


| Basic Information | |
|---|---|
| Family ID | F019110 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 231 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAA |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 231 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.27 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.15 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.177 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (57.576 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (83.117 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 231 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 3.03 |
| PF03841 | SelA | 2.60 |
| PF02391 | MoaE | 2.16 |
| PF01663 | Phosphodiest | 2.16 |
| PF01182 | Glucosamine_iso | 2.16 |
| PF02775 | TPP_enzyme_C | 1.73 |
| PF00406 | ADK | 1.73 |
| PF05088 | Bac_GDH | 1.73 |
| PF00005 | ABC_tran | 1.30 |
| PF01653 | DNA_ligase_aden | 1.30 |
| PF02515 | CoA_transf_3 | 1.30 |
| PF07992 | Pyr_redox_2 | 1.30 |
| PF01676 | Metalloenzyme | 1.30 |
| PF00361 | Proton_antipo_M | 1.30 |
| PF00575 | S1 | 1.30 |
| PF03308 | MeaB | 0.87 |
| PF01636 | APH | 0.87 |
| PF02771 | Acyl-CoA_dh_N | 0.87 |
| PF02130 | YbeY | 0.87 |
| PF08245 | Mur_ligase_M | 0.87 |
| PF00989 | PAS | 0.87 |
| PF03703 | bPH_2 | 0.87 |
| PF01713 | Smr | 0.87 |
| PF01451 | LMWPc | 0.87 |
| PF07722 | Peptidase_C26 | 0.87 |
| PF00378 | ECH_1 | 0.87 |
| PF04339 | FemAB_like | 0.87 |
| PF12704 | MacB_PCD | 0.87 |
| PF12697 | Abhydrolase_6 | 0.87 |
| PF00814 | TsaD | 0.87 |
| PF00072 | Response_reg | 0.87 |
| PF13432 | TPR_16 | 0.87 |
| PF02954 | HTH_8 | 0.87 |
| PF00528 | BPD_transp_1 | 0.87 |
| PF13187 | Fer4_9 | 0.87 |
| PF01923 | Cob_adeno_trans | 0.87 |
| PF13720 | Acetyltransf_11 | 0.87 |
| PF07811 | TadE | 0.87 |
| PF04226 | Transgly_assoc | 0.87 |
| PF00296 | Bac_luciferase | 0.87 |
| PF03379 | CcmB | 0.87 |
| PF13419 | HAD_2 | 0.87 |
| PF13692 | Glyco_trans_1_4 | 0.43 |
| PF13304 | AAA_21 | 0.43 |
| PF04079 | SMC_ScpB | 0.43 |
| PF04127 | DFP | 0.43 |
| PF00753 | Lactamase_B | 0.43 |
| PF01878 | EVE | 0.43 |
| PF10397 | ADSL_C | 0.43 |
| PF00884 | Sulfatase | 0.43 |
| PF00977 | His_biosynth | 0.43 |
| PF13537 | GATase_7 | 0.43 |
| PF03641 | Lysine_decarbox | 0.43 |
| PF00817 | IMS | 0.43 |
| PF01597 | GCV_H | 0.43 |
| PF00795 | CN_hydrolase | 0.43 |
| PF14572 | Pribosyl_synth | 0.43 |
| PF01734 | Patatin | 0.43 |
| PF04413 | Glycos_transf_N | 0.43 |
| PF13483 | Lactamase_B_3 | 0.43 |
| PF07650 | KH_2 | 0.43 |
| PF08448 | PAS_4 | 0.43 |
| PF06293 | Kdo | 0.43 |
| PF01261 | AP_endonuc_2 | 0.43 |
| PF00512 | HisKA | 0.43 |
| PF00069 | Pkinase | 0.43 |
| PF02790 | COX2_TM | 0.43 |
| PF00132 | Hexapep | 0.43 |
| PF13710 | ACT_5 | 0.43 |
| PF01230 | HIT | 0.43 |
| PF01925 | TauE | 0.43 |
| PF00501 | AMP-binding | 0.43 |
| PF00579 | tRNA-synt_1b | 0.43 |
| PF00873 | ACR_tran | 0.43 |
| PF00196 | GerE | 0.43 |
| PF00850 | Hist_deacetyl | 0.43 |
| PF12680 | SnoaL_2 | 0.43 |
| PF01951 | Archease | 0.43 |
| PF00155 | Aminotran_1_2 | 0.43 |
| PF00578 | AhpC-TSA | 0.43 |
| PF01026 | TatD_DNase | 0.43 |
| PF03471 | CorC_HlyC | 0.43 |
| PF01571 | GCV_T | 0.43 |
| PF00067 | p450 | 0.43 |
| PF01594 | AI-2E_transport | 0.43 |
| PF10555 | MraY_sig1 | 0.43 |
| PF02310 | B12-binding | 0.43 |
| PF00348 | polyprenyl_synt | 0.43 |
| PF07719 | TPR_2 | 0.43 |
| PF00291 | PALP | 0.43 |
| PF11583 | AurF | 0.43 |
| PF13231 | PMT_2 | 0.43 |
| PF10502 | Peptidase_S26 | 0.43 |
| PF03755 | YicC_N | 0.43 |
| PF00216 | Bac_DNA_binding | 0.43 |
| PF13411 | MerR_1 | 0.43 |
| PF13847 | Methyltransf_31 | 0.43 |
| PF03062 | MBOAT | 0.43 |
| PF01326 | PPDK_N | 0.43 |
| PF00535 | Glycos_transf_2 | 0.43 |
| PF13305 | TetR_C_33 | 0.43 |
| PF00011 | HSP20 | 0.43 |
| PF02547 | Queuosine_synth | 0.43 |
| PF13975 | gag-asp_proteas | 0.43 |
| PF00890 | FAD_binding_2 | 0.43 |
| PF01084 | Ribosomal_S18 | 0.43 |
| PF13420 | Acetyltransf_4 | 0.43 |
| PF01061 | ABC2_membrane | 0.43 |
| PF02190 | LON_substr_bdg | 0.43 |
| PF00285 | Citrate_synt | 0.43 |
| PF13632 | Glyco_trans_2_3 | 0.43 |
| PF01252 | Peptidase_A8 | 0.43 |
| PF00834 | Ribul_P_3_epim | 0.43 |
| PF01507 | PAPS_reduct | 0.43 |
| PF13237 | Fer4_10 | 0.43 |
| PF04892 | VanZ | 0.43 |
| PF05201 | GlutR_N | 0.43 |
| PF03167 | UDG | 0.43 |
| PF05721 | PhyH | 0.43 |
| PF13400 | Tad | 0.43 |
| PF13614 | AAA_31 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 231 Family Scaffolds |
|---|---|---|---|
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 2.60 |
| COG0314 | Molybdopterin synthase catalytic subunit MoaE | Coenzyme transport and metabolism [H] | 2.16 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 2.16 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.73 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 1.73 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 1.73 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 1.30 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.30 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
| COG0319 | ssRNA-specific RNase YbeY, 16S rRNA maturation enzyme | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.87 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.87 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.87 |
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG3146 | Predicted N-acyltransferase | General function prediction only [R] | 0.87 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.87 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.87 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 0.43 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.43 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG0238 | Ribosomal protein S18 | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.43 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.43 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.43 |
| COG0452 | Phosphopantothenoylcysteine synthetase/decarboxylase CoaBC | Coenzyme transport and metabolism [H] | 0.43 |
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 0.43 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.43 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.43 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.43 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.43 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.43 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG1371 | Archease, activates RNA ligation by RtcB (tRNA splicing) | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG1386 | Chromosome segregation and condensation protein ScpB | Transcription [K] | 0.43 |
| COG1519 | 3-deoxy-D-manno-octulosonic-acid transferase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.43 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.43 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.43 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.43 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.43 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.43 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.43 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.43 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.43 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.43 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.61 % |
| Unclassified | root | N/A | 10.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005166|Ga0066674_10044200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1997 | Open in IMG/M |
| 3300005171|Ga0066677_10228124 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300005172|Ga0066683_10049404 | All Organisms → cellular organisms → Bacteria | 2477 | Open in IMG/M |
| 3300005172|Ga0066683_10103980 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300005172|Ga0066683_10461845 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300005174|Ga0066680_10064239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2185 | Open in IMG/M |
| 3300005175|Ga0066673_10680714 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005176|Ga0066679_10509522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300005177|Ga0066690_10703054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300005178|Ga0066688_10763039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300005179|Ga0066684_10843511 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005180|Ga0066685_10045619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2796 | Open in IMG/M |
| 3300005180|Ga0066685_10537832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300005180|Ga0066685_10679220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300005186|Ga0066676_10135809 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300005186|Ga0066676_10526092 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005186|Ga0066676_10973680 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005187|Ga0066675_10194997 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300005187|Ga0066675_11124709 | Not Available | 585 | Open in IMG/M |
| 3300005187|Ga0066675_11361152 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005445|Ga0070708_101129834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300005446|Ga0066686_10336231 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300005446|Ga0066686_11058966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 523 | Open in IMG/M |
| 3300005447|Ga0066689_10564117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300005447|Ga0066689_11025300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300005450|Ga0066682_10208139 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300005450|Ga0066682_10313319 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300005451|Ga0066681_10106225 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300005451|Ga0066681_10647260 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005540|Ga0066697_10266304 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300005540|Ga0066697_10644860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300005540|Ga0066697_10775642 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005540|Ga0066697_10830203 | Not Available | 501 | Open in IMG/M |
| 3300005552|Ga0066701_10345873 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300005552|Ga0066701_10351932 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005553|Ga0066695_10383331 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005554|Ga0066661_10149242 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300005554|Ga0066661_10295551 | Not Available | 998 | Open in IMG/M |
| 3300005555|Ga0066692_10263236 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300005555|Ga0066692_10276832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1062 | Open in IMG/M |
| 3300005555|Ga0066692_10659964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300005556|Ga0066707_10294977 | Not Available | 1061 | Open in IMG/M |
| 3300005556|Ga0066707_10498158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300005556|Ga0066707_10516249 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005556|Ga0066707_10807811 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005556|Ga0066707_10938064 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005557|Ga0066704_10968290 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005559|Ga0066700_10048848 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300005559|Ga0066700_10158366 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300005559|Ga0066700_10376228 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300005559|Ga0066700_10596136 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005559|Ga0066700_10845763 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005559|Ga0066700_11153850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300005569|Ga0066705_10804259 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005574|Ga0066694_10333434 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodothermus | 720 | Open in IMG/M |
| 3300005574|Ga0066694_10508784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300005576|Ga0066708_10042143 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
| 3300005586|Ga0066691_10922605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300005587|Ga0066654_10918367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300005598|Ga0066706_10357561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1158 | Open in IMG/M |
| 3300005598|Ga0066706_11499912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300006031|Ga0066651_10088477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1537 | Open in IMG/M |
| 3300006031|Ga0066651_10224273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 997 | Open in IMG/M |
| 3300006031|Ga0066651_10462950 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300006034|Ga0066656_10212238 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300006034|Ga0066656_10327634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 989 | Open in IMG/M |
| 3300006046|Ga0066652_100990227 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300006791|Ga0066653_10131172 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300006791|Ga0066653_10283473 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300006791|Ga0066653_10363145 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006794|Ga0066658_10465759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300006796|Ga0066665_10085473 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
| 3300006796|Ga0066665_10198083 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300006796|Ga0066665_10524420 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300006796|Ga0066665_10854018 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300006796|Ga0066665_10922035 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300006796|Ga0066665_11358417 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006797|Ga0066659_11630228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 542 | Open in IMG/M |
| 3300006797|Ga0066659_11779258 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300007265|Ga0099794_10270738 | Not Available | 877 | Open in IMG/M |
| 3300009012|Ga0066710_103663530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300009012|Ga0066710_104018441 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009012|Ga0066710_104425728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300009038|Ga0099829_10159161 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300009088|Ga0099830_10291515 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300009137|Ga0066709_103547701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300010128|Ga0127486_1084072 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300010301|Ga0134070_10133719 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300010304|Ga0134088_10085823 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300010304|Ga0134088_10367027 | Not Available | 700 | Open in IMG/M |
| 3300010304|Ga0134088_10526108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300010320|Ga0134109_10119405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 930 | Open in IMG/M |
| 3300010325|Ga0134064_10011397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2395 | Open in IMG/M |
| 3300010325|Ga0134064_10067305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1126 | Open in IMG/M |
| 3300010329|Ga0134111_10077413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1249 | Open in IMG/M |
| 3300010333|Ga0134080_10326071 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300010333|Ga0134080_10678833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300010335|Ga0134063_10699986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300010336|Ga0134071_10036326 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300010336|Ga0134071_10155419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1114 | Open in IMG/M |
| 3300010337|Ga0134062_10007869 | All Organisms → cellular organisms → Bacteria | 3870 | Open in IMG/M |
| 3300010337|Ga0134062_10090111 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300010337|Ga0134062_10640997 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010364|Ga0134066_10199961 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300010364|Ga0134066_10211921 | Not Available | 649 | Open in IMG/M |
| 3300012198|Ga0137364_11349439 | Not Available | 529 | Open in IMG/M |
| 3300012198|Ga0137364_11439010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300012199|Ga0137383_10910181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300012199|Ga0137383_11353473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300012200|Ga0137382_10085505 | All Organisms → cellular organisms → Bacteria | 2053 | Open in IMG/M |
| 3300012200|Ga0137382_10115874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1785 | Open in IMG/M |
| 3300012200|Ga0137382_10180226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1445 | Open in IMG/M |
| 3300012201|Ga0137365_10661064 | Not Available | 765 | Open in IMG/M |
| 3300012202|Ga0137363_10046929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3076 | Open in IMG/M |
| 3300012202|Ga0137363_10889315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300012203|Ga0137399_10648035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 889 | Open in IMG/M |
| 3300012206|Ga0137380_10316973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1395 | Open in IMG/M |
| 3300012206|Ga0137380_10444505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1147 | Open in IMG/M |
| 3300012208|Ga0137376_10056818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3218 | Open in IMG/M |
| 3300012209|Ga0137379_10132513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2395 | Open in IMG/M |
| 3300012209|Ga0137379_10163329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2139 | Open in IMG/M |
| 3300012210|Ga0137378_10534901 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300012210|Ga0137378_10794293 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300012211|Ga0137377_10819073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300012211|Ga0137377_10952753 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012349|Ga0137387_10705532 | Not Available | 730 | Open in IMG/M |
| 3300012356|Ga0137371_10019313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 5247 | Open in IMG/M |
| 3300012356|Ga0137371_10931092 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300012359|Ga0137385_10063811 | All Organisms → cellular organisms → Bacteria | 3279 | Open in IMG/M |
| 3300012918|Ga0137396_10854673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300012927|Ga0137416_11919690 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012929|Ga0137404_11570333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300012930|Ga0137407_10455018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1191 | Open in IMG/M |
| 3300012975|Ga0134110_10337745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300012976|Ga0134076_10284872 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300012977|Ga0134087_10068917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1430 | Open in IMG/M |
| 3300012977|Ga0134087_10166172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 969 | Open in IMG/M |
| 3300012977|Ga0134087_10742141 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300014154|Ga0134075_10053264 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300014154|Ga0134075_10053273 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300014154|Ga0134075_10279374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300014157|Ga0134078_10078748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1197 | Open in IMG/M |
| 3300014157|Ga0134078_10200849 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300014157|Ga0134078_10623078 | Not Available | 519 | Open in IMG/M |
| 3300014166|Ga0134079_10091757 | Not Available | 1145 | Open in IMG/M |
| 3300015245|Ga0137409_10832215 | Not Available | 758 | Open in IMG/M |
| 3300015359|Ga0134085_10013554 | All Organisms → cellular organisms → Bacteria | 3039 | Open in IMG/M |
| 3300015359|Ga0134085_10569779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300017659|Ga0134083_10278444 | Not Available | 705 | Open in IMG/M |
| 3300018431|Ga0066655_10071040 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
| 3300018431|Ga0066655_10279204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1080 | Open in IMG/M |
| 3300018431|Ga0066655_10571983 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300018431|Ga0066655_11077120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300018433|Ga0066667_10136254 | Not Available | 1707 | Open in IMG/M |
| 3300018433|Ga0066667_10458672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
| 3300018433|Ga0066667_10626019 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300018433|Ga0066667_11510654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300018468|Ga0066662_10337972 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300018468|Ga0066662_11351568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300018468|Ga0066662_12300679 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300018482|Ga0066669_10515817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1037 | Open in IMG/M |
| 3300018482|Ga0066669_10862098 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300018482|Ga0066669_11111834 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300018482|Ga0066669_11897314 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018482|Ga0066669_12116417 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300025922|Ga0207646_10258932 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300025922|Ga0207646_11495573 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300026277|Ga0209350_1038410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1410 | Open in IMG/M |
| 3300026306|Ga0209468_1055699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1335 | Open in IMG/M |
| 3300026306|Ga0209468_1146813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300026307|Ga0209469_1105676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 757 | Open in IMG/M |
| 3300026309|Ga0209055_1111644 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 1063 | Open in IMG/M |
| 3300026313|Ga0209761_1064741 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
| 3300026314|Ga0209268_1038094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → unclassified Desulfatiglans → Desulfatiglans sp. | 1599 | Open in IMG/M |
| 3300026314|Ga0209268_1042254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 1492 | Open in IMG/M |
| 3300026314|Ga0209268_1047607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1379 | Open in IMG/M |
| 3300026314|Ga0209268_1116012 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300026316|Ga0209155_1114498 | Not Available | 949 | Open in IMG/M |
| 3300026323|Ga0209472_1151712 | Not Available | 866 | Open in IMG/M |
| 3300026324|Ga0209470_1005290 | All Organisms → cellular organisms → Bacteria | 8483 | Open in IMG/M |
| 3300026324|Ga0209470_1013372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4750 | Open in IMG/M |
| 3300026324|Ga0209470_1138128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1075 | Open in IMG/M |
| 3300026324|Ga0209470_1318693 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026327|Ga0209266_1104739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1229 | Open in IMG/M |
| 3300026327|Ga0209266_1159136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 899 | Open in IMG/M |
| 3300026328|Ga0209802_1019235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3798 | Open in IMG/M |
| 3300026329|Ga0209375_1099935 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300026329|Ga0209375_1194862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300026330|Ga0209473_1087947 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300026330|Ga0209473_1131841 | Not Available | 1030 | Open in IMG/M |
| 3300026330|Ga0209473_1179060 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon | 826 | Open in IMG/M |
| 3300026330|Ga0209473_1248836 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300026333|Ga0209158_1212285 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300026334|Ga0209377_1093210 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300026342|Ga0209057_1086182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1313 | Open in IMG/M |
| 3300026342|Ga0209057_1187993 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300026343|Ga0209159_1007153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6946 | Open in IMG/M |
| 3300026343|Ga0209159_1020991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3680 | Open in IMG/M |
| 3300026343|Ga0209159_1030797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2867 | Open in IMG/M |
| 3300026343|Ga0209159_1055528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1914 | Open in IMG/M |
| 3300026343|Ga0209159_1102712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1241 | Open in IMG/M |
| 3300026343|Ga0209159_1176688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300026343|Ga0209159_1227983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300026524|Ga0209690_1274874 | Not Available | 531 | Open in IMG/M |
| 3300026528|Ga0209378_1016504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4243 | Open in IMG/M |
| 3300026528|Ga0209378_1306621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300026529|Ga0209806_1038427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2327 | Open in IMG/M |
| 3300026530|Ga0209807_1018277 | All Organisms → cellular organisms → Bacteria | 3427 | Open in IMG/M |
| 3300026530|Ga0209807_1220917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300026536|Ga0209058_1001574 | All Organisms → cellular organisms → Bacteria | 19396 | Open in IMG/M |
| 3300026537|Ga0209157_1302027 | Not Available | 587 | Open in IMG/M |
| 3300026538|Ga0209056_10075537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2867 | Open in IMG/M |
| 3300026538|Ga0209056_10119065 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300026538|Ga0209056_10668084 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026538|Ga0209056_10675768 | Not Available | 521 | Open in IMG/M |
| 3300026540|Ga0209376_1019367 | All Organisms → cellular organisms → Bacteria | 4578 | Open in IMG/M |
| 3300026540|Ga0209376_1149702 | Not Available | 1120 | Open in IMG/M |
| 3300026540|Ga0209376_1159432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1072 | Open in IMG/M |
| 3300026542|Ga0209805_1337887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300026547|Ga0209156_10056061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → unclassified Desulfatiglans → Desulfatiglans sp. | 2072 | Open in IMG/M |
| 3300026547|Ga0209156_10100939 | Not Available | 1435 | Open in IMG/M |
| 3300026548|Ga0209161_10247995 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300026550|Ga0209474_10050194 | All Organisms → cellular organisms → Bacteria | 2989 | Open in IMG/M |
| 3300026550|Ga0209474_10259706 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300026550|Ga0209474_10430954 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300027655|Ga0209388_1050607 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300027748|Ga0209689_1258095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300027748|Ga0209689_1392301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300027846|Ga0209180_10458373 | Not Available | 718 | Open in IMG/M |
| 3300028536|Ga0137415_10571178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 941 | Open in IMG/M |
| 3300031949|Ga0214473_11701689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 57.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066674_100442003 | 3300005166 | Soil | MTGAEESVGVTMVSEANEPGSESRKRSDDRRGVPEGTPQEGGAS |
| Ga0066677_102281241 | 3300005171 | Soil | MVASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0066683_100494041 | 3300005172 | Soil | MVASEANEPGSESGKRSDDRRGAARGTRAGCWSPQEGGASSHL |
| Ga0066683_101039801 | 3300005172 | Soil | MVSEANEPGSESGKRSDDRRGVPKGTPQEGGASTPLAAPGS |
| Ga0066683_104618451 | 3300005172 | Soil | VIVVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGAS |
| Ga0066680_100642393 | 3300005174 | Soil | MIMVSEANEPGSESGKRSDDRRGAARGTRAGGWSPQEGGAS |
| Ga0066673_106807142 | 3300005175 | Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0066679_105095222 | 3300005176 | Soil | MVSEAREPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGS |
| Ga0066690_107030541 | 3300005177 | Soil | MVSEANEPGSESGMRSDDRRGVPEGTPQEGGASSHLAARL |
| Ga0066688_107630392 | 3300005178 | Soil | MVSEAREPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0066684_108435111 | 3300005179 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWTPQEGGASSHL |
| Ga0066685_100456191 | 3300005180 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGGWSPQEGGASNHLAARLPPRS |
| Ga0066685_105378321 | 3300005180 | Soil | VASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0066685_106792201 | 3300005180 | Soil | MASEANEPGSESGKRSDDRRGVPAGTPQEGGASSHLAARLPPRS |
| Ga0066676_101358093 | 3300005186 | Soil | MVVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0066676_105260922 | 3300005186 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWTPQEGGASSHLAARLPPR |
| Ga0066676_109736801 | 3300005186 | Soil | VTMVSEANEPGSESGKRSDDRRGVPEGTPQEGEASTPLAAPG |
| Ga0066675_101949971 | 3300005187 | Soil | MVVSEANEPGSESGKRSDDRRGVPGGTPQEGGASTPLAAPG |
| Ga0066675_111247091 | 3300005187 | Soil | MVVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTSLAAPG |
| Ga0066675_113611522 | 3300005187 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGEASTPLAAPG |
| Ga0070708_1011298342 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSEASEPGSESGKRSDDRRGVPVGTPQEEGASTPLAAPGS |
| Ga0066686_103362311 | 3300005446 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWTPQEGGASSHLAARL |
| Ga0066686_110589661 | 3300005446 | Soil | MVASEANEPGSESGKRSDDRRGAARGTRAGCWSPQEGGAS |
| Ga0066689_105641172 | 3300005447 | Soil | MVSEATEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASNHLAAR |
| Ga0066689_110253002 | 3300005447 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASNHSAA |
| Ga0066682_102081391 | 3300005450 | Soil | MVASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAP |
| Ga0066682_103133192 | 3300005450 | Soil | MVNEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0066681_101062251 | 3300005451 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASSHLAARL |
| Ga0066681_106472602 | 3300005451 | Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASTPLAAPG |
| Ga0066697_102663041 | 3300005540 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWTPQEGGAS |
| Ga0066697_106448601 | 3300005540 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPL |
| Ga0066697_107756421 | 3300005540 | Soil | MVSEANEPGSESGERSDDRRGVPEGTPQEGEASTPLAAPGSFA |
| Ga0066697_108302031 | 3300005540 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGGWSPQEGGAS |
| Ga0066701_103458731 | 3300005552 | Soil | VSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0066701_103519321 | 3300005552 | Soil | VTMVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGAS |
| Ga0066695_103833314 | 3300005553 | Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASTPLAAP |
| Ga0066661_101492423 | 3300005554 | Soil | MASEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASSHLAARLPPR |
| Ga0066661_102955512 | 3300005554 | Soil | VVMVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPL |
| Ga0066692_102632361 | 3300005555 | Soil | MVASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLA |
| Ga0066692_102768321 | 3300005555 | Soil | MVASEANEPGSESGKRSDDRRGAARGTRAGGWSPQEGGASSHL |
| Ga0066692_106599642 | 3300005555 | Soil | MASEAHEPGSESGKRSDDRRGAARGTRAGSWSPQE |
| Ga0066707_102949771 | 3300005556 | Soil | MVSEANEPGSESGKRSDDRRGAARGTCAESWSPQEGGA |
| Ga0066707_104981582 | 3300005556 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGCWSPQEGGA |
| Ga0066707_105162491 | 3300005556 | Soil | MVSEATEPGSESGKRSDDRRGAARGTRAGSWSPQEGGAS |
| Ga0066707_108078111 | 3300005556 | Soil | MVDEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0066707_109380641 | 3300005556 | Soil | MVSEANEPGSESGKRSDDRRGVPVGTPQEGGASTPLAAPGS |
| Ga0066704_109682902 | 3300005557 | Soil | VIMVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAP |
| Ga0066700_100488481 | 3300005559 | Soil | MVASEANEPGSESGKRSDDRRGVPEGTPQEGGASSHLAARL |
| Ga0066700_101583665 | 3300005559 | Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASTPLAVP |
| Ga0066700_103762281 | 3300005559 | Soil | MVASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGS |
| Ga0066700_105961361 | 3300005559 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWTPQEGGA |
| Ga0066700_108457633 | 3300005559 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWTPQEGG |
| Ga0066700_111538501 | 3300005559 | Soil | MASEAHEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASSHLAAR |
| Ga0066705_108042592 | 3300005569 | Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGS |
| Ga0066694_103334343 | 3300005574 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASSH |
| Ga0066694_105087842 | 3300005574 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASTP |
| Ga0066708_100421431 | 3300005576 | Soil | MVDEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASSHLAAR |
| Ga0066691_109226052 | 3300005586 | Soil | MASEANESGSESGKRSDDRRGAARGTRAGSWSPQEGGAS |
| Ga0066654_109183672 | 3300005587 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASNHL |
| Ga0066706_103575611 | 3300005598 | Soil | VAMASEASEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0066706_114999121 | 3300005598 | Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGGASSHLAARLP |
| Ga0066651_100884773 | 3300006031 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGGWSPQEG |
| Ga0066651_102242732 | 3300006031 | Soil | MVDEPGSESGKRSDDRRGAVRGTRAGSWSPQEGGASSHLAARLPPR |
| Ga0066651_104629503 | 3300006031 | Soil | VVVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0066656_102122383 | 3300006034 | Soil | MVVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLA |
| Ga0066656_103276341 | 3300006034 | Soil | MVSEAHEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGS |
| Ga0066652_1009902273 | 3300006046 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASSHLAARLPPRSP |
| Ga0066653_101311721 | 3300006791 | Soil | VIVVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGG |
| Ga0066653_102834732 | 3300006791 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAP |
| Ga0066653_103631451 | 3300006791 | Soil | MVSEASEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGS |
| Ga0066658_104657592 | 3300006794 | Soil | VVMVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGAS |
| Ga0066665_100854735 | 3300006796 | Soil | VSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0066665_101980831 | 3300006796 | Soil | MASEANEPGGESGKRSNDRRGVPEGTPQEGGASTPLAAP |
| Ga0066665_105244201 | 3300006796 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWTPQEGGASS |
| Ga0066665_108540182 | 3300006796 | Soil | VTMVSEANEPGSESGKRSDDRRGVPEGTPQEGEASTP |
| Ga0066665_109220352 | 3300006796 | Soil | MVASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0066665_113584172 | 3300006796 | Soil | MVVSEANEPGSESGKRSDDRRGVPEGTPQEGGAST |
| Ga0066659_116302281 | 3300006797 | Soil | MVASEVNEPGSESGKRSDDRRGAARGTRAGCWSPQEGGASSHLAARL |
| Ga0066659_117792582 | 3300006797 | Soil | MVVSEANEPGSESGKRSDDRRGVPEGTPQEGGASSHL |
| Ga0099794_102707382 | 3300007265 | Vadose Zone Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0066710_1036635301 | 3300009012 | Grasslands Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAP |
| Ga0066710_1040184412 | 3300009012 | Grasslands Soil | VIMVSEANEPGSEGAERSDDRRGVPEGTPQEGGAST |
| Ga0066710_1044257281 | 3300009012 | Grasslands Soil | MASEANEPGGESGKRSDDRRAVPEGTAQEGGASSHLAAR |
| Ga0099829_101591611 | 3300009038 | Vadose Zone Soil | MVSEANGPGSESGKRSDDRRGVPEGTPQEEGASMPLAAPGS |
| Ga0099830_102915153 | 3300009088 | Vadose Zone Soil | MVSEANEPGSEGGKRSDDRRGAARGTRAGSWSPQEGG |
| Ga0066709_1035477011 | 3300009137 | Grasslands Soil | MVSEVNEPGSESGKRSDDRRGVPEGTPQEGGASSHLAA |
| Ga0127486_10840721 | 3300010128 | Grasslands Soil | VIVVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEG |
| Ga0134070_101337191 | 3300010301 | Grasslands Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASRQ |
| Ga0134088_100858231 | 3300010304 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGGWSPQE |
| Ga0134088_103670271 | 3300010304 | Grasslands Soil | MVSEVNEPGSESGKRSDDRRAVPEGTAQEGGASTPL |
| Ga0134088_105261082 | 3300010304 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAA |
| Ga0134109_101194051 | 3300010320 | Grasslands Soil | MASEANEPGSESGKRSDDRRGVPKGTPQEEGASTPLAAPGSF |
| Ga0134064_100113971 | 3300010325 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSFA |
| Ga0134064_100673051 | 3300010325 | Grasslands Soil | MVSEANERGSESGKRSDDRRGAPEGTPQEGGASTPLAAPGSF |
| Ga0134111_100774131 | 3300010329 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGAS |
| Ga0134080_103260711 | 3300010333 | Grasslands Soil | MASEAYEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAP |
| Ga0134080_106788332 | 3300010333 | Grasslands Soil | VIVASEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASTPL |
| Ga0134063_106999862 | 3300010335 | Grasslands Soil | MVSEANEPGSESGERSDDRRGVPEGTPQEGEASTP |
| Ga0134071_100363263 | 3300010336 | Grasslands Soil | MVASEADEPGSESGKRSDDRRGAARGTRAGSWSPQ |
| Ga0134071_101554194 | 3300010336 | Grasslands Soil | MVASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPL |
| Ga0134062_100078691 | 3300010337 | Grasslands Soil | MASGAHEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0134062_100901114 | 3300010337 | Grasslands Soil | VIVVSEANEPGSESGKRSDDRRGAARGTRAGCWSPQE |
| Ga0134062_106409971 | 3300010337 | Grasslands Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASTP |
| Ga0134066_101999612 | 3300010364 | Grasslands Soil | MVSEANEPGSESCKRSDDRRGVPEGTPQEGGASTPLA |
| Ga0134066_102119211 | 3300010364 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGMRAGSWSPQE |
| Ga0137364_113494391 | 3300012198 | Vadose Zone Soil | MVVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGS |
| Ga0137364_114390102 | 3300012198 | Vadose Zone Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLA |
| Ga0137383_109101811 | 3300012199 | Vadose Zone Soil | MVGSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLEA |
| Ga0137383_113534731 | 3300012199 | Vadose Zone Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASNHSAAR |
| Ga0137382_100855054 | 3300012200 | Vadose Zone Soil | MVDEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSFA |
| Ga0137382_101158741 | 3300012200 | Vadose Zone Soil | MVSEANESGSESGKRSDDRRGVPEGTPQEGGASTPLAAP |
| Ga0137382_101802261 | 3300012200 | Vadose Zone Soil | MTSEANEPGSESGKRSDDRRGVPSGTPQEGGASSHLAARL |
| Ga0137365_106610642 | 3300012201 | Vadose Zone Soil | MVVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGAS |
| Ga0137363_100469294 | 3300012202 | Vadose Zone Soil | MVSEANEPGSEIGKRSDDRRGVPEGTPQEGGASAPLAAP |
| Ga0137363_108893152 | 3300012202 | Vadose Zone Soil | MVSEVNEPGSESGKRSDDRRGVPEGTPQEGGASNHLAARLAPRA |
| Ga0137399_106480351 | 3300012203 | Vadose Zone Soil | MPSEVNEPGSESGKRSDDRRAVPDGTAQEGGASTHLAARLPPRSP |
| Ga0137380_103169733 | 3300012206 | Vadose Zone Soil | MVSEANEPGSESGERSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0137380_104445051 | 3300012206 | Vadose Zone Soil | MASETNEPGSESGKRSDDRRGVPCGTPQEGGASTPLAAPGSF |
| Ga0137376_100568181 | 3300012208 | Vadose Zone Soil | VIMVSEANEPGSESGKRSDDRRGAARGTRAGGWSPQEGG |
| Ga0137379_101325131 | 3300012209 | Vadose Zone Soil | MVGELNEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGS |
| Ga0137379_101633294 | 3300012209 | Vadose Zone Soil | MVSEANEPGSESGKRSDDRRGVPKGTPQEGGASTPLAA |
| Ga0137378_105349012 | 3300012210 | Vadose Zone Soil | VVMASEANEPGSESRKRSDDRRGVPEGTPQEGGASTPLAAPGSFAA |
| Ga0137378_107942932 | 3300012210 | Vadose Zone Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASSHLAARLSPRS |
| Ga0137377_108190731 | 3300012211 | Vadose Zone Soil | MVSEANEPGSESGERSDDRRGVPEGTPQEGEASTPLAAPGS |
| Ga0137377_109527531 | 3300012211 | Vadose Zone Soil | MVSEANESGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGS |
| Ga0137387_107055321 | 3300012349 | Vadose Zone Soil | MVSGANEPGSESGKRSDDRRAVPEDTAQEGGASTPL |
| Ga0137371_100193131 | 3300012356 | Vadose Zone Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEAGASPPL |
| Ga0137371_109310921 | 3300012356 | Vadose Zone Soil | MVVSEANDPGSESGKRSDDRRGVPEGTPQEGEASTPLAAPGS |
| Ga0137385_100638111 | 3300012359 | Vadose Zone Soil | MVASEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASSHLA |
| Ga0137396_108546731 | 3300012918 | Vadose Zone Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASSHLAAR |
| Ga0137416_119196902 | 3300012927 | Vadose Zone Soil | MVSEANEPGSESGKRSDDRGGVAWAPPHEGGASNHLAARLA |
| Ga0137404_115703331 | 3300012929 | Vadose Zone Soil | MVSEVNEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0137407_104550181 | 3300012930 | Vadose Zone Soil | MMSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0134110_103377452 | 3300012975 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGVARGTRAGSWSPQEGGASSHLAARLPPRSP |
| Ga0134076_102848721 | 3300012976 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGVPKGTPQEGGASTP |
| Ga0134087_100689172 | 3300012977 | Grasslands Soil | VIMVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGG |
| Ga0134087_101661723 | 3300012977 | Grasslands Soil | MASEANEPGSESGKRSDDRRGVPEDTPQEGGASTPLA |
| Ga0134087_107421412 | 3300012977 | Grasslands Soil | MVASEADEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0134075_100532643 | 3300014154 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGAST |
| Ga0134075_100532733 | 3300014154 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEDAARSPRIVR |
| Ga0134075_102793743 | 3300014154 | Grasslands Soil | MVSEANEPGSENGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0134078_100787485 | 3300014157 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEEG |
| Ga0134078_102008492 | 3300014157 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASTPLAAPG |
| Ga0134078_106230781 | 3300014157 | Grasslands Soil | MVVSEANEPGSESGKRSDDRRGVPEGTPQEGEASTPL |
| Ga0134079_100917571 | 3300014166 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASSHLA |
| Ga0137409_108322152 | 3300015245 | Vadose Zone Soil | MVSEANEPGSESGKRSDDRRGAARRMRAGCWLPQEGGAS |
| Ga0134085_100135545 | 3300015359 | Grasslands Soil | MVNEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSFA |
| Ga0134085_105697791 | 3300015359 | Grasslands Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGGASSHLA |
| Ga0134083_102784442 | 3300017659 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTHAGSWPPQEG |
| Ga0066655_100710401 | 3300018431 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLA |
| Ga0066655_102792041 | 3300018431 | Grasslands Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0066655_105719833 | 3300018431 | Grasslands Soil | MVASEADEPGSESGKRSDDRRGAARGTRAGSWSPQEEGAS |
| Ga0066655_110771201 | 3300018431 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGG |
| Ga0066667_101362543 | 3300018433 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTCAESWSPQEGGAS |
| Ga0066667_104586721 | 3300018433 | Grasslands Soil | MVSEAHEPGSESGKRSDDRRGVPEGTPQEGEASTPLAAPGS |
| Ga0066667_106260191 | 3300018433 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGGWSPQEGG |
| Ga0066667_115106541 | 3300018433 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGCWSPQEGGAS |
| Ga0066662_103379723 | 3300018468 | Grasslands Soil | MASEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGAS |
| Ga0066662_113515681 | 3300018468 | Grasslands Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASTPL |
| Ga0066662_123006792 | 3300018468 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGA |
| Ga0066669_105158172 | 3300018482 | Grasslands Soil | MDEPGSESGKRSDDRRGAARGTRAGSWSPQEGEAS |
| Ga0066669_108620981 | 3300018482 | Grasslands Soil | MVSEVNEPGSESGKRSDDRRGVPEGTPQEGGASSHLAARLPPRSP |
| Ga0066669_111118341 | 3300018482 | Grasslands Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGGASTP |
| Ga0066669_118973141 | 3300018482 | Grasslands Soil | MVSEANEPGSESGKRSDDQRAVPEGTAQEGGASRQSAAR |
| Ga0066669_121164171 | 3300018482 | Grasslands Soil | MASEANEPGSESGKRSDDRRAVPEGTAQEGGASTALAAPGSF |
| Ga0207646_102589323 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGS |
| Ga0207646_114955732 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MASETNEAGSESGKRSDDRRGAVRGTRAVCWSPQEG |
| Ga0209350_10384101 | 3300026277 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGCWSPQEGGASNHLAAR |
| Ga0209468_10556991 | 3300026306 | Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGEASTPLAAPGSFAAA |
| Ga0209468_11468132 | 3300026306 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEG |
| Ga0209469_11056762 | 3300026307 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTP |
| Ga0209055_11116441 | 3300026309 | Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASTPLAVPGSF |
| Ga0209761_10647413 | 3300026313 | Grasslands Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASNHLAARLAPR |
| Ga0209268_10380942 | 3300026314 | Soil | MVSEASEPGSESGKRSDDRRGVPEGTPQEGGASTPL |
| Ga0209268_10422542 | 3300026314 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0209268_10476071 | 3300026314 | Soil | MASEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGG |
| Ga0209268_11160121 | 3300026314 | Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASRQSAARL |
| Ga0209155_11144981 | 3300026316 | Soil | MASEAHEPGSESGKRSDDRRGVPEGTPQEEGASTPLAAPGS |
| Ga0209472_11517121 | 3300026323 | Soil | MVVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTS |
| Ga0209470_100529010 | 3300026324 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASS |
| Ga0209470_10133721 | 3300026324 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGNWTPQKGGASTPLAAPGS |
| Ga0209470_11381281 | 3300026324 | Soil | VIVASEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASTPLAA |
| Ga0209470_13186931 | 3300026324 | Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASRQSAARLSPRSPG |
| Ga0209266_11047392 | 3300026327 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASTPLAAP |
| Ga0209266_11591362 | 3300026327 | Soil | MVDEPGSESGKRSDDRRGAVRGTRAGTWSPQEGGASSHLAARL |
| Ga0209802_10192354 | 3300026328 | Soil | MVSEANEPGSESGERSDDRRGVPEGTPQEGEASTPLA |
| Ga0209375_10999353 | 3300026329 | Soil | MVASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSFAAA |
| Ga0209375_11948623 | 3300026329 | Soil | MASEANESGSESGKRSDDRRGAARGTRAGSWSPQEGEASSHLAARLPP |
| Ga0209473_10879472 | 3300026330 | Soil | MVVSEANEPGSESGKRSDDRRGVPGGTPQEGGASTPLAAP |
| Ga0209473_11318412 | 3300026330 | Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASSHLA |
| Ga0209473_11790601 | 3300026330 | Soil | MVSEANEPGSESGTRSDDRRAVPEGTAQEGGASTPLAAPGS |
| Ga0209473_12488362 | 3300026330 | Soil | MVSEANEPGSESGERSDDRRGVPEGTPQEGGASTPLAAPGS |
| Ga0209158_12122852 | 3300026333 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGGWSPQEGGA |
| Ga0209377_10932102 | 3300026334 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASSHLA |
| Ga0209057_10861823 | 3300026342 | Soil | MVSEANEPGSESGKRSDDRRGAARETRAGSWSPQEGGASNHLAARLPPRSPG |
| Ga0209057_11879931 | 3300026342 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEEGASTPLAAPG |
| Ga0209159_10071537 | 3300026343 | Soil | MVASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSFA |
| Ga0209159_10209911 | 3300026343 | Soil | MVSDANEPGSESGKRSDDRRGAARGTRAGGWSPQEG |
| Ga0209159_10307971 | 3300026343 | Soil | MVSEANEPGSESGKRSDDRRAVPEGTAQEGGASTPLA |
| Ga0209159_10555281 | 3300026343 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEDAARSPRIVRRSR |
| Ga0209159_11027121 | 3300026343 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGGWSPQEGGASNH |
| Ga0209159_11766881 | 3300026343 | Soil | MASEAHEPGSESGKRSDDRRGVPEGTPQEGGASTP |
| Ga0209159_12279831 | 3300026343 | Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSFA |
| Ga0209690_12748741 | 3300026524 | Soil | MVSEANEPGSESGKRSDDRRGVPVGTPQEGGASNHLAARLLPRSPGS |
| Ga0209378_10165041 | 3300026528 | Soil | MASEAHEPGSESGKRSDDRRGVPEGTPQEEGASSPLA |
| Ga0209378_13066212 | 3300026528 | Soil | VVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0209806_10384272 | 3300026529 | Soil | MVSEVNELGSESGKRSDDRRGVPEGTPQEGGASNHLAAR |
| Ga0209807_10182771 | 3300026530 | Soil | MVNEANEPGSESGKRSDDRRGVPEGTPQEGGASTP |
| Ga0209807_12209171 | 3300026530 | Soil | VVMVSEANEPGSESGERSDDRRGAARGTRAGSWSPQEGGASSHLAARL |
| Ga0209058_10015741 | 3300026536 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQE |
| Ga0209157_13020271 | 3300026537 | Soil | MMVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0209056_100755371 | 3300026538 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGNWTPQKGGASTP |
| Ga0209056_101190651 | 3300026538 | Soil | MASEANEPGGESGKRSNDRRGVPEGTPQEGGASTPLA |
| Ga0209056_106680841 | 3300026538 | Soil | VTMVSEANEPGSESGKRSDDRRGVPEGTPQEGEASTPLA |
| Ga0209056_106757683 | 3300026538 | Soil | MPSREPSETGSESAKRSDDRGGVPKGTPHKGGASTALAAPG |
| Ga0209376_10193671 | 3300026540 | Soil | MVSEANEPGSESGKRSDDPRAVPEGTAQEGGASTAL |
| Ga0209376_11497022 | 3300026540 | Soil | MVSEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAGP |
| Ga0209376_11594321 | 3300026540 | Soil | MVSEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASSH |
| Ga0209805_13378872 | 3300026542 | Soil | VVMVSEANEPGSESGERSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0209156_100560612 | 3300026547 | Soil | MVSEASEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPG |
| Ga0209156_101009391 | 3300026547 | Soil | MVSEANEPGSQSGKRSDDRRGAARGTRAGGWSPQEGGASNHLAARLPP |
| Ga0209161_102479952 | 3300026548 | Soil | MTSEANEPGSESGKRSDDRRGVPSGTPQEGGASSHLAARLAPRAP |
| Ga0209474_100501941 | 3300026550 | Soil | MVSEANEAGSESGERSDDRRGVPEGTPQEGGASTP |
| Ga0209474_102597061 | 3300026550 | Soil | VIVASEANEPGSESGKRSDDRRGVPSGTPQEGGASTPLA |
| Ga0209474_104309541 | 3300026550 | Soil | MVASEADEPGSESGKRSDDRRGVPEGTPQEEGASTPLA |
| Ga0209388_10506071 | 3300027655 | Vadose Zone Soil | VIVASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAAPGSF |
| Ga0209689_12580951 | 3300027748 | Soil | MVSEAREPGSESGKRSDDRRGVPEGTPQEGGASTPLAA |
| Ga0209689_13923011 | 3300027748 | Soil | MASEANEPGSESGKRSDDRRGVPEGTPQEGGASTPLAA |
| Ga0209180_104583733 | 3300027846 | Vadose Zone Soil | MVASEANEPGSESGKRSDDRRGAARGTRAGSWSPQEGGASSHLAARLP |
| Ga0137415_105711783 | 3300028536 | Vadose Zone Soil | MVREANEPGSESGKRSNDRRGVPEGTPEEGGASTPLAASGSF |
| Ga0214473_117016891 | 3300031949 | Soil | MAPSEPNEPGSESGKRSADRGGVARATPHKGGASTPLAAPGS |
| ⦗Top⦘ |