


| Basic Information | |
|---|---|
| Family ID | F018990 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 232 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQHLYP |
| Number of Associated Samples | 203 |
| Number of Associated Scaffolds | 232 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.21 % |
| % of genes near scaffold ends (potentially truncated) | 95.69 % |
| % of genes from short scaffolds (< 2000 bps) | 91.81 % |
| Associated GOLD sequencing projects | 192 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.121 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.948 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.017 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.483 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.35% β-sheet: 8.45% Coil/Unstructured: 66.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 232 Family Scaffolds |
|---|---|---|
| PF00126 | HTH_1 | 12.50 |
| PF00903 | Glyoxalase | 6.03 |
| PF07883 | Cupin_2 | 6.03 |
| PF07690 | MFS_1 | 4.31 |
| PF03466 | LysR_substrate | 4.31 |
| PF00891 | Methyltransf_2 | 3.88 |
| PF05977 | MFS_3 | 3.88 |
| PF02643 | DUF192 | 3.45 |
| PF08281 | Sigma70_r4_2 | 3.02 |
| PF12840 | HTH_20 | 2.16 |
| PF03795 | YCII | 1.72 |
| PF05378 | Hydant_A_N | 1.29 |
| PF01575 | MaoC_dehydratas | 1.29 |
| PF13561 | adh_short_C2 | 0.86 |
| PF13302 | Acetyltransf_3 | 0.86 |
| PF07045 | DUF1330 | 0.86 |
| PF04264 | YceI | 0.86 |
| PF12681 | Glyoxalase_2 | 0.86 |
| PF02317 | Octopine_DH | 0.86 |
| PF00561 | Abhydrolase_1 | 0.86 |
| PF12847 | Methyltransf_18 | 0.43 |
| PF04392 | ABC_sub_bind | 0.43 |
| PF00496 | SBP_bac_5 | 0.43 |
| PF13379 | NMT1_2 | 0.43 |
| PF00873 | ACR_tran | 0.43 |
| PF00583 | Acetyltransf_1 | 0.43 |
| PF01546 | Peptidase_M20 | 0.43 |
| PF03150 | CCP_MauG | 0.43 |
| PF02826 | 2-Hacid_dh_C | 0.43 |
| PF08327 | AHSA1 | 0.43 |
| PF08450 | SGL | 0.43 |
| PF01850 | PIN | 0.43 |
| PF00067 | p450 | 0.43 |
| PF00144 | Beta-lactamase | 0.43 |
| PF01408 | GFO_IDH_MocA | 0.43 |
| PF01381 | HTH_3 | 0.43 |
| PF00296 | Bac_luciferase | 0.43 |
| PF04909 | Amidohydro_2 | 0.43 |
| PF13452 | MaoC_dehydrat_N | 0.43 |
| PF00498 | FHA | 0.43 |
| PF08592 | Anthrone_oxy | 0.43 |
| PF07687 | M20_dimer | 0.43 |
| PF00082 | Peptidase_S8 | 0.43 |
| PF08352 | oligo_HPY | 0.43 |
| PF12704 | MacB_PCD | 0.43 |
| PF00069 | Pkinase | 0.43 |
| PF00202 | Aminotran_3 | 0.43 |
| PF01210 | NAD_Gly3P_dh_N | 0.43 |
| PF12697 | Abhydrolase_6 | 0.43 |
| PF13669 | Glyoxalase_4 | 0.43 |
| PF01179 | Cu_amine_oxid | 0.43 |
| PF12973 | Cupin_7 | 0.43 |
| PF01844 | HNH | 0.43 |
| PF00817 | IMS | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 232 Family Scaffolds |
|---|---|---|---|
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 3.88 |
| COG1430 | Uncharacterized conserved membrane protein, UPF0127 family | Function unknown [S] | 3.45 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 2.59 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.72 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.72 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.86 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.86 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.43 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.43 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.43 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.43 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.43 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.43 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.43 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.43 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.12 % |
| Unclassified | root | N/A | 3.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01DH0B8 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300000956|JGI10216J12902_111130664 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300002530|C687J35503_10102847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
| 3300004092|Ga0062389_103431355 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300004643|Ga0062591_101009151 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005167|Ga0066672_10015334 | All Organisms → cellular organisms → Bacteria | 3862 | Open in IMG/M |
| 3300005172|Ga0066683_10839734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300005176|Ga0066679_10584086 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005176|Ga0066679_10939498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300005179|Ga0066684_10532069 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005330|Ga0070690_100730322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 763 | Open in IMG/M |
| 3300005345|Ga0070692_10469061 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005355|Ga0070671_101937946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300005434|Ga0070709_11009604 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 662 | Open in IMG/M |
| 3300005445|Ga0070708_100100111 | All Organisms → cellular organisms → Bacteria | 2652 | Open in IMG/M |
| 3300005457|Ga0070662_100010469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6088 | Open in IMG/M |
| 3300005467|Ga0070706_101018484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
| 3300005471|Ga0070698_100037959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4965 | Open in IMG/M |
| 3300005471|Ga0070698_100833699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 867 | Open in IMG/M |
| 3300005471|Ga0070698_102228152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300005540|Ga0066697_10086734 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1811 | Open in IMG/M |
| 3300005546|Ga0070696_100958396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 713 | Open in IMG/M |
| 3300005557|Ga0066704_10335892 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300005557|Ga0066704_10352845 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005576|Ga0066708_10715880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 633 | Open in IMG/M |
| 3300005618|Ga0068864_100965796 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300005713|Ga0066905_101772376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
| 3300005719|Ga0068861_102714473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300005764|Ga0066903_108677220 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006041|Ga0075023_100068475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1158 | Open in IMG/M |
| 3300006173|Ga0070716_101771021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300006175|Ga0070712_101988868 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300006176|Ga0070765_101878428 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006354|Ga0075021_10233668 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300006845|Ga0075421_101646016 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300006845|Ga0075421_101837357 | Not Available | 651 | Open in IMG/M |
| 3300006854|Ga0075425_101800103 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300006876|Ga0079217_11394871 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006880|Ga0075429_100826416 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300006894|Ga0079215_10345470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 848 | Open in IMG/M |
| 3300007258|Ga0099793_10368255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 704 | Open in IMG/M |
| 3300007265|Ga0099794_10423834 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 696 | Open in IMG/M |
| 3300009038|Ga0099829_11202435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
| 3300009088|Ga0099830_10119203 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
| 3300009088|Ga0099830_10494933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
| 3300009089|Ga0099828_10309308 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300009089|Ga0099828_11734630 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300009137|Ga0066709_103804261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300009143|Ga0099792_10624942 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 689 | Open in IMG/M |
| 3300009176|Ga0105242_11351167 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
| 3300009444|Ga0114945_10044848 | All Organisms → cellular organisms → Bacteria | 2397 | Open in IMG/M |
| 3300009662|Ga0105856_1099971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
| 3300009801|Ga0105056_1012282 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300009807|Ga0105061_1009067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1225 | Open in IMG/M |
| 3300010047|Ga0126382_11572576 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 608 | Open in IMG/M |
| 3300010303|Ga0134082_10213537 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 792 | Open in IMG/M |
| 3300010322|Ga0134084_10109410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 891 | Open in IMG/M |
| 3300010333|Ga0134080_10087886 | Not Available | 1266 | Open in IMG/M |
| 3300010335|Ga0134063_10460469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300010339|Ga0074046_10611133 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010358|Ga0126370_10690331 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 895 | Open in IMG/M |
| 3300010362|Ga0126377_11695999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300010366|Ga0126379_12537336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300010376|Ga0126381_102175869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
| 3300010379|Ga0136449_103336034 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300010397|Ga0134124_12308389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 579 | Open in IMG/M |
| 3300010398|Ga0126383_10098152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2610 | Open in IMG/M |
| 3300010400|Ga0134122_12319991 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010400|Ga0134122_12822993 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 539 | Open in IMG/M |
| 3300010880|Ga0126350_11668925 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 992 | Open in IMG/M |
| 3300011119|Ga0105246_11018886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 751 | Open in IMG/M |
| 3300011406|Ga0137454_1019035 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012171|Ga0137342_1084324 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 671 | Open in IMG/M |
| 3300012199|Ga0137383_10522823 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300012202|Ga0137363_10481446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1041 | Open in IMG/M |
| 3300012202|Ga0137363_10552184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 970 | Open in IMG/M |
| 3300012202|Ga0137363_10622578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300012203|Ga0137399_10394336 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300012204|Ga0137374_11171170 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
| 3300012207|Ga0137381_10981032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 729 | Open in IMG/M |
| 3300012208|Ga0137376_10991388 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 720 | Open in IMG/M |
| 3300012210|Ga0137378_11468180 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300012210|Ga0137378_11522596 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012350|Ga0137372_10717765 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012351|Ga0137386_10150473 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300012351|Ga0137386_10390726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
| 3300012357|Ga0137384_10703157 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 821 | Open in IMG/M |
| 3300012685|Ga0137397_10138884 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300012918|Ga0137396_10363674 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300012922|Ga0137394_10084171 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300012922|Ga0137394_10357238 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300012925|Ga0137419_10931433 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 717 | Open in IMG/M |
| 3300012929|Ga0137404_10145952 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300012930|Ga0137407_10401775 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1269 | Open in IMG/M |
| 3300012930|Ga0137407_11891699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 569 | Open in IMG/M |
| 3300012944|Ga0137410_10853506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 768 | Open in IMG/M |
| 3300012944|Ga0137410_12087585 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012948|Ga0126375_11195989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300012975|Ga0134110_10553152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
| 3300012976|Ga0134076_10592479 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012977|Ga0134087_10389610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300013297|Ga0157378_12410188 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300014157|Ga0134078_10041805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1552 | Open in IMG/M |
| 3300014324|Ga0075352_1011938 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1684 | Open in IMG/M |
| 3300014658|Ga0181519_10955491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300014877|Ga0180074_1037390 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1002 | Open in IMG/M |
| 3300014881|Ga0180094_1137295 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300014885|Ga0180063_1161928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 710 | Open in IMG/M |
| 3300015264|Ga0137403_10340147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1389 | Open in IMG/M |
| 3300015371|Ga0132258_10574922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2827 | Open in IMG/M |
| 3300015371|Ga0132258_13641280 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1053 | Open in IMG/M |
| 3300016270|Ga0182036_10240032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1351 | Open in IMG/M |
| 3300016319|Ga0182033_12141589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300016357|Ga0182032_10452881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1047 | Open in IMG/M |
| 3300016371|Ga0182034_10182469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1608 | Open in IMG/M |
| 3300018007|Ga0187805_10406653 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300018031|Ga0184634_10051613 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300018053|Ga0184626_10008130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4062 | Open in IMG/M |
| 3300018059|Ga0184615_10602441 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300018066|Ga0184617_1080280 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 883 | Open in IMG/M |
| 3300018070|Ga0184631_10286172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 684 | Open in IMG/M |
| 3300018076|Ga0184609_10295435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 758 | Open in IMG/M |
| 3300018085|Ga0187772_10847479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300018422|Ga0190265_10259934 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300018431|Ga0066655_10214646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1201 | Open in IMG/M |
| 3300018433|Ga0066667_11232739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 652 | Open in IMG/M |
| 3300018468|Ga0066662_10208948 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300018468|Ga0066662_10282111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1382 | Open in IMG/M |
| 3300019883|Ga0193725_1020186 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1825 | Open in IMG/M |
| 3300020004|Ga0193755_1220318 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300020580|Ga0210403_10877754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 709 | Open in IMG/M |
| 3300021073|Ga0210378_10025746 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
| 3300021178|Ga0210408_10388149 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1112 | Open in IMG/M |
| 3300021181|Ga0210388_10390958 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300021344|Ga0193719_10371174 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 593 | Open in IMG/M |
| 3300021363|Ga0193699_10471594 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 515 | Open in IMG/M |
| 3300021401|Ga0210393_10033981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3987 | Open in IMG/M |
| 3300021406|Ga0210386_10134146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2059 | Open in IMG/M |
| 3300021476|Ga0187846_10166596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 929 | Open in IMG/M |
| 3300021560|Ga0126371_13216606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300022534|Ga0224452_1113173 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 832 | Open in IMG/M |
| 3300025893|Ga0207682_10377781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 669 | Open in IMG/M |
| 3300025900|Ga0207710_10110317 | Not Available | 1306 | Open in IMG/M |
| 3300025910|Ga0207684_10250055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1530 | Open in IMG/M |
| 3300025910|Ga0207684_11437434 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300025916|Ga0207663_10921734 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 699 | Open in IMG/M |
| 3300025922|Ga0207646_11668287 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
| 3300025931|Ga0207644_11687438 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300025935|Ga0207709_10939151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 704 | Open in IMG/M |
| 3300025938|Ga0207704_10389256 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300025942|Ga0207689_10163607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1833 | Open in IMG/M |
| 3300025981|Ga0207640_11274042 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
| 3300026089|Ga0207648_10177118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1886 | Open in IMG/M |
| 3300026310|Ga0209239_1094287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
| 3300026320|Ga0209131_1006260 | All Organisms → cellular organisms → Bacteria | 7634 | Open in IMG/M |
| 3300026330|Ga0209473_1189956 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 787 | Open in IMG/M |
| 3300026331|Ga0209267_1238314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300026358|Ga0257166_1024376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300026469|Ga0257169_1086408 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026489|Ga0257160_1100543 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300026496|Ga0257157_1001516 | All Organisms → cellular organisms → Bacteria | 3176 | Open in IMG/M |
| 3300026497|Ga0257164_1054499 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 646 | Open in IMG/M |
| 3300026557|Ga0179587_10473809 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 820 | Open in IMG/M |
| 3300027646|Ga0209466_1110630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300027684|Ga0209626_1140647 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300027738|Ga0208989_10093177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1027 | Open in IMG/M |
| 3300027812|Ga0209656_10549109 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027862|Ga0209701_10239696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1065 | Open in IMG/M |
| 3300027874|Ga0209465_10242203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300027874|Ga0209465_10366173 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 722 | Open in IMG/M |
| 3300027875|Ga0209283_10220806 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300027886|Ga0209486_11321964 | Not Available | 500 | Open in IMG/M |
| 3300027894|Ga0209068_10180519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1154 | Open in IMG/M |
| 3300027909|Ga0209382_11475172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300027954|Ga0209859_1009763 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300027961|Ga0209853_1177973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300028536|Ga0137415_10120597 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2468 | Open in IMG/M |
| 3300028809|Ga0247824_10073268 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1780 | Open in IMG/M |
| 3300028884|Ga0307308_10653023 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300029636|Ga0222749_10479530 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 670 | Open in IMG/M |
| 3300031229|Ga0299913_11120007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 749 | Open in IMG/M |
| 3300031231|Ga0170824_107332689 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
| 3300031234|Ga0302325_13068026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300031469|Ga0170819_10144855 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
| 3300031474|Ga0170818_109086855 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031538|Ga0310888_10342833 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300031548|Ga0307408_100998829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 771 | Open in IMG/M |
| 3300031572|Ga0318515_10771418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300031573|Ga0310915_10151251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1604 | Open in IMG/M |
| 3300031573|Ga0310915_10948830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300031708|Ga0310686_105748905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2631 | Open in IMG/M |
| 3300031720|Ga0307469_11244582 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
| 3300031720|Ga0307469_11486877 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
| 3300031724|Ga0318500_10078959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1461 | Open in IMG/M |
| 3300031740|Ga0307468_100618429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 888 | Open in IMG/M |
| 3300031747|Ga0318502_10382163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300031764|Ga0318535_10565530 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300031770|Ga0318521_10349044 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300031793|Ga0318548_10335662 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031819|Ga0318568_10023821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3351 | Open in IMG/M |
| 3300031820|Ga0307473_11327219 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300031879|Ga0306919_10025532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3648 | Open in IMG/M |
| 3300031912|Ga0306921_10342534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum thiophilum | 1748 | Open in IMG/M |
| 3300031941|Ga0310912_11093113 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031946|Ga0310910_10062474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2662 | Open in IMG/M |
| 3300031946|Ga0310910_10803074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300031947|Ga0310909_11527316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300031959|Ga0318530_10432251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300032005|Ga0307411_10702310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
| 3300032005|Ga0307411_11313027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 659 | Open in IMG/M |
| 3300032010|Ga0318569_10368202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300032041|Ga0318549_10221788 | Not Available | 850 | Open in IMG/M |
| 3300032041|Ga0318549_10536005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300032042|Ga0318545_10146989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300032055|Ga0318575_10728801 | Not Available | 501 | Open in IMG/M |
| 3300032060|Ga0318505_10523598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300032066|Ga0318514_10708731 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300032094|Ga0318540_10314950 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300032122|Ga0310895_10390332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300032179|Ga0310889_10637889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 552 | Open in IMG/M |
| 3300032180|Ga0307471_100380742 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300032180|Ga0307471_101090029 | Not Available | 965 | Open in IMG/M |
| 3300032180|Ga0307471_101418264 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300032180|Ga0307471_101745039 | Not Available | 775 | Open in IMG/M |
| 3300032180|Ga0307471_103843992 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300032205|Ga0307472_100951157 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 800 | Open in IMG/M |
| 3300032205|Ga0307472_102492694 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 526 | Open in IMG/M |
| 3300032261|Ga0306920_102453036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300033289|Ga0310914_11829475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300033814|Ga0364930_0071354 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300034150|Ga0364933_062279 | Not Available | 927 | Open in IMG/M |
| 3300034176|Ga0364931_0030922 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.02% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.59% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.16% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.72% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.29% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.29% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.29% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.43% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.43% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.43% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.43% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.43% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.43% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.43% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.43% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.43% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.43% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002530 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_09892000 | 2170459005 | Grass Soil | LTLAHGTDRLESARLVLRRVAPDDLPFFTRIHALPEVAQHLYPGGRPRSPE |
| JGI10216J12902_1111306641 | 3300000956 | Soil | MTLAHGTDRLESARLVLRRITPEDLPFFARIHALPEVAEHLYP |
| C687J35503_101028472 | 3300002530 | Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRVHALPEVAQYLYPGG |
| Ga0062389_1034313551 | 3300004092 | Bog Forest Soil | MTLAHGTNRLESSRLLLRRIARDDLPFFTRLHALPEVARFLYPEGPRSPERTA |
| Ga0062591_1010091511 | 3300004643 | Soil | MTLAHGTARLESARLVLRRVAPDDQPFFTRIHALPEGAENLYPGGRPRSSEET |
| Ga0066672_100153346 | 3300005167 | Soil | LTLAYGTDWLESDRLVLRRVTPDDLPFYTRLHALPKVAEHL |
| Ga0066683_108397342 | 3300005172 | Soil | MTLAHGTDRLESARLLLRRIAPDDLPFFTRIHALPEVAQHLYP |
| Ga0066679_105840862 | 3300005176 | Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQHLYPGGRPR |
| Ga0066679_109394981 | 3300005176 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRIHALPEVAQHLYPGGRPRSPEETAAW |
| Ga0066684_105320691 | 3300005179 | Soil | MTLPHGTDRLESERLVLRRIAPDDLPFFTRIHALPDVARHLYPGGRPRSPEETAAW |
| Ga0070690_1007303221 | 3300005330 | Switchgrass Rhizosphere | MTLTHGTDRLESDRLVLRRVVPDDLPFYIHLHANPQVAEHLYPQGRPRSP |
| Ga0070692_104690612 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAHGTARLESARLVLRRVAPDDQPFFTRIHALPEGAENLYPG |
| Ga0070671_1019379461 | 3300005355 | Switchgrass Rhizosphere | MTLAHGTDRLESDRLVLRRVTPDDLPFYTRLHALPKVAEHLYPE |
| Ga0070709_110096041 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAHGTDRLESDRLVLRRVTPDDLPFYTRLHALPKVAEHLYPEGRPRSPEETKAWM |
| Ga0070708_1001001115 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQHLYPGGRPRS |
| Ga0070662_1000104691 | 3300005457 | Corn Rhizosphere | MTLAHGTARLESARLVLRRVAPDDQPFFTRIHALPEGAENLYPGGRPRSSEETAAWLA |
| Ga0070706_1010184841 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAYGTDRLESARLVLRRIAPDDLPFFTRLHALPEVAQH |
| Ga0070698_1000379591 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQHLYPGGRPRSPEETAAW |
| Ga0070698_1008336993 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLARGTDRLESARLVLRRVAPDDLPFFTRIHALPEVAQHLYPG |
| Ga0070698_1022281522 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LTLAHGTDRLESYRLVLRRVTPDDLPFYTRLHALPKVAEHLYPEGRPRSPEETKA |
| Ga0066697_100867344 | 3300005540 | Soil | LTLAHGTDRLESDRLVLRRVTPDDLPFYTRLHALP |
| Ga0070696_1009583961 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAHGTDRLESARLVLRRIVPGDLPFYTRLHALPEVARHLYPGGRPRSPEETAR |
| Ga0066704_103358921 | 3300005557 | Soil | VTLPHGTDQLESARLVLRRIAPDDLPFFTRIHALPEVAQ |
| Ga0066704_103528453 | 3300005557 | Soil | MTLPHGTDRLESARLVLRRMTPDDLPFYTRIHALPEVAR |
| Ga0066708_107158801 | 3300005576 | Soil | MTLARGTDRLESARLVLRRVAPDDLPFFTRIHALPEVAEHLY |
| Ga0068864_1009657962 | 3300005618 | Switchgrass Rhizosphere | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHGLPEVARHLQRQGSARVVEVDP* |
| Ga0066905_1017723761 | 3300005713 | Tropical Forest Soil | VTLVHRTDRRESTRLVLRRVGPDDLPCYTRLHALPNVAEHRYPEG |
| Ga0068861_1027144731 | 3300005719 | Switchgrass Rhizosphere | MTLAHGTDRLESARLLLRRIVPGDLPFFTRLHALPEVAQHLYPGGRP |
| Ga0066903_1086772202 | 3300005764 | Tropical Forest Soil | MTLAHGTEGLESARLLLRRVTPDDLSFFTRLHALPAVAEHLYPGGRPRSPE |
| Ga0075023_1000684751 | 3300006041 | Watersheds | MTLAHGTDHLESARLVLRRVAPVDLPFFTRIHALPEVARHL |
| Ga0070716_1017710211 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAHGTDCLESARLVLRRVVPDDLPFFTRIHSLPEV |
| Ga0070712_1019888681 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLAHGTDQLESDRLVLRRVGPGDLPFFARIHGLPDVARY |
| Ga0070765_1018784283 | 3300006176 | Soil | MTLAHGTEQLETARLLLRRIAPDDLPFFTRIHALPEV |
| Ga0075021_102336681 | 3300006354 | Watersheds | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQ |
| Ga0075421_1016460161 | 3300006845 | Populus Rhizosphere | MTLARATDRIQSPRLMLRRIAPDDLPFFTRIHAIADVVRYTGHGRP |
| Ga0075421_1018373572 | 3300006845 | Populus Rhizosphere | MTLAHGTDRLESARLTLRRITPGDLPFFTRIHALP |
| Ga0075425_1018001033 | 3300006854 | Populus Rhizosphere | MTLAHGTDRLESARLVLRRVTSDDLPFFTRLHALPDVAQLL |
| Ga0079217_113948711 | 3300006876 | Agricultural Soil | MTLAHGTDRLESARLALRRIAPDDLPFFTRIHALPEVAQHLYPGGRPQL |
| Ga0075429_1008264163 | 3300006880 | Populus Rhizosphere | MTLMRGTDRLESARLVLRRVAPDDLPFFTRIHALPEVAQHLYPGG |
| Ga0079215_103454702 | 3300006894 | Agricultural Soil | MTLAHGTDRLESARLVLRRVVPGDLPFFTRSPKSPNFSIREAGRARPKRRPHGCST |
| Ga0099793_103682551 | 3300007258 | Vadose Zone Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRLHALPEVAQHL |
| Ga0099794_104238341 | 3300007265 | Vadose Zone Soil | MTLAHGTDRLESARLVLRQIAPDDLPFFTRIHALPEVAQHLYPGGRP |
| Ga0099829_112024351 | 3300009038 | Vadose Zone Soil | MTLTHGTDRLESDRLVLRRVVPDDLLFYTHLHANPQVAEHLYPQGR |
| Ga0099830_101192034 | 3300009088 | Vadose Zone Soil | MTLPHGTDRLESARLVLRRIAPDDLPFFARIHALPEVAQHLYPGGRPRSPEE |
| Ga0099830_104949332 | 3300009088 | Vadose Zone Soil | MTLAHGTDQLESDRLVLRRVGRGDLPFFARIHGLPEVA |
| Ga0099828_103093081 | 3300009089 | Vadose Zone Soil | MTLPHGTDQLESARLVLRRIAPDDLPFFTRIHALPEVA |
| Ga0099828_117346301 | 3300009089 | Vadose Zone Soil | MTLPRGTDRLESARLVLRRLAPDDLPFFTRIHALPEVAQYLWGQGRPRSPEETA |
| Ga0066709_1038042611 | 3300009137 | Grasslands Soil | MTLAHSTDRLESARLVLRRIGPDDLPFFTRIHALPEVAQYL |
| Ga0099792_106249422 | 3300009143 | Vadose Zone Soil | MTLPHGIDRLESPRLVLRRIAPDDLPFFARIHALPEVAQYLYAGG |
| Ga0105242_113511672 | 3300009176 | Miscanthus Rhizosphere | MTLAHGTDRLESDRLVLRRVTPDDLPFYTRLHALPKVAEQLYPEG |
| Ga0114945_100448486 | 3300009444 | Thermal Springs | MTLPHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVA |
| Ga0105856_10999712 | 3300009662 | Permafrost Soil | MTLARGTDRLESDRLVLRRIALDDLPFFARLHASPEVARHLYPGG |
| Ga0105056_10122821 | 3300009801 | Groundwater Sand | MTLAHGTDRLESDRLVLRRVTPDDLPFYTRLHALPNVADHLYPEGRPRSP |
| Ga0105061_10090674 | 3300009807 | Groundwater Sand | MTLAHGTDRLESARLVLRRITADDLPFYTRLHALPEVAQHLYAEGRPRTPE |
| Ga0126382_115725762 | 3300010047 | Tropical Forest Soil | VTLAHGIDRLESARLVLRRITPDDLPFFARLHALPEVARHLYPGG |
| Ga0134082_102135373 | 3300010303 | Grasslands Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRLHALPKVAEHLYREGRPRSP |
| Ga0134084_101094101 | 3300010322 | Grasslands Soil | MTLAHGTDRLESDRLVLRRVTSDDLPFFTRLHALPDVAQLLYP |
| Ga0134080_100878863 | 3300010333 | Grasslands Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQHLYPGGRPRAP |
| Ga0134063_104604691 | 3300010335 | Grasslands Soil | MTLARSTDRLESARLVLRRVEPDDLPFFTRIHALPEVAQYLWTRPRSPEETAA |
| Ga0074046_106111332 | 3300010339 | Bog Forest Soil | MTLACGTERLESARLVLRRIAPDDLPFFTRIHALPEVAQ* |
| Ga0126370_106903311 | 3300010358 | Tropical Forest Soil | MTLAHGTDRLESARLVLRRIGPDDLPFFTRLHARSDVAKHLYPGGRP |
| Ga0126377_116959993 | 3300010362 | Tropical Forest Soil | MTLAHGTDRLESERLVLRRITPDDLPFYTRLHALPEVAEHLYPEGR |
| Ga0126379_125373361 | 3300010366 | Tropical Forest Soil | VTLARGTDRLESARLVLRRVTPDDLPFFTRIHSLPAVAQHLYPD |
| Ga0126381_1021758692 | 3300010376 | Tropical Forest Soil | MTLAHGTDRLESARLVLRRVAPEDLAFFARLHALPEVAQHLYPSGRPRSP |
| Ga0136449_1033360342 | 3300010379 | Peatlands Soil | MTLAHGTDRVESARLVLRRIAPDDLPFFTRIHALPEVTQYLYPGGRTRS |
| Ga0134124_123083892 | 3300010397 | Terrestrial Soil | MTLAHGTDRLESARNVLRRIALDDLPFFTRIHALP |
| Ga0126383_100981525 | 3300010398 | Tropical Forest Soil | MTLARGTDRLESARLVLRRVAWDDLPFFTRLHALPEVAQHLY |
| Ga0134122_123199912 | 3300010400 | Terrestrial Soil | MTLAHGTDRLESARLALRRIAPDDLPFFTRIHALPEVVQYLGQG |
| Ga0134122_128229932 | 3300010400 | Terrestrial Soil | MTLAHGTDRLESARLVLRRVAPGDLPFFTRLHALPEVARHLYPGGRPRSPE |
| Ga0126350_116689252 | 3300010880 | Boreal Forest Soil | MTLAHGTDRLESARLVLRRIAPDDQPFFTRIHALPEVAQYLYPEGRPRSPE |
| Ga0105246_110188861 | 3300011119 | Miscanthus Rhizosphere | MTLTHGTDRLESDRLVLRRVVPDDLPFYIHLHANPQVAEHLYPQGRPRSPE |
| Ga0137454_10190351 | 3300011406 | Soil | MTLPHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQHL |
| Ga0137342_10843242 | 3300012171 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFLTRLHALPDVA |
| Ga0137383_105228232 | 3300012199 | Vadose Zone Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHALPEVAQHLYPGGRPR |
| Ga0137363_104814462 | 3300012202 | Vadose Zone Soil | MTLAHSTDRLESARLVLRRVGPDDLPFFTRIHALPEVAQYLWTRPRSPE |
| Ga0137363_105521842 | 3300012202 | Vadose Zone Soil | VTLPHGTDRLESARLVLRRITPDDLPFYTRLHALPEVARHLYFGGRPRTPEE |
| Ga0137363_106225781 | 3300012202 | Vadose Zone Soil | MTLAHGTDQLESDRLVLRRVGPGDLPFFARIHGLPEV |
| Ga0137399_103943363 | 3300012203 | Vadose Zone Soil | AHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQYL* |
| Ga0137374_111711701 | 3300012204 | Vadose Zone Soil | VTLAHGTDRLESARLVLRRITPDDLPFFTRLHALPEVAQHLYPGG |
| Ga0137381_109810321 | 3300012207 | Vadose Zone Soil | VTLAHGTDRLESALLVLRRIAPDDLPFFTRLHALPEVAQHLYPGGRPRTPEESAA |
| Ga0137376_109913881 | 3300012208 | Vadose Zone Soil | LTLAYGTDWLESDRLVLRRVTPDDLPFYTRLHALPKVAEHLCPEGRPRSPEETKAWM |
| Ga0137378_114681802 | 3300012210 | Vadose Zone Soil | MKEFFKMTLAHGTDRLESDRLVLRRITPDDLPFFARIHALPEVTQYLYPGGRPRSP |
| Ga0137378_115225962 | 3300012210 | Vadose Zone Soil | MTLAHGTDRLESDRLVLRRITPDDLPFFARIHALPEVTQYLYPGGRPRSP |
| Ga0137372_107177652 | 3300012350 | Vadose Zone Soil | MTLAHRTDRLESARLVLRRIAPDDLPFFIRIHALPEVAEHLYP |
| Ga0137386_101504731 | 3300012351 | Vadose Zone Soil | VTLPHGTVRLESARLVLRRITPDDLPFYTRLHALPEVARH |
| Ga0137386_103907261 | 3300012351 | Vadose Zone Soil | MTLAYGTDRLESDRLVLRRATPDDLPFFTRLHALPEVAELLYPGGRPRSP |
| Ga0137384_107031571 | 3300012357 | Vadose Zone Soil | MTLAYGTDRLESDRLVLRRVTPDDLPFFTRLHALPEVAELLYPGG |
| Ga0137397_101388842 | 3300012685 | Vadose Zone Soil | MTLTHGTDRLESPRLVLRRIVPDDLPFFARIHALPEVAQHLYPGGRPRSPEAG* |
| Ga0137396_103636742 | 3300012918 | Vadose Zone Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQYL* |
| Ga0137394_100841714 | 3300012922 | Vadose Zone Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRIHALPEVAHHLYPGG |
| Ga0137394_103572384 | 3300012922 | Vadose Zone Soil | MTLAHGTDRLESARLVLRRIGPGDLPFFTRIHALPEVAQHLYPRGRPRSPEAG* |
| Ga0137419_109314332 | 3300012925 | Vadose Zone Soil | MTLAHGAERLESDRLVLRRVTPDDRPFYTRLHALPKVAE |
| Ga0137404_101459521 | 3300012929 | Vadose Zone Soil | MTLAHGTDRLESARLVLRRIAPDDLPFYTRLHALPEVARLLYPGGRP |
| Ga0137407_104017751 | 3300012930 | Vadose Zone Soil | MTLPHGTDRLESERLVLRRIAPDDLPFFTRIHALPDVARHLY |
| Ga0137407_118916993 | 3300012930 | Vadose Zone Soil | MTLAHGTDRLESTRLVLRRVAPDDLPFFTRIHALPEV |
| Ga0137410_108535063 | 3300012944 | Vadose Zone Soil | MTLARGTDRLESARLVLRRIAPDDLPFFTRLHALPEVAQHLYPG |
| Ga0137410_120875852 | 3300012944 | Vadose Zone Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQHLYPGGRPRSPEETA |
| Ga0126375_111959892 | 3300012948 | Tropical Forest Soil | MTLAHGTDCLESARLVLRRVAPDDLPFFTRIHALPE |
| Ga0134110_105531522 | 3300012975 | Grasslands Soil | MHGTDRLESDRLVLRRVTPDDLPFFTRLHALPEVAELLYPGGRPRSPEETAA |
| Ga0134076_105924791 | 3300012976 | Grasslands Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQYLYPGG |
| Ga0134087_103896102 | 3300012977 | Grasslands Soil | MTLARSTDRLESARLVLRRIGPDDLPFFTRIHALPEVAQYLWTRPRSPEETA |
| Ga0157378_124101881 | 3300013297 | Miscanthus Rhizosphere | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALLQVAEHLYPEGRPRSPEETAG* |
| Ga0134078_100418054 | 3300014157 | Grasslands Soil | VTLPHGTDRLESARLVLRRITPDDLPFYTRLHALPEVARHLYF |
| Ga0075352_10119381 | 3300014324 | Natural And Restored Wetlands | MRRREGVFTMTLAHGTARLESARLVLRRIAPDDLSFFTRIHALPEVAQHLYPGGRPRSP |
| Ga0181519_109554912 | 3300014658 | Bog | MTLAHGTEWLESPRLILRRIVPDDLPFFTRIHALPEVALHLWPAGQP |
| Ga0180074_10373901 | 3300014877 | Soil | MTLAHGTDRLESDRLVLRRVAPGDLPFFTRIHALSEVAQHLY |
| Ga0180094_11372952 | 3300014881 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHALPEVALHLYPRGRPRSPE |
| Ga0180063_11619281 | 3300014885 | Soil | MTLAHGTDRLESARLVLRRITPDDLPFFARLHARPEVTQYLYPGGRTRSP |
| Ga0137403_103401471 | 3300015264 | Vadose Zone Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHTLPEVAEHLYPGGRPRSPEETAAW |
| Ga0132258_105749221 | 3300015371 | Arabidopsis Rhizosphere | VTLAHGTDRLESARLVVGRIAPADPPFLPRIDALPE |
| Ga0132258_136412803 | 3300015371 | Arabidopsis Rhizosphere | MTLTHGTDRLESDRLVLRRVVPDDLPFYTYLHANPQVAEHLYPQGRPRSP |
| Ga0182036_102400321 | 3300016270 | Soil | MTLAHGTDRLESARLVLRRVVRDDLPFFTRLHALPEVAQHLYPNGRPRSPEET |
| Ga0182033_121415892 | 3300016319 | Soil | MTLAHGTDRLESERLALRRVARDDLPFFTRLHALPEVAQHLYPNGRP |
| Ga0182032_104528811 | 3300016357 | Soil | MTLAHDTDRLESARLVLRRVARDDLPFFTRLHALPE |
| Ga0182034_101824693 | 3300016371 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHALPEVARHLYPNGRPRLPEEP |
| Ga0187805_104066531 | 3300018007 | Freshwater Sediment | MTLAYGTDRLESARLVLRRMVPEDLPFFTRFHALPEVAQGLYPGGRPRARRNRSPRGCR |
| Ga0184634_100516133 | 3300018031 | Groundwater Sediment | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHALPEVAQHLYPGGRPRSPEE |
| Ga0184626_100081306 | 3300018053 | Groundwater Sediment | MTLAHGTDRLESDRLVLRRVVPDDLPFVTRIHALPQVA |
| Ga0184615_106024411 | 3300018059 | Groundwater Sediment | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQYLYPGGRPRSPE |
| Ga0184617_10802801 | 3300018066 | Groundwater Sediment | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHALPEVAQHLYP |
| Ga0184631_102861722 | 3300018070 | Groundwater Sediment | MTLPHGTDRLESARLVLRRIAPDDLPFFARIHALPEVAQHLYPGGRPRSPE |
| Ga0184609_102954351 | 3300018076 | Groundwater Sediment | MTLAHGTDRLESARLVLRRIAPGDLPFFTRIHALPEVAQNLYSGG |
| Ga0187772_108474792 | 3300018085 | Tropical Peatland | MTLASGTDRLESDRLVLRRITPDDLPFFTRLHASPDVARTLYPEGRGRTPEET |
| Ga0190265_102599341 | 3300018422 | Soil | MTLAHGRDRLESDRLVLRRVTPDDLPFYTRLHAHPKVAQHLYPGGRPRSPEE |
| Ga0066655_102146461 | 3300018431 | Grasslands Soil | MTLAHGTDRLESARLVLRGIAPDDLPFFTRIHALPEVAQHLY |
| Ga0066667_112327392 | 3300018433 | Grasslands Soil | LTLAYGTDWLESDRLVLRRVTPDDLPFYTRLHALPNVAGPLYPEGRPASTEEQETWV |
| Ga0066662_102089482 | 3300018468 | Grasslands Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQYLWEQGRPRCARKTGR |
| Ga0066662_102821113 | 3300018468 | Grasslands Soil | MTLARGTDRLESARLVLRRVAPDDLPFFTRIHALP |
| Ga0193725_10201864 | 3300019883 | Soil | MTLPHGTDRLESARLVLRRIAPDDLPFFARIHALPEVAQHLYPGGRPRSPEETAAW |
| Ga0193755_12203182 | 3300020004 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHALPEVAQHLYPGGRPRSPEETA |
| Ga0210403_108777541 | 3300020580 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRIHALPQVAQH |
| Ga0210378_100257464 | 3300021073 | Groundwater Sediment | MTLAHGTDRLESDRLVLRRVVPDDLPFFTRIHALPQV |
| Ga0210408_103881491 | 3300021178 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRIHALPEVA |
| Ga0210388_103909582 | 3300021181 | Soil | MTLAHGTDRLESARLVLRRIAPDDQPFFTRIHALPEV |
| Ga0193719_103711742 | 3300021344 | Soil | MTLLHGTDRLESARLVMRRIASDDLPFFTRIHALPDVARHLYPGGRP |
| Ga0193699_104715942 | 3300021363 | Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRLHALPEVARHLYPGGRPRS |
| Ga0210393_100339811 | 3300021401 | Soil | MTLARGTERLESARLVLRRIGPDDLPFFARIHALPEVTQYL |
| Ga0210386_101341463 | 3300021406 | Soil | VTLAHGTDLLESARLVLRRIAPGDLPFFTRIHALP |
| Ga0187846_101665962 | 3300021476 | Biofilm | MTLAHGTDRLESARLALRRVTRDDLPFFTRLHALREVAQHLYPNGR |
| Ga0126371_132166061 | 3300021560 | Tropical Forest Soil | MTLAHGTDRLESARLVLRRVEPDDLPFFTRLHALPEVAQHLYPGDRPRSPEETAAWL |
| Ga0224452_11131732 | 3300022534 | Groundwater Sediment | MTLAHGTDRLESDRLVLRRVVPDDLPFFTRIHALPQVAEHLYPQGRPRSSEE |
| Ga0207682_103777812 | 3300025893 | Miscanthus Rhizosphere | MTLARATDRIESTRLVLRRITPSDLPFFTRIHSVADV |
| Ga0207710_101103173 | 3300025900 | Switchgrass Rhizosphere | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHGLPEVARHLQRQGSARVVEVDP |
| Ga0207684_102500554 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAHGTDRLESDRLVLRRVTPDDLPFYTRLHALPKVAEHLYPEGRPRSPEETKAW |
| Ga0207684_114374342 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAHGTDRLESARLVLRRVASDDLPFFTRIHALPEVAHHL |
| Ga0207663_109217342 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAHGTDRLESARLVLRRVVPDDLPFFTRIHALPEVAQHL |
| Ga0207646_116682871 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLAHGTDRLESARLVLRRIAPVDLPFFTRIHALPEVAQNLHPAGRP |
| Ga0207644_116874381 | 3300025931 | Switchgrass Rhizosphere | MTLAHGTDRLESDRLVLRRVTPDDLPFYTRLHALPKVAEHLYPEG |
| Ga0207709_109391511 | 3300025935 | Miscanthus Rhizosphere | MTLARATDRIESTRLVLRRITPSDLPFFTRIHSVADVVRYTG |
| Ga0207704_103892561 | 3300025938 | Miscanthus Rhizosphere | MTLTHGTDRLESDRLVLRRVVPDDLPFYIHLHANPQVAEHLYPQ |
| Ga0207689_101636071 | 3300025942 | Miscanthus Rhizosphere | MTLARATDSIESARLVLRRIAPGDLPFFTRIHSVADV |
| Ga0207640_112740421 | 3300025981 | Corn Rhizosphere | MTLTHGTDRLESDRLVLRRVVPDDLPFYIHLHANPQVAEHLYPQGRPRSPEETKA |
| Ga0207648_101771181 | 3300026089 | Miscanthus Rhizosphere | MTLAHGTDRLESARLVLRRIVPGDLPFYTRLHALPEVARHLYPGGRPRSPEE |
| Ga0209239_10942871 | 3300026310 | Grasslands Soil | MTLAHGTDRLESPRLVLRRIAPDDLPFFTRLHALP |
| Ga0209131_10062601 | 3300026320 | Grasslands Soil | MTLAHGTDRLESARLVLRRIAPADLPFFTHIHALPEVARHLYPGGRPRS |
| Ga0209473_11899562 | 3300026330 | Soil | MTLAHGTDRLESARLVLRRVVPDDLPFFTRIHALPEVAEHLYPEGRPRTPEETATWL |
| Ga0209267_12383141 | 3300026331 | Soil | MTLAHGTDRLESARLVLRRVAPHDLPFFTRIHALPEVAQYLWVRPRSPEE |
| Ga0257166_10243763 | 3300026358 | Soil | MTLPHGTDRLESARLVLRRIAPDDLPFFARIHALPEVARHLY |
| Ga0257169_10864082 | 3300026469 | Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALP |
| Ga0257160_11005431 | 3300026489 | Soil | MTLAHGTDRLESARLVLRRVAPGDLPFFTRLHALPEVAEHLYPGGRPRS |
| Ga0257157_10015165 | 3300026496 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRIHALPEVAQHLY |
| Ga0257164_10544992 | 3300026497 | Soil | MTLPHGTDRLESARLVLRRIAPDDLPFFARIHALPEVAQHLYPG |
| Ga0179587_104738091 | 3300026557 | Vadose Zone Soil | MTLAHGADRLESARLVLRRITPDHLPFFTRIHALPEVAQH |
| Ga0209466_11106302 | 3300027646 | Tropical Forest Soil | VTLAHGTDRLESDRLVLRRVTPDDLPFCTRLHAHPKVAEHLYPEG |
| Ga0209626_11406472 | 3300027684 | Forest Soil | LTLAHGTDRLESPRLVLRRVVPDDLPFFTRIHALPQVAQHLYPAAGRARPKRRPAHCAR |
| Ga0208989_100931771 | 3300027738 | Forest Soil | MTLAHGADRLESARLVLRRIGPDDLPFFTRIHALPEVAQHLYPGGRPRSPDET |
| Ga0209656_105491093 | 3300027812 | Bog Forest Soil | VTLARGTDRLESARLVLRRIAPEDLPFFTRIHALP |
| Ga0209701_102396963 | 3300027862 | Vadose Zone Soil | MTLPHGTDRLESARLVLRRIAPDDLPFFARIHALPEVAQHLYPGGRPRSPEATAA |
| Ga0209465_102422031 | 3300027874 | Tropical Forest Soil | VTLAHGTDRLESDGLVLRRVTPDDLPFYTRLHAHPKVAEHLYPEGRPRSPEETKAWIE |
| Ga0209465_103661731 | 3300027874 | Tropical Forest Soil | MTLAHGTDRLESARLVLRRVAPDDLAFFTRLHALPEVAQHLYPNGRPRLPEE |
| Ga0209283_102208064 | 3300027875 | Vadose Zone Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFARIHALPKVAQYLY |
| Ga0209486_113219641 | 3300027886 | Agricultural Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRVHALPEVAQYLYPGGVP |
| Ga0209068_101805192 | 3300027894 | Watersheds | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQYHYPG |
| Ga0209382_114751721 | 3300027909 | Populus Rhizosphere | MTLAHGTDRLESARLVLRRIVPGDLPFFTRLHALPE |
| Ga0209859_10097634 | 3300027954 | Groundwater Sand | MTLAHGTDRLESARLVLRRIAPDDLPFFTRSHALPEVAQYLYPGG |
| Ga0209853_11779732 | 3300027961 | Groundwater Sand | MTLAHGTDRLESARLVLRRITPDDLPFFARLHALPEVTQYLYP |
| Ga0137415_101205975 | 3300028536 | Vadose Zone Soil | MTLAHGTDRLESTRLVLRRVAPDDLPFFTRIHALPEVAQHLYPGGRPR |
| Ga0247824_100732681 | 3300028809 | Soil | MTLAHGTDRLESARLVLRRIVPGDLPFFTRLHALPEVAQHLYPGGRP |
| Ga0307308_106530231 | 3300028884 | Soil | MARAHGTARRESARPVLPRVAPDDLPFFTPIHALPEVAQNLYPGGRPRSPE |
| Ga0222749_104795301 | 3300029636 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRIHALPQVAQHLYPDGRPRSPEET |
| Ga0299913_111200071 | 3300031229 | Soil | VTLARGTERLESARLVLRRVVPDDLPFFTRIHALPAVAQHLYPGGRPRSPEETAT |
| Ga0170824_1073326891 | 3300031231 | Forest Soil | MTLTHGTDRLESDRLVLRRVVPDDLPFYTYLHANPQVAEHLYP |
| Ga0302325_130680261 | 3300031234 | Palsa | MTLAHGTDRLESARLVLRRIAPDDLPFFTRLHALPEVAQ |
| Ga0170819_101448551 | 3300031469 | Forest Soil | MTLTHGTDRLESDRLVLRRVVPDDLPFYTYLHANPQVAEH |
| Ga0170818_1090868551 | 3300031474 | Forest Soil | MTLAHGTDRLESARLVLQRITPDDLPFFTRLHAHLQVAQHLYPGG |
| Ga0310888_103428333 | 3300031538 | Soil | MTLARATDRIESTRLVLRRITPSDLPFFTRIHSVADVVRYTGH |
| Ga0307408_1009988291 | 3300031548 | Rhizosphere | MTLARATDRIESARLILRRITPSDLPFFTRIHSVADVVRYTGHG |
| Ga0318515_107714181 | 3300031572 | Soil | MTLAHGTDQLESARLVLRRVAQDDLPFFTRLHALPEVTQHLY |
| Ga0310915_101512511 | 3300031573 | Soil | MTLAHGTDRLESARLVLRRLAPDDLPFFTRLHALPEVAQHLYPSGRPRSPKETAGW |
| Ga0310915_109488301 | 3300031573 | Soil | VTLAHGSDHLESARLVLRRVSPEDLPFFTRLHALPEV |
| Ga0310686_1057489056 | 3300031708 | Soil | MTLANGTDRLESARLVLRRIVPDDREFFTRLHALREVTQYLYPGGRPRSPEES |
| Ga0307469_112445821 | 3300031720 | Hardwood Forest Soil | MTLARGTDRLESARLVLRRVAPHDLPFFTRILALPEVAQHLYPGGRPRSPE |
| Ga0307469_114868772 | 3300031720 | Hardwood Forest Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQHL |
| Ga0318500_100789593 | 3300031724 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHALSKVAQHLYPNG |
| Ga0307468_1006184291 | 3300031740 | Hardwood Forest Soil | MTLAHGTDRLESARLVLRRVTPDDLPFFTRIHALPE |
| Ga0318502_103821631 | 3300031747 | Soil | MTLAHHTDRLESARLMLRRVAPDDLPFFTRLHALPEVAQHLYPTGRPRSPEET |
| Ga0318535_105655301 | 3300031764 | Soil | MTLAHGTDRLESARLVLRRLAPDDLPFFTRLHALPEVAQHLYPSGRPRSPKETAG |
| Ga0318521_103490441 | 3300031770 | Soil | MTLVRGTEQLESARLVLRRITQDDLPFFTRIHALPKVAQHLYPGGRPRTPQETAAFL |
| Ga0318548_103356621 | 3300031793 | Soil | MTLVRGTEQLESARLVLRRITQDDLPFFTRIHALPKVAQHLYPGGRPRTPQE |
| Ga0318568_100238212 | 3300031819 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHALSKVAQHLYPNGRTRSPEETAA |
| Ga0307473_113272192 | 3300031820 | Hardwood Forest Soil | VTLRHGTDRLESDRLVLRRVALGDLPFFTRLHALPDV |
| Ga0306919_100255326 | 3300031879 | Soil | MTLAHGTDWLESARLVLRRVAPDDLPFFTRLHALSKVAQHLYPNGRPRSP |
| Ga0306921_103425343 | 3300031912 | Soil | MTLVRGTEQLESARLVLRRITQDDLPFFTRIHALPKVAQQ |
| Ga0310912_110931132 | 3300031941 | Soil | MTLVRGTEQLESARLVLRRITQDDLPFFTRIHALPKVAQHL |
| Ga0310910_100624741 | 3300031946 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLPALSKVAQHLY |
| Ga0310910_108030742 | 3300031946 | Soil | MTLAHDTDRLESARLVLRRVARDDLPFFTRLHALPEVAQHLYPNGRPRSPE |
| Ga0310909_115273162 | 3300031947 | Soil | VTLAHGSDHLESARLVLRRVSPEDLPFFTRLHALP |
| Ga0318530_104322511 | 3300031959 | Soil | MTLAHHTDRLESARLMLRRVAPDDLPFFTRLHALPEVAQHLYP |
| Ga0307411_107023103 | 3300032005 | Rhizosphere | MTLARATDRIESARLILRRIAPGDLPFFTRIHAVAD |
| Ga0307411_113130272 | 3300032005 | Rhizosphere | MTLARSTDRIESARLVLRRVTPGDLPFFTRIHSVADVVRYTGNG |
| Ga0318569_103682021 | 3300032010 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHALSKVAQHLYPNGRTR |
| Ga0318549_102217883 | 3300032041 | Soil | MTLVRGTEQLESARLVLRRITQDDLPFFTRIHALPK |
| Ga0318549_105360051 | 3300032041 | Soil | MTLAHGTDRLESARLVLRRVAPDDLPFFTRLHALPEVAR |
| Ga0318545_101469892 | 3300032042 | Soil | MTLAHGTDRLESARLMLRRVAPEDLPFFTRLHALPEVARHLYP |
| Ga0318575_107288011 | 3300032055 | Soil | VTLAHGTDQLESDRLVLRRITLDDLPFFARIHALPE |
| Ga0318505_105235982 | 3300032060 | Soil | MTLAHGTDRLESARLVLRRLAPDDLPFFTRLPALPE |
| Ga0318514_107087311 | 3300032066 | Soil | MTLAHGTDRLESARLVLRRVVRDDLPFFTRLHALPEVAQHLYPNGRPRSPK |
| Ga0318540_103149501 | 3300032094 | Soil | MTLVRGTEQLESARLVLRRITQDDLPFFTRIHALPKVAQHLY |
| Ga0310895_103903321 | 3300032122 | Soil | MTLTHGTDRLESDRLVLRRVVPDDLPFYIHLHANPQVAEHLYPQG |
| Ga0310889_106378891 | 3300032179 | Soil | MTLARTTDRIESARLVLRRITPSDLPFFTRIHSVADVVRYTGHG |
| Ga0307471_1003807426 | 3300032180 | Hardwood Forest Soil | MTLAHGTEQLESLRLVMRRITPDDLPFFTRLHALPEVAQH |
| Ga0307471_1010900292 | 3300032180 | Hardwood Forest Soil | MTLAHGTDRLESDRLVLRRVTPDDLPFYTRLHALPNVAE |
| Ga0307471_1014182643 | 3300032180 | Hardwood Forest Soil | MTLAHGTDRLESARLVLRRVASDDLPFFTRIHALPEVAHHLY |
| Ga0307471_1017450392 | 3300032180 | Hardwood Forest Soil | MTLAHGTDRLESARLVLRRITPGDLPFFTRLHALPEVAQHLYPGGR |
| Ga0307471_1038439923 | 3300032180 | Hardwood Forest Soil | MTLAHGTDRLESARLVLRRVASDDLPFFARIHALPEVAHHLY |
| Ga0307472_1009511573 | 3300032205 | Hardwood Forest Soil | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQHLYPGGRPRSP |
| Ga0307472_1024926941 | 3300032205 | Hardwood Forest Soil | MTLAHGTDRLESDRLVLRRITLDDLPFFTRLHALPEVAR |
| Ga0306920_1024530362 | 3300032261 | Soil | MTLAHGIDRLESARLVLRRVAWDDLPFFTRLHALPEVAQHLYPNGRPRSPEETA |
| Ga0310914_118294751 | 3300033289 | Soil | MTLAHGTDRLESARLVLRRVARDDLPFFTRLHALPEVAQHLYPNGRPRSPEETTAW |
| Ga0364930_0071354_1055_1183 | 3300033814 | Sediment | MTLAHGTDRLESARLVLRRIAPDDLPFFTRIHALPEVAQHLYP |
| Ga0364933_062279_1_135 | 3300034150 | Sediment | MTLAHGTDRLESARLVLRRIAPGDLPFFTRIHALPEVARDLYPQG |
| Ga0364931_0030922_3_140 | 3300034176 | Sediment | MTLAHGTDRLESARLVLRRIAPGDLPFFTRIHALPEVAQHLYPGGR |
| ⦗Top⦘ |