376|Ga0126381_100374961 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300010396|Ga0134126_10819689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
| 3300010403|Ga0134123_12487808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 584 | Open in IMG/M |
| 3300010866|Ga0126344_1169309 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300011120|Ga0150983_15961563 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300011269|Ga0137392_10619564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 898 | Open in IMG/M |
| 3300011270|Ga0137391_10310709 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300011270|Ga0137391_11177802 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300011271|Ga0137393_11285485 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012189|Ga0137388_11089642 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300012198|Ga0137364_10184934 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300012198|Ga0137364_10987662 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 637 | Open in IMG/M |
| 3300012198|Ga0137364_11257442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300012199|Ga0137383_11175078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
| 3300012200|Ga0137382_10316297 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1091 | Open in IMG/M |
| 3300012201|Ga0137365_10519504 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300012201|Ga0137365_11137776 | Not Available | 561 | Open in IMG/M |
| 3300012208|Ga0137376_10412290 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300012208|Ga0137376_11301611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
| 3300012211|Ga0137377_10107605 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2647 | Open in IMG/M |
| 3300012211|Ga0137377_11449291 | Not Available | 614 | Open in IMG/M |
| 3300012211|Ga0137377_11798310 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012349|Ga0137387_10243414 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300012349|Ga0137387_10367334 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300012351|Ga0137386_10236651 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300012356|Ga0137371_10058445 | All Organisms → cellular organisms → Bacteria | 2987 | Open in IMG/M |
| 3300012359|Ga0137385_10428423 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300012359|Ga0137385_10741147 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 819 | Open in IMG/M |
| 3300012360|Ga0137375_11378109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300012361|Ga0137360_11372586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012361|Ga0137360_11706241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300012385|Ga0134023_1212964 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012388|Ga0134031_1109976 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 781 | Open in IMG/M |
| 3300012401|Ga0134055_1191892 | Not Available | 988 | Open in IMG/M |
| 3300012402|Ga0134059_1224286 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300012409|Ga0134045_1175034 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300012469|Ga0150984_104447007 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012532|Ga0137373_10830347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 681 | Open in IMG/M |
| 3300012685|Ga0137397_10058711 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
| 3300012896|Ga0157303_10070173 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012917|Ga0137395_10049293 | All Organisms → cellular organisms → Bacteria | 2638 | Open in IMG/M |
| 3300012971|Ga0126369_10853581 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 995 | Open in IMG/M |
| 3300012972|Ga0134077_10130813 | Not Available | 990 | Open in IMG/M |
| 3300012975|Ga0134110_10053028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1600 | Open in IMG/M |
| 3300012975|Ga0134110_10396367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300012976|Ga0134076_10249177 | Not Available | 757 | Open in IMG/M |
| 3300012976|Ga0134076_10416593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
| 3300014154|Ga0134075_10489153 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300014166|Ga0134079_10244522 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300014501|Ga0182024_10003266 | All Organisms → cellular organisms → Bacteria | 38871 | Open in IMG/M |
| 3300014969|Ga0157376_10390742 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300015264|Ga0137403_11222845 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 597 | Open in IMG/M |
| 3300015356|Ga0134073_10060336 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300015356|Ga0134073_10079849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 933 | Open in IMG/M |
| 3300015356|Ga0134073_10374727 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
| 3300015357|Ga0134072_10005262 | All Organisms → cellular organisms → Bacteria | 2803 | Open in IMG/M |
| 3300015357|Ga0134072_10142883 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300015359|Ga0134085_10333448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 672 | Open in IMG/M |
| 3300016371|Ga0182034_10706212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300017654|Ga0134069_1014846 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
| 3300017657|Ga0134074_1210916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 691 | Open in IMG/M |
| 3300018433|Ga0066667_10974536 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300018433|Ga0066667_10976475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 730 | Open in IMG/M |
| 3300018468|Ga0066662_10807367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 911 | Open in IMG/M |
| 3300018468|Ga0066662_12935950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300018482|Ga0066669_10005144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6003 | Open in IMG/M |
| 3300019242|Ga0181502_1439299 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300020580|Ga0210403_11142371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300020581|Ga0210399_10620143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300021086|Ga0179596_10078251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1453 | Open in IMG/M |
| 3300021088|Ga0210404_10254203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300021088|Ga0210404_10784924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300021171|Ga0210405_10286408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1303 | Open in IMG/M |
| 3300021171|Ga0210405_10696781 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300021171|Ga0210405_11232918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300021178|Ga0210408_11101248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300021401|Ga0210393_11344860 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300021406|Ga0210386_11115653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 669 | Open in IMG/M |
| 3300021420|Ga0210394_10420229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1177 | Open in IMG/M |
| 3300021479|Ga0210410_11564738 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021559|Ga0210409_11708225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
| 3300022694|Ga0222623_10064706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1412 | Open in IMG/M |
| 3300022724|Ga0242665_10082665 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300023056|Ga0233357_1024125 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300025903|Ga0207680_10398670 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300025914|Ga0207671_11028326 | Not Available | 649 | Open in IMG/M |
| 3300025915|Ga0207693_10140950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1896 | Open in IMG/M |
| 3300025917|Ga0207660_10637359 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300025921|Ga0207652_11388720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300025922|Ga0207646_10013754 | All Organisms → cellular organisms → Bacteria | 7726 | Open in IMG/M |
| 3300025922|Ga0207646_10559539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1028 | Open in IMG/M |
| 3300025998|Ga0208651_1001692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1321 | Open in IMG/M |
| 3300026095|Ga0207676_10063658 | Not Available | 2930 | Open in IMG/M |
| 3300026142|Ga0207698_11338015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300026296|Ga0209235_1048112 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300026297|Ga0209237_1053922 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_69_8 | 1999 | Open in IMG/M |
| 3300026298|Ga0209236_1001614 | All Organisms → cellular organisms → Bacteria | 13605 | Open in IMG/M |
| 3300026298|Ga0209236_1055694 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300026310|Ga0209239_1194356 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300026327|Ga0209266_1128864 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1062 | Open in IMG/M |
| 3300026333|Ga0209158_1267821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300026334|Ga0209377_1108294 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300026335|Ga0209804_1036685 | All Organisms → cellular organisms → Bacteria | 2457 | Open in IMG/M |
| 3300026359|Ga0257163_1047197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300026515|Ga0257158_1092307 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300026523|Ga0209808_1158450 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 853 | Open in IMG/M |
| 3300026524|Ga0209690_1070963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1489 | Open in IMG/M |
| 3300026524|Ga0209690_1130922 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300026528|Ga0209378_1047622 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2105 | Open in IMG/M |
| 3300026532|Ga0209160_1134524 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300026532|Ga0209160_1185222 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300026537|Ga0209157_1322198 | Not Available | 561 | Open in IMG/M |
| 3300026537|Ga0209157_1328427 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300026540|Ga0209376_1081705 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300026548|Ga0209161_10030510 | All Organisms → cellular organisms → Bacteria | 3726 | Open in IMG/M |
| 3300026550|Ga0209474_10248775 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300026552|Ga0209577_10584590 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300027334|Ga0209529_1074286 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300027371|Ga0209418_1089384 | Not Available | 553 | Open in IMG/M |
| 3300027671|Ga0209588_1099398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 937 | Open in IMG/M |
| 3300027748|Ga0209689_1139697 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_4_69_5 | 1189 | Open in IMG/M |
| 3300027842|Ga0209580_10691883 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300028536|Ga0137415_10669497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 850 | Open in IMG/M |
| 3300028878|Ga0307278_10199593 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300028881|Ga0307277_10520686 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300028884|Ga0307308_10021109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2995 | Open in IMG/M |
| 3300029954|Ga0311331_10713177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300031250|Ga0265331_10248433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300031261|Ga0302140_11137016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300031446|Ga0170820_15962422 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031718|Ga0307474_10116783 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
| 3300031720|Ga0307469_12169674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300031754|Ga0307475_10648340 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300031820|Ga0307473_10126896 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_69_8 | 1411 | Open in IMG/M |
| 3300031893|Ga0318536_10289810 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300031962|Ga0307479_11224166 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 714 | Open in IMG/M |
| 3300031962|Ga0307479_12045786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
| 3300032180|Ga0307471_102916251 | Not Available | 607 | Open in IMG/M |
| 3300032205|Ga0307472_100424469 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300032205|Ga0307472_101178875 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 730 | Open in IMG/M |
| 3300032783|Ga0335079_10896797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 911 | Open in IMG/M |
| 3300032829|Ga0335070_10877664 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300033158|Ga0335077_10795483 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300033158|Ga0335077_10909416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 886 | Open in IMG/M |
| 3300033412|Ga0310810_11004459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300033475|Ga0310811_10420881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1448 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.30% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.30% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.87% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.43% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.43% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.43% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025998 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01409920 | 2199352024 | Soil | PLAKKGYQSTTLYQHQATLRLILQGLGINSFPGKAASAPQMLEFF |
| JGI25616J43925_103684871 | 3300002917 | Grasslands Soil | KQGYQSTTLYQHQSTLRLILQGLGISTYPGDASTAPEMGEFF* |
| JGIcombinedJ51221_100373331 | 3300003505 | Forest Soil | GYQSTTMYQHQSTLRLMLEALGISTLPGSASTAPDMGEFF* |
| Ga0063356_1059157922 | 3300004463 | Arabidopsis Thaliana Rhizosphere | QSSTLYQHQSTLRLMLKTLGVTGYPGAAATAPDMDEFLTP* |
| Ga0066674_101005421 | 3300005166 | Soil | GYQSTTLYQHASTMRLSLTALGVTTLPNGAATAPDMNEFFAP* |
| Ga0070709_117182362 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | QSTTLYQHQSTLRLMLKGLGVNSFPNDAATAPDMSEFFNP* |
| Ga0070705_1003640451 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VYWVAVSPTKSKRGYQSTTLYQHQSTLRLMLKGLGVTSFPGDAATAPDMSEFFNP* |
| Ga0070694_1008643281 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | RSTTLYQHQSTLRMMMQALGLSSYPGAAASAVEMGEFFTP* |
| Ga0066686_110960141 | 3300005446 | Soil | QSTTLYQHQSTLRLTVKALGLPGLPGTAATAPDMSEFFRP* |
| Ga0066689_101936101 | 3300005447 | Soil | STTLYQHQSTLRLILKGLGVTVFPGAAAMAPGMDEFFTP* |
| Ga0066689_105003032 | 3300005447 | Soil | VYWVAVSPTKSKRGYVSTTLYQHQSTLRLMLKGLGVTSFPGDAATAPDMSEFFTP* |
| Ga0066681_103768021 | 3300005451 | Soil | QSTTLYQHQSTLRLILKGLGATVFPGASASAPDMSEFFTP* |
| Ga0070663_1011705981 | 3300005455 | Corn Rhizosphere | KQGYRSSALYQHQSTLRLVLQGLGIQTYPAAAGTAREMGEFF* |
| Ga0070685_100705453 | 3300005466 | Switchgrass Rhizosphere | YRSATLFQHESTLRLALKALGVTSFPNGAASAPDMDEFFVP* |
| Ga0070699_1010319032 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | QSTTLYQHQSTLRLILEGLGVSTFPGDAGSAPDMSEFFTP* |
| Ga0070741_105015291 | 3300005529 | Surface Soil | IVGAMVKHGYQSSTLYQHQSTLRLMLARLGVTMFPNHAATAPDMSEFFTP* |
| Ga0070735_104674481 | 3300005534 | Surface Soil | STTVYQHQSALRLSLKALGVTDLPGDAATAPDMGEFFQ* |
| Ga0070697_1014627681 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | STTLYQHQSTLRLMLKGLGVTVFPGAAASAPDMSEFFTP* |
| Ga0070733_104473711 | 3300005541 | Surface Soil | TLYQHQSTLRLILAGSGVNTFPGMSAAAPDMSEFFTGN* |
| Ga0066701_100666791 | 3300005552 | Soil | PKSKPGYVSTTLYQHQSTLRLILKGLGVTVFPGAAAMAPEMDEFFTP* |
| Ga0066701_100813394 | 3300005552 | Soil | AVSPKSKPGYQSATLYQHQSSLRLILKGLGVTAFPGAAASVPDMGEFFTP* |
| Ga0066701_102014192 | 3300005552 | Soil | VAVSPKSKPGYQSATLYQHQSSLRLILKGLGVTAFPGAAASAPDMGEFFTP* |
| Ga0066701_104498861 | 3300005552 | Soil | PKSKPGYVSTTLYQHQSTLRLILKGLGVTVFPGAAAMAPGMDEFFTP* |
| Ga0066692_109949611 | 3300005555 | Soil | TLYQHQSTLRLILKGLGVTVFPGAAASAPDMSEFFTP* |
| Ga0066707_103465632 | 3300005556 | Soil | STTLYQHQSTLRLILKGLGVTVFPGAAAMAPEMDEFFTP* |
| Ga0066704_103506272 | 3300005557 | Soil | YQHQSTLRLTLKALGVTAFPNAAASAPDMDEFFMP* |
| Ga0068855_1004821671 | 3300005563 | Corn Rhizosphere | SALYQHQSTLRLVLQGLGIQTYPAAAGTAREMGEFF* |
| Ga0066703_100461034 | 3300005568 | Soil | TTNYQHQSTLRTLMKALGISTFPGSAGSAKDMGEMF* |
| Ga0066694_103052831 | 3300005574 | Soil | TLYQHQSTLRLILKGLGVTAFPAAAASAADMGEFFTP* |
| Ga0066694_105467881 | 3300005574 | Soil | LYQHQSTLRLMLGGLGVTVFPGAASSAPTMGEFFNNFTLP* |
| Ga0066706_105328871 | 3300005598 | Soil | YQHQSSLRLILKGLGVTAFPGAAASAPDMGEFFTP* |
| Ga0068864_1025143292 | 3300005618 | Switchgrass Rhizosphere | KALYQHQSTLRLILQGLGIQTYPAAASTAPDMGEFF* |
| Ga0066903_1000768542 | 3300005764 | Tropical Forest Soil | QHESTLRLALKALGVTTFPNAAATAPDMDEFFMP* |
| Ga0066903_1008710421 | 3300005764 | Tropical Forest Soil | SKSKYQSQTDYQHQSTLRLVLQASGAGAFPGLANTAPDMTEFFTGN* |
| Ga0066903_1068523122 | 3300005764 | Tropical Forest Soil | SQTEYQHQSTLRLVLEASGVSSFPGLAGTAPDMAEFFTGN* |
| Ga0075284_10143401 | 3300005885 | Rice Paddy Soil | YQHQSLLKLILQASGVWSYPGASSSAPEMGEFFY* |
| Ga0075271_100148052 | 3300005899 | Rice Paddy Soil | HESLLRTALKVLGITTYPGAAATAPDMSEFLTTQ* |
| Ga0070766_100326921 | 3300005921 | Soil | QHQSVLRLVLAASGVNSFPGLAGVAPDMTEFFTGH* |
| Ga0066656_100132365 | 3300006034 | Soil | QHQSTLRLTLKALGVTAFPNAAASAPDMDEFFMP* |
| Ga0066656_106708611 | 3300006034 | Soil | SPTKSKRGYVSTTLYQHQSTLRLMLKGLGVTSFPGDAATAPDMSEFFTP* |
| Ga0066656_110877731 | 3300006034 | Soil | YQHESTLRLMCKMLGLTAFPGAAASAPDMGEFFSGN* |
| Ga0075029_1003407593 | 3300006052 | Watersheds | LYGHQSALRLVLAASGVISFPGLAGTAPDMTEFFIGH* |
| Ga0075030_1009078101 | 3300006162 | Watersheds | QGYKSTTFYQHQSLLRLILEGLRVSNLPGASSTAPDMGEFF* |
| Ga0070716_1015844442 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QSTTLYQHQSTLRLILGGLGVTAYPGASAQAPDISEFF* |
| Ga0070712_1011672191 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYQSLAEYQHQSTLRLLLAASGVDKFPGLAGTAPDMTEFFTGQ* |
| Ga0079222_100016821 | 3300006755 | Agricultural Soil | STTTYKHQSTLRLILKGLGINTFPGDAATAPDMSEFFNP* |
| Ga0066653_107803811 | 3300006791 | Soil | TYQHPSTLRLILKGLGVTVFPGASATAPDMSEFFNP* |
| Ga0066658_102466211 | 3300006794 | Soil | TLYQHQSSLRLILKGLGVTAFPGAAASAPDMGEFFTP* |
| Ga0066665_113047192 | 3300006796 | Soil | VTSRKNSDAKKGYQSTSVYQHQSTLRLILKSLGATTLPGAANSAPDMTEF |
| Ga0066659_103187361 | 3300006797 | Soil | SKAGYQSTTLYQHQSTLRLMLGGLGVTVFPGAASSAPTMGEFFNNFTLP* |
| Ga0066659_108180291 | 3300006797 | Soil | QVYWVAVSPTKSKRGYVSTTLYQHQSTLRLMLKGLGVTSFPGDAATAPDMSEFFTP* |
| Ga0066659_109021792 | 3300006797 | Soil | WVAVSPKSKPGYQSTTLYQHQSTLRLILKGLGVNVFPGAAASAPDMSEFFTP* |
| Ga0079220_100907252 | 3300006806 | Agricultural Soil | YQSTTLYQHQSTLRLMLKGLGVNSFPGDAATAPDMSEFFNP* |
| Ga0075425_1012403702 | 3300006854 | Populus Rhizosphere | TTLYQHQSTLRLILEALGVTQYPGAAATAPDMAEFFTP* |
| Ga0068865_1000694922 | 3300006881 | Miscanthus Rhizosphere | ALYQHQSTLRLVLQGLGIQTYPAAAGAAREMGEFF* |
| Ga0075435_1005306702 | 3300007076 | Populus Rhizosphere | LYQHQSTLRLILEALGVTQYPGAAATAPDMAEFFTP* |
| Ga0099791_100609262 | 3300007255 | Vadose Zone Soil | LYQHQSTLRLLLKGLGLNTFPGDAASAPDMSEFFNP* |
| Ga0066710_1009970031 | 3300009012 | Grasslands Soil | YQHPSTLRLILKGLGVNVFPGASATAPDMSEFFNP |
| Ga0066710_1023824221 | 3300009012 | Grasslands Soil | GDNTNGGGKVVWIAIGPKAKLAYKSSTTYLHQATLRLMLKGLGITTYPGAAAIAPDMAEFFNP |
| Ga0066710_1024934541 | 3300009012 | Grasslands Soil | KRGYQSTTVYKHQSTLRLILKGLGVTVFPGDAARAPDMTEFFTP |
| Ga0066710_1030931312 | 3300009012 | Grasslands Soil | YQHQSTLRLILEALGVAQFPGAAATAPAMTEFFTP |
| Ga0066710_1036963701 | 3300009012 | Grasslands Soil | YNSTVLYQHQSTLRLILKGLGVTVFPGAAAMAPEMDEFFTP |
| Ga0099829_114050782 | 3300009038 | Vadose Zone Soil | LYQHQSTLRLLLKGLGFNTFPGDAASAPDMSEFFNP* |
| Ga0099827_113068921 | 3300009090 | Vadose Zone Soil | SPKSKPGYQSTTTYLHQSTLRLILKGLGLNTFPGDAATAPDMSEFFNP* |
| Ga0105247_109084851 | 3300009101 | Switchgrass Rhizosphere | IIISPKAKQGYRSAAMYQHQSTLRLILRGLGIQTYPAAAGSAAEMGEFF* |
| Ga0066709_1006147732 | 3300009137 | Grasslands Soil | WVAVSPKSKPGYQSATLYQHQSSLRLILKGLGVTAFPGAAASAPDMGEFFTP* |
| Ga0066709_1024746532 | 3300009137 | Grasslands Soil | GYVSTTLYQHQSTLRLMLKGLGVTSFPGDAATAPDMSEFFTP* |
| Ga0066709_1025440811 | 3300009137 | Grasslands Soil | TTLYQHQSTLRLMLKGLGVTSFPGDAATAPDMSEFFTP* |
| Ga0105248_104971691 | 3300009177 | Switchgrass Rhizosphere | GHQSKALYQHQSTLRLILQGLGIQTYPAAASTAPDMGEFF* |
| Ga0127456_12408561 | 3300010140 | Grasslands Soil | PKSKLGHQSTTLYQHQSTLRLMLKGLGVTVFPGAAASAPDMDEFFNP* |
| Ga0134082_103361752 | 3300010303 | Grasslands Soil | FYQHQSTLRLTLKALGVTAFPNAAASAPDMDEFFMP* |
| Ga0134084_102421832 | 3300010322 | Grasslands Soil | LYQHGSTLRLSLKQLGVTVFPNAAASAPDMDEFFIP* |
| Ga0134086_101712861 | 3300010323 | Grasslands Soil | TTLYQHQSTLRLILKGLGVTVFPGAAAMAPGMDEFFTP* |
| Ga0134064_101034741 | 3300010325 | Grasslands Soil | TYQHPSTLRLILKGLGVNVFPGASATAPDMSEFFNP* |
| Ga0134065_101936531 | 3300010326 | Grasslands Soil | TLYQHQSTLRLILKGLGVTVLPGAAASAPDMSEFFTP* |
| Ga0134080_104373682 | 3300010333 | Grasslands Soil | STTLYQHQSTLRLTLEALGITLFPEAARAAPGMREFFAP* |
| Ga0134063_103853861 | 3300010335 | Grasslands Soil | RGYQSTRLYQHGSTLRLSLKQLGVTVFPNAAASAPDMDEFFIP* |
| Ga0134062_100356111 | 3300010337 | Grasslands Soil | GYQSTTLYQHQSTLRLILKGLGVNVFPGAAASAPDMSEFFTP* |
| Ga0126376_111151962 | 3300010359 | Tropical Forest Soil | QSTTLYQHQSTLRLSLKALGVTVFPGAANSAPDMGEFFNP* |
| Ga0126376_122788071 | 3300010359 | Tropical Forest Soil | SQALYQHQSTLRMTLEALGVNTFPGMSASAPDMTEFFTGH* |
| Ga0134125_121767781 | 3300010371 | Terrestrial Soil | SSALYQHQSTLRLVLQGLGIQTYPAAAGTAREMGEFF* |
| Ga0126381_1003749611 | 3300010376 | Tropical Forest Soil | NYQSQTFYQHESVLRLILASSGITVFPGMSASAPDMTEFFATQ* |
| Ga0134126_108196891 | 3300010396 | Terrestrial Soil | FYQHESTLRLVLSTLGIKSFPGAAASAPDMGEFFK* |
| Ga0134123_124878081 | 3300010403 | Terrestrial Soil | STTTYQHQSTLRLILKGLGITTFPGDAATAPDMSEFFNP* |
| Ga0126344_11693091 | 3300010866 | Boreal Forest Soil | HYQHDSTLRLMLVGLGVTDLPGGAAAAPDMTEFFK* |
| Ga0150983_159615632 | 3300011120 | Forest Soil | GYQSATLYQHQSVLRLSLKALGVTDLPGDAATAPDMGEFFQ* |
| Ga0137392_106195642 | 3300011269 | Vadose Zone Soil | LYQHQSTLRLLFNGLGFNTFPGDAASAPDMSEFFNP* |
| Ga0137391_103107091 | 3300011270 | Vadose Zone Soil | STTLYQHQSTLRLLLKGLGFNTFPGDAASAPDMSEFFNP* |
| Ga0137391_111778021 | 3300011270 | Vadose Zone Soil | QHQSTLRLMLKGLGVTPFPSDAATAPDMSEFFTP* |
| Ga0137393_112854852 | 3300011271 | Vadose Zone Soil | STTLYQHQSTLRLILQGLGISTYPGEASTAPEMGEFF* |
| Ga0137388_110896421 | 3300012189 | Vadose Zone Soil | TTLYQHQSTLRLTLEALGIPPFSGAAATAPAMSEFFAP* |
| Ga0137364_101849342 | 3300012198 | Vadose Zone Soil | RIAWVAVSGKGKRAYQSTTVYQHQSTLRLSLNALGVKVFPNRAATAPDMDEFFTP* |
| Ga0137364_109876622 | 3300012198 | Vadose Zone Soil | YQHQSTLRVILETLGVTQLPAAAATAPAMAEFFTP* |
| Ga0137364_112574422 | 3300012198 | Vadose Zone Soil | STLRLMLGGLGVTVFPGAASSAPTMGEFFNNVTLP* |
| Ga0137383_111750781 | 3300012199 | Vadose Zone Soil | KRGYQSTTLYQHQSTLRLILKGLGVNVFPGAAASAPDMSEFFTP* |
| Ga0137382_103162971 | 3300012200 | Vadose Zone Soil | STTLYQHEATLRLILKSLGVTNYPSTAATAPDMDEFFVP* |
| Ga0137365_105195042 | 3300012201 | Vadose Zone Soil | YQHQSTLRLTLETLGMQNLPGLAAIAPEMGEFFK* |
| Ga0137365_111377761 | 3300012201 | Vadose Zone Soil | KAKRSYESTRTYEHQSTLRLSLQALGVTGFPNAAASAPDLGEFFTP* |
| Ga0137376_104122902 | 3300012208 | Vadose Zone Soil | VWVAVSPKSKPGYQSTTLYQHQSTLRLILKGLGVNVFPGAAASAPDMSEFFTP* |
| Ga0137376_113016111 | 3300012208 | Vadose Zone Soil | GYQSTTLYQHQSTLRLILEGLGVTELPGAAASAPNMDEFFTRMP* |
| Ga0137377_101076052 | 3300012211 | Vadose Zone Soil | GYQSTTTYLHQSTLRLMLKGLGVTVFPGAASSAPDMTEFFTP* |
| Ga0137377_114492912 | 3300012211 | Vadose Zone Soil | TTFFQHQSTLRLVMSTLGVTAFPGLAAAAPDMGEFFK* |
| Ga0137377_117983103 | 3300012211 | Vadose Zone Soil | QSATLYQHQSSLRLILKGLGVTAFPGAAASAADMGEFFTP* |
| Ga0137387_102434143 | 3300012349 | Vadose Zone Soil | YQHQSTLRLTLEALGISLFPGAAATAPAMSEFFTP* |
| Ga0137387_103673341 | 3300012349 | Vadose Zone Soil | TLYQHQSTLRLILKGLGLTAFPGAAASAPDMSEFFTP* |
| Ga0137386_102366511 | 3300012351 | Vadose Zone Soil | HQSTLRLMAEALGVTKVPGAAATAPNMTEFFTLRSRP* |
| Ga0137371_100584454 | 3300012356 | Vadose Zone Soil | VRATEKRGYQSSTTYKHQSTLRLMLTALGVTVYPGAASSAPAMTEFFTA* |
| Ga0137385_104284231 | 3300012359 | Vadose Zone Soil | STTLYQHQSTLRLTLEALGIARFPGAGVTAPAMSEFFAP* |
| Ga0137385_107411472 | 3300012359 | Vadose Zone Soil | YQHQSTLRLILKGLGINTFPGAAATAPDMSEFFNP* |
| Ga0137375_113781092 | 3300012360 | Vadose Zone Soil | LYQHQSTLRLTLDALGITSFPGAGATAPAMGEFFTP* |
| Ga0137360_113725861 | 3300012361 | Vadose Zone Soil | TLYQHQSTLRLILEGLGVRKFPGAANAAPEMGEFF* |
| Ga0137360_117062411 | 3300012361 | Vadose Zone Soil | TTYQHQSTLRLILKGLGVTVFPGGAATAPDMSEFFTP* |
| Ga0134023_12129641 | 3300012385 | Grasslands Soil | QHASTLRLSLKALGVTAFPNGAATAPDMDEFFNP* |
| Ga0134031_11099762 | 3300012388 | Grasslands Soil | YQHPSTLRLILKGLGVTVYPGAAASAPDMSEFFTP* |
| Ga0134055_11918921 | 3300012401 | Grasslands Soil | SPKSKLGYQSTTLYQHQSTLRLMLKGLGVTAFPGAAASAPDMDEFFNP* |
| Ga0134059_12242861 | 3300012402 | Grasslands Soil | QHPSTLRLMLKVLGVTPYPGAAATAPDMDEFFNP* |
| Ga0134045_11750342 | 3300012409 | Grasslands Soil | STRLYQHASTLRLSLKALGVTALPNGAATAPDMDEFFNP* |
| Ga0150984_1044470072 | 3300012469 | Avena Fatua Rhizosphere | SNYKSETEYQHQSTLRLVLAASGVDSFPGLAAAAPDMTEFFNGQ* |
| Ga0137373_108303472 | 3300012532 | Vadose Zone Soil | STTFYQHQSTLRLMLEGLGITSFPGASSSAPQMGEFFVP* |
| Ga0137397_100587114 | 3300012685 | Vadose Zone Soil | YQHQSTLRLTLEALGITQFPGTARAAPAMSEFFAP* |
| Ga0157303_100701731 | 3300012896 | Soil | ALYQHQSTLRLILQGLGIQTYPAAASTAPDMGEFF* |
| Ga0137395_100492931 | 3300012917 | Vadose Zone Soil | RVYWAAISPKSKPGYQSTTTYLHQSTLRLILKGLGINTFPGDAATAPDMSEFFNP* |
| Ga0126369_108535812 | 3300012971 | Tropical Forest Soil | GGRVVCVVASPRSKPGYRSATLLQHQSTLRLALKALGVTTFPNGAATAPDMDEFFMP* |
| Ga0134077_101308131 | 3300012972 | Grasslands Soil | KPGYNSTVLYQHQSTLRLILKGLGVTVFPGAAAMAPEMDEFFTP* |
| Ga0134110_100530282 | 3300012975 | Grasslands Soil | STTLYQHQSTLRLMLKGLGVTSFPGDAATAPDMSEFFTP* |
| Ga0134110_103963671 | 3300012975 | Grasslands Soil | KAGYQSTTLYQHQSTLRLMLGGLGVTVFPGAASSAPTMGEFFNNFTLP* |
| Ga0134076_102491771 | 3300012976 | Grasslands Soil | KHQSTLRLILKGLGVTVFPGDAARAPDMTEFFTP* |
| Ga0134076_104165931 | 3300012976 | Grasslands Soil | TYQHPSTLRLILKGLGVNTFPGAAATAPDMSEFFNP* |
| Ga0134075_104891532 | 3300014154 | Grasslands Soil | VSAKSKSGYQSTTLYQHASTMRLSLTALGVTTLPNGAATAPDMNEFFAP* |
| Ga0134079_102445221 | 3300014166 | Grasslands Soil | TTLYQHQSTLRLILKGLGATVFPGASASAPDMSEFFTP* |
| Ga0182024_100032664 | 3300014501 | Permafrost | VTLYQHQSTLRLILAGSGVSTFPGQAATAPDMTEFFTGH* |
| Ga0157376_103907421 | 3300014969 | Miscanthus Rhizosphere | SPKAKQGYRSAAMYQHQSTLRLILHGLGIQTYPAAAGSAAEMGEFF* |
| Ga0137403_112228452 | 3300015264 | Vadose Zone Soil | KQGYQSTTLYQHQSTLRLILQGLGVSTYPGEASTAPEMGEFF* |
| Ga0134073_100603361 | 3300015356 | Grasslands Soil | QSSITYQHPSTLRLILKGLGVTVYPGAAASAPDMDEFFTP* |
| Ga0134073_100798492 | 3300015356 | Grasslands Soil | QSSITYQHPSTLRLILKGLGVTVYPGAAASAPDMSEFFTP* |
| Ga0134073_103747272 | 3300015356 | Grasslands Soil | SITYQHPSTLRLILKGLGVTVYPGAAASAPDMSEFFTP* |
| Ga0134072_100052622 | 3300015357 | Grasslands Soil | WVAVSPTKSKRGYVSTTLYQHQSTLRLMLKGLGVTSFPGDAATAPDMSEFFTP* |
| Ga0134072_101428832 | 3300015357 | Grasslands Soil | PKSKPGYQSTTLYQHQSTLRLILKGLGVNVFPGAAASAPDMSEFFTP* |
| Ga0134085_103334483 | 3300015359 | Grasslands Soil | TLYQHQSTLRLILKGLGVTAFPGAAASAPDMGEFFTP* |
| Ga0182034_107062122 | 3300016371 | Soil | TLFQHQSTLRLLLAASGVSVFPGAAAMAPDMNEFFQ |
| Ga0134069_10148461 | 3300017654 | Grasslands Soil | RVYQSTTLYQHQSTLRLILKGLGVSVFPGAAASAPDMSEFFTP |
| Ga0134074_12109161 | 3300017657 | Grasslands Soil | QSTRLYQHGSTLRLSLKQLGVTVFPNAAASAPDMDEFFIP |
| Ga0066667_109745362 | 3300018433 | Grasslands Soil | GYVSTTLYQHQSTLRLMLKGLGVTSFPGDAATAPDMSEFFTP |
| Ga0066667_109764751 | 3300018433 | Grasslands Soil | TYQHPSTLRLILKGLGVNVFPGASATAPDMSEFFNP |
| Ga0066662_108073672 | 3300018468 | Grasslands Soil | STTLYQHQSTLRLILKGLGVTVFPGAAAMAPEMDEFFTP |
| Ga0066662_129359501 | 3300018468 | Grasslands Soil | SEQAKKNFVSQTLYQHESTLRLTLSASGVTSVPAAAASAPDMSEFITGQ |
| Ga0066669_100051446 | 3300018482 | Grasslands Soil | ISPFSKAGYQSTTLYQHQSTLRLMLGGLGVTVFPGAASSAPTMGEFFNNFTLP |
| Ga0181502_14392991 | 3300019242 | Peatland | QSTALYQHQSSLRLSLSASGVNTFPGMAASAPDMTEFFTGH |
| Ga0210403_111423711 | 3300020580 | Soil | TTFYQHQSTLRLILEGLGISHLPGGASTAPDMGEFF |
| Ga0210399_106201432 | 3300020581 | Soil | SKAVYQHQSVLRLVLAASGVNSFPGLAGVAPDMTEFFTGH |
| Ga0179596_100782511 | 3300021086 | Vadose Zone Soil | LYQHQSTLRLLLKGLGFNTFPGDAASAPDMSEFFNP |
| Ga0210404_102542033 | 3300021088 | Soil | FKSTTLYQHQSTLRLILHGLQVPAYPAAASTAPEMGEFF |
| Ga0210404_107849242 | 3300021088 | Soil | NTCQHQSTLRLILAGSGVNGFPGLPAVAPDMTEFFTGP |
| Ga0210405_102864081 | 3300021171 | Soil | HVADLIISPKAKQGYQSTNLYQHQSTLRLILQGLGGSSYPAATNTAPEMGEFF |
| Ga0210405_106967811 | 3300021171 | Soil | TTVYQHQSTMRLSLKALGVTDLPGDAATAPDMGEFFQ |
| Ga0210405_112329182 | 3300021171 | Soil | SNPYQHQSTLRLILAGSGVNGFPGLSAGAPDMTEFFTGP |
| Ga0210408_111012481 | 3300021178 | Soil | FQSSNPYQHQSTLRLILAGSGVNGFPGLSAGAPDMTEFFTGP |
| Ga0210393_113448601 | 3300021401 | Soil | YQSTTVYQHQSTLRLSLKGLGVTDLPGDAATAPDMGEFFQ |
| Ga0210386_111156532 | 3300021406 | Soil | VPAIIVSSKSKVGYQSTTVYQHQSTLCLSLKALGVTDLPGDAATAPDMGEFFQ |
| Ga0210394_104202293 | 3300021420 | Soil | QGYQSTNLYQHQSTLRLILQGLGGSSYPAATNTAPEMGEFF |
| Ga0210410_115647381 | 3300021479 | Soil | TVYQHQSTLRLSLKGLGVTDLPGDAATAPDMGEFFQ |
| Ga0210409_117082252 | 3300021559 | Soil | IVWVAVSPKSKPAYQSATLYLHQSTLRLMLSGLGVTVFPGAAASAPDMSEFFTP |
| Ga0222623_100647061 | 3300022694 | Groundwater Sediment | TLYQHQSTLRLILEALGVTQYPGAAATAPAMAEFFTP |
| Ga0242665_100826651 | 3300022724 | Soil | YQSTSLYLHQSTLRLMLSGLGVTVFPGAAASAPDMSEFFTP |
| Ga0233357_10241251 | 3300023056 | Soil | QSTTLYQHQSALRLSLKVLGVTDLMGDAATAPDMAEFFR |
| Ga0207680_103986701 | 3300025903 | Switchgrass Rhizosphere | IVSLKAKQGHQSKALYQHQSTLRLILQGLGIQTYPAAASTAPDMGEFF |
| Ga0207671_110283261 | 3300025914 | Corn Rhizosphere | STTTYQHQSTLRLILEGLEIQNLPAAAGTAPEMSEFF |
| Ga0207693_101409502 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KYQSLAEYQHQSTLRLLLAASGVDKFPGLAGTAPDMTEFFTGQ |
| Ga0207660_106373593 | 3300025917 | Corn Rhizosphere | SKALYQHQSTLRLILQGLGIQTYPAAASTAPDMGEFF |
| Ga0207652_113887202 | 3300025921 | Corn Rhizosphere | YQHQSTLRLVLEALGVNKFPGEAATSPAMAEFFNGH |
| Ga0207646_100137541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TTLYQHASTLRLTGKVLGLTSFPNQAATAPGMDEFFTP |
| Ga0207646_105595391 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PKAKAGYQSTTLYQHQSTLRLILKGLGVSTFPGDAGSAPDMSEFFTP |
| Ga0208651_10016923 | 3300025998 | Rice Paddy Soil | KKSTKFYQHQSLLKLILQASGVWSYPGASSSAPEMGEFFY |
| Ga0207676_100636582 | 3300026095 | Switchgrass Rhizosphere | YRSSALYQHQSTLRLVLQGLGIQTYPAAAGTAREMGEFF |
| Ga0207698_113380151 | 3300026142 | Corn Rhizosphere | KQGHQSKALYQHQSTLRLILQGLGIQTYPAAASTAPDMGEFF |
| Ga0209234_10248455 | 3300026295 | Grasslands Soil | TTRYHHESTLRLSLSAIGVKTFPNKAAGAPDMSEFFAP |
| Ga0209235_10481121 | 3300026296 | Grasslands Soil | VSTTLYQHQSTLRLILKGLGVTVFPGAAAMAPGMDEFFTP |
| Ga0209237_10539222 | 3300026297 | Grasslands Soil | YQHQSTLRLILKGLGVTVFPGAAAMAPGMDEFFTP |
| Ga0209236_100161410 | 3300026298 | Grasslands Soil | VVSPKSKPGYVSTTLYQHQSTLRLILKGLGVTVFPGAAAMAPEMDEFFTP |
| Ga0209236_10556941 | 3300026298 | Grasslands Soil | VVSPKSKPGYVSTTLYQHQSTLRLILKGLGVTVFPGAAAMAPGMDEFFTP |
| Ga0209239_11943561 | 3300026310 | Grasslands Soil | TLYQHQSTLRLMLKGLGVTSFPSDAATAPDMSEFFTP |
| Ga0209266_11288642 | 3300026327 | Soil | TTYQHPSTLRLILKGLGVNVFPGASATAPDMSEFFNP |
| Ga0209158_12678212 | 3300026333 | Soil | ISAASKAGYQSTTLYQHQSTLRLMLGGLGVTVFPGAASSAPTMGEFFNNVTLP |
| Ga0209377_11082941 | 3300026334 | Soil | KSKPGYQSTTLYQHQSTLRLILKGLGATVFPGASASAPDMSEFFTP |
| Ga0209804_10366851 | 3300026335 | Soil | TTFYQHQSTLRLTLKALGVTAFPNAAASAPDMDEFFMP |
| Ga0257163_10471971 | 3300026359 | Soil | GHQSSTLYQHQSTLRLILEGLGVKKFPGAASVAPEMGEFF |
| Ga0257158_10923071 | 3300026515 | Soil | GYKSTTHYQHDSTLRLMMEGLGVTDLPGGAATAPDMTEFFK |
| Ga0209808_11584502 | 3300026523 | Soil | SSITYQHPSTLRLILKGLGVTVYPGAAASAPDMSEFFTP |
| Ga0209690_10709631 | 3300026524 | Soil | LYQHQSTLRLILKGLGVTVFPGAAAMAPEMDEFFTP |
| Ga0209690_11309221 | 3300026524 | Soil | VAVSPKSKPGYQSATLYQHQSSLRLILKGLGVTAFPGAAASAPDMGEFFTP |
| Ga0209378_10476222 | 3300026528 | Soil | TYLHQSTLRLILKGLGINTFPGDAATAPDMSEFFNP |
| Ga0209160_11345241 | 3300026532 | Soil | PGYQSATLDQHQSSLRLILKGLGVTAFPGAAASAPDMGEFFTP |
| Ga0209160_11852221 | 3300026532 | Soil | AKRGYQSTTVYKHQSTLRLILKGLGVGAFPGAASSAPDMTEFFTP |
| Ga0209157_13221982 | 3300026537 | Soil | TLYQHQSTLRLMLEALGITSFPGASSSAKEMAEFFNP |
| Ga0209157_13284271 | 3300026537 | Soil | YQSSTLYQHQSTLRLTLEALGITQFPGAATAPAMGEFFAP |
| Ga0209376_10817053 | 3300026540 | Soil | QSTTLYQHQSTLRLTLEALGIARFPGAGVAAPAMSEFFAP |
| Ga0209161_100305101 | 3300026548 | Soil | YQSATLYQHQSSLRLILKGLGVTAFPGAAASAPDMGEFFTP |
| Ga0209474_102487752 | 3300026550 | Soil | TTVYKHQSTLRLILKGLGVTVFPGDAARAPDMTEFFTP |
| Ga0209577_105845901 | 3300026552 | Soil | ATLYQHQSTLRLILKGLGVTAFPAAAASAADMGEFFTP |
| Ga0209529_10742862 | 3300027334 | Forest Soil | LYQHQSTLRLVLAASGVTSFPGLAGTAPDMTEFFTGH |
| Ga0209418_10893841 | 3300027371 | Forest Soil | STMLYQHQSTLRLILQGLGVSNLPGASSSAPQMGEFF |
| Ga0209588_10993982 | 3300027671 | Vadose Zone Soil | LYQHQSTLRLLLKGLGLNTFPGDAASAPDMSEFFNP |
| Ga0209689_11396971 | 3300027748 | Soil | PAYQSTTLYQHQSTLRLMLSGLGVTVFPGGAATAPDMSEFFTP |
| Ga0209580_106918832 | 3300027842 | Surface Soil | AKPGFQSTTLYQHQSTLRLILQGLGISSYPGAAAQAPNMAEFF |
| Ga0137415_106694972 | 3300028536 | Vadose Zone Soil | SQTFYQHQSLLRLTLAASGVDTFPGAAAIAPDMTEFFQ |
| Ga0302294_100959282 | 3300028740 | Fen | IVSPRAKNNYQSTKVYQHEATLRLLLEGLGITTLPGSAATAPDMIEFF |
| Ga0307278_101995932 | 3300028878 | Soil | TLYQHQGTLRLTLEALGITQFPGAAAAAPAMAEFFTP |
| Ga0307277_105206862 | 3300028881 | Soil | SPKSKLGYQATTLYQHHSTLRLMLKGLGVTVFPGAASGAPDMNEFFTP |
| Ga0307308_100211091 | 3300028884 | Soil | ASKAGYQSTTLYQHQSTLRLMLGGLGVTVFPGAASSAPTMGEFFNNVTLP |
| Ga0311331_107131772 | 3300029954 | Bog | FSKGGHQSTTLYQHESTLRLMLEGLGITTTLPGAAATAPTMWEFFSFAPP |
| Ga0265331_102484332 | 3300031250 | Rhizosphere | SQTLYQHQSVLRLILAGSGVNSFPGLAAAAPDMTEFFTGH |
| Ga0302140_111370162 | 3300031261 | Bog | TTLYQHESTLRLMMEGLGVGDMPGGAAGAPDMSEFFQ |
| Ga0170820_159624221 | 3300031446 | Forest Soil | VNKGLQSTTLYQHQCTLRLILAGSGVNNFPGMAATAPDMAEFFSGH |
| Ga0307474_101167833 | 3300031718 | Hardwood Forest Soil | TMYQHQSTLRLMLEALGISTLPGSASTAPDMGEFF |
| Ga0307469_121696741 | 3300031720 | Hardwood Forest Soil | STTLYQHQSALRLILQGLGVPTYPAAASTAPEMGEFF |
| Ga0302321_1014838831 | 3300031726 | Fen | AKNNYQSTKVYQHEATLRLLLEGLGITTLPGSAATAPDMIEFF |
| Ga0307475_106483402 | 3300031754 | Hardwood Forest Soil | TTLYQHQSALRLSLELLNISQLPGMAAKAPAMSEFF |
| Ga0307473_101268962 | 3300031820 | Hardwood Forest Soil | GGKVYWAAISPKSKRGYVSTTTYLHQSTLRLILKGLGITTFPGDAATAPDMSEFFNP |
| Ga0318536_102898101 | 3300031893 | Soil | TTLYQHESTLRLSLKALGVNVFPGAANAAPDMGEFFNP |
| Ga0307479_112241661 | 3300031962 | Hardwood Forest Soil | KTLYQHDSTLRLMLRGLGVSDLPGGAATATDMGEFFK |
| Ga0307479_120457861 | 3300031962 | Hardwood Forest Soil | STTTYQHPSTLRLILKGLGVTVFPGAAASAPDMSEFFTP |
| Ga0307471_1029162511 | 3300032180 | Hardwood Forest Soil | QHQSTLRLALASLKVDHFPAEAATAPDMTEFFTGP |
| Ga0307472_1004244693 | 3300032205 | Hardwood Forest Soil | TLYQHQNTLRLILQGLGISSYPGAAAQAPNMAEFF |
| Ga0307472_1011788752 | 3300032205 | Hardwood Forest Soil | STTLYQHEATLRLILKSLGISSYPGAATTAPDMDEFFNP |
| Ga0335079_108967972 | 3300032783 | Soil | TLYQHQSTLRLILMSSGVTTLPGLAASAPDMTEFFNGH |
| Ga0335070_108776641 | 3300032829 | Soil | ANFQSQTEYQHQSTLRLVLAASGVNSYPGMAAAAPDMTEFFNGN |
| Ga0335077_107954831 | 3300033158 | Soil | VYVYQHQSTLRLMLQLLGVNVFPGASQTARNMTEFVTAQ |
| Ga0335077_109094162 | 3300033158 | Soil | QSQALYQHESTLRLILAGSGIETFPGLAASAPNMTELFIGQ |
| Ga0310810_110044591 | 3300033412 | Soil | AALIISPKAKQGHQSKALYQHQSTLRLILQGLGIQTYPAAASTAPDMGEFF |
| Ga0310811_104208813 | 3300033475 | Soil | KALYQHQSTLRLILQGLGIQTYPAAASTAPDMGEFF |
| ⦗Top⦘ |