


| Basic Information | |
|---|---|
| Family ID | F018947 |
| Family Type | Metagenome |
| Number of Sequences | 232 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIKKDGED |
| Number of Associated Samples | 189 |
| Number of Associated Scaffolds | 232 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.86 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 90.52 % |
| Associated GOLD sequencing projects | 170 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.948 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (8.190 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.948 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.241 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.12% β-sheet: 0.00% Coil/Unstructured: 80.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 232 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 37.50 |
| PF00892 | EamA | 27.16 |
| PF12704 | MacB_PCD | 3.88 |
| PF04055 | Radical_SAM | 3.45 |
| PF00313 | CSD | 3.02 |
| PF00030 | Crystall | 2.59 |
| PF00528 | BPD_transp_1 | 2.16 |
| PF02687 | FtsX | 1.72 |
| PF06224 | HTH_42 | 0.86 |
| PF04392 | ABC_sub_bind | 0.86 |
| PF03054 | tRNA_Me_trans | 0.86 |
| PF00106 | adh_short | 0.43 |
| PF17137 | DUF5110 | 0.43 |
| PF13536 | EmrE | 0.43 |
| PF02628 | COX15-CtaA | 0.43 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.43 |
| PF13671 | AAA_33 | 0.43 |
| PF08448 | PAS_4 | 0.43 |
| PF00905 | Transpeptidase | 0.43 |
| PF06739 | SBBP | 0.43 |
| PF14113 | Tae4 | 0.43 |
| PF08240 | ADH_N | 0.43 |
| PF00085 | Thioredoxin | 0.43 |
| PF07519 | Tannase | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 232 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 37.50 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.86 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.86 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.95 % |
| Unclassified | root | N/A | 9.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_12839477 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100913294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300003321|soilH1_10087235 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
| 3300003861|Ga0031654_10169345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 621 | Open in IMG/M |
| 3300004082|Ga0062384_100530513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
| 3300004633|Ga0066395_10300711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 877 | Open in IMG/M |
| 3300004778|Ga0062383_10057999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1547 | Open in IMG/M |
| 3300005186|Ga0066676_10716722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 681 | Open in IMG/M |
| 3300005187|Ga0066675_10327312 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005293|Ga0065715_10863734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300005335|Ga0070666_10336619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1078 | Open in IMG/M |
| 3300005338|Ga0068868_100605145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 971 | Open in IMG/M |
| 3300005339|Ga0070660_100362687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1194 | Open in IMG/M |
| 3300005345|Ga0070692_10104512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1557 | Open in IMG/M |
| 3300005347|Ga0070668_100886394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 797 | Open in IMG/M |
| 3300005366|Ga0070659_101399511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300005439|Ga0070711_102032229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300005441|Ga0070700_100714844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 798 | Open in IMG/M |
| 3300005455|Ga0070663_101927929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300005458|Ga0070681_10456306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1190 | Open in IMG/M |
| 3300005459|Ga0068867_100409747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1145 | Open in IMG/M |
| 3300005459|Ga0068867_100525456 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300005539|Ga0068853_101679092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 616 | Open in IMG/M |
| 3300005543|Ga0070672_100920013 | Not Available | 773 | Open in IMG/M |
| 3300005547|Ga0070693_101422308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 540 | Open in IMG/M |
| 3300005577|Ga0068857_100003344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13356 | Open in IMG/M |
| 3300005577|Ga0068857_101012196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300005578|Ga0068854_102221037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
| 3300005586|Ga0066691_10273026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 995 | Open in IMG/M |
| 3300005615|Ga0070702_100970789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300005615|Ga0070702_101060458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300005616|Ga0068852_101435313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 712 | Open in IMG/M |
| 3300005764|Ga0066903_106696487 | Not Available | 599 | Open in IMG/M |
| 3300005764|Ga0066903_106797233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300005764|Ga0066903_108115017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 538 | Open in IMG/M |
| 3300005841|Ga0068863_100651667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300005843|Ga0068860_102019035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300005844|Ga0068862_101510301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 677 | Open in IMG/M |
| 3300006224|Ga0079037_100824480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 912 | Open in IMG/M |
| 3300006224|Ga0079037_100923197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 862 | Open in IMG/M |
| 3300006358|Ga0068871_100110613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2310 | Open in IMG/M |
| 3300006358|Ga0068871_101043053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 763 | Open in IMG/M |
| 3300006755|Ga0079222_10004199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4641 | Open in IMG/M |
| 3300006791|Ga0066653_10303305 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300006797|Ga0066659_11825974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300006804|Ga0079221_10006457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4295 | Open in IMG/M |
| 3300006854|Ga0075425_101373703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 800 | Open in IMG/M |
| 3300006854|Ga0075425_101484092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300006871|Ga0075434_102354529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
| 3300006881|Ga0068865_101695774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300006904|Ga0075424_100248895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1889 | Open in IMG/M |
| 3300006904|Ga0075424_101081085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 855 | Open in IMG/M |
| 3300006904|Ga0075424_101319342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 767 | Open in IMG/M |
| 3300007076|Ga0075435_100593051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 961 | Open in IMG/M |
| 3300007632|Ga0102894_1220592 | Not Available | 501 | Open in IMG/M |
| 3300009075|Ga0105090_11021500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 505 | Open in IMG/M |
| 3300009091|Ga0102851_10087887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2650 | Open in IMG/M |
| 3300009091|Ga0102851_10454979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1304 | Open in IMG/M |
| 3300009111|Ga0115026_10245500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1223 | Open in IMG/M |
| 3300009162|Ga0075423_10509278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1266 | Open in IMG/M |
| 3300009177|Ga0105248_10295549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1824 | Open in IMG/M |
| 3300009177|Ga0105248_10795008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1068 | Open in IMG/M |
| 3300009179|Ga0115028_10372406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 991 | Open in IMG/M |
| 3300010037|Ga0126304_11098393 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010373|Ga0134128_10605380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1219 | Open in IMG/M |
| 3300010401|Ga0134121_12107608 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012043|Ga0136631_10406873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
| 3300012206|Ga0137380_11099930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300012207|Ga0137381_10593160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 965 | Open in IMG/M |
| 3300012285|Ga0137370_10378657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300012351|Ga0137386_10096774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2084 | Open in IMG/M |
| 3300012357|Ga0137384_11047705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300012358|Ga0137368_10017580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6915 | Open in IMG/M |
| 3300012496|Ga0157353_1023770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300012532|Ga0137373_11056440 | Not Available | 584 | Open in IMG/M |
| 3300012533|Ga0138256_11008141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300012903|Ga0157289_10420098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 507 | Open in IMG/M |
| 3300012905|Ga0157296_10224500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 615 | Open in IMG/M |
| 3300012907|Ga0157283_10383699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300012916|Ga0157310_10489483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300012951|Ga0164300_10857139 | Not Available | 569 | Open in IMG/M |
| 3300012985|Ga0164308_12307185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 500 | Open in IMG/M |
| 3300012988|Ga0164306_11850854 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012988|Ga0164306_11988511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 506 | Open in IMG/M |
| 3300013100|Ga0157373_11133185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 588 | Open in IMG/M |
| 3300013104|Ga0157370_10285618 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300013105|Ga0157369_12477909 | Not Available | 525 | Open in IMG/M |
| 3300013297|Ga0157378_12715138 | Not Available | 548 | Open in IMG/M |
| 3300013306|Ga0163162_10066911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3643 | Open in IMG/M |
| 3300013306|Ga0163162_11988589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 666 | Open in IMG/M |
| 3300013306|Ga0163162_12461432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 598 | Open in IMG/M |
| 3300013307|Ga0157372_10046563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 4815 | Open in IMG/M |
| 3300013307|Ga0157372_10924139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1012 | Open in IMG/M |
| 3300013308|Ga0157375_10009246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8647 | Open in IMG/M |
| 3300013308|Ga0157375_11087322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 936 | Open in IMG/M |
| 3300014305|Ga0075349_1002585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2859 | Open in IMG/M |
| 3300014315|Ga0075350_1093859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 702 | Open in IMG/M |
| 3300014319|Ga0075348_1007291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2041 | Open in IMG/M |
| 3300014325|Ga0163163_11813251 | Not Available | 670 | Open in IMG/M |
| 3300014745|Ga0157377_11592219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 523 | Open in IMG/M |
| 3300014968|Ga0157379_11088994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300014969|Ga0157376_10326218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1461 | Open in IMG/M |
| 3300014969|Ga0157376_11361299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300015241|Ga0137418_11026375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300015259|Ga0180085_1215845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 570 | Open in IMG/M |
| 3300015360|Ga0163144_11411960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 618 | Open in IMG/M |
| 3300015371|Ga0132258_13457749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300015374|Ga0132255_102632910 | Not Available | 769 | Open in IMG/M |
| 3300016294|Ga0182041_10629355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 945 | Open in IMG/M |
| 3300016445|Ga0182038_10053834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2705 | Open in IMG/M |
| 3300017930|Ga0187825_10404209 | Not Available | 525 | Open in IMG/M |
| 3300018027|Ga0184605_10147366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1058 | Open in IMG/M |
| 3300018027|Ga0184605_10223412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 856 | Open in IMG/M |
| 3300018053|Ga0184626_10452726 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300018081|Ga0184625_10513734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 602 | Open in IMG/M |
| 3300018082|Ga0184639_10162977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1184 | Open in IMG/M |
| 3300018431|Ga0066655_10399160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 907 | Open in IMG/M |
| 3300018433|Ga0066667_10260659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1321 | Open in IMG/M |
| 3300018482|Ga0066669_11849667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300019356|Ga0173481_10476776 | Not Available | 630 | Open in IMG/M |
| 3300020062|Ga0193724_1031870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1123 | Open in IMG/M |
| 3300021344|Ga0193719_10011658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3693 | Open in IMG/M |
| 3300021445|Ga0182009_10680802 | Not Available | 556 | Open in IMG/M |
| 3300025903|Ga0207680_11052369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 582 | Open in IMG/M |
| 3300025907|Ga0207645_10312487 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300025918|Ga0207662_11112120 | Not Available | 562 | Open in IMG/M |
| 3300025919|Ga0207657_10488935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia ginsengisoli | 964 | Open in IMG/M |
| 3300025920|Ga0207649_10158949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1564 | Open in IMG/M |
| 3300025921|Ga0207652_10171554 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300025921|Ga0207652_11447498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 591 | Open in IMG/M |
| 3300025923|Ga0207681_10200526 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300025929|Ga0207664_10175443 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300025932|Ga0207690_10132961 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300025936|Ga0207670_10751232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 810 | Open in IMG/M |
| 3300025938|Ga0207704_10083521 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300025941|Ga0207711_10190647 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300025949|Ga0207667_12045492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 3300025949|Ga0207667_12172991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia ginsengisoli | 512 | Open in IMG/M |
| 3300025981|Ga0207640_10400604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1117 | Open in IMG/M |
| 3300026023|Ga0207677_11284077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 672 | Open in IMG/M |
| 3300026041|Ga0207639_10184113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1779 | Open in IMG/M |
| 3300026059|Ga0208540_1021823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300026069|Ga0208539_1023804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 614 | Open in IMG/M |
| 3300026075|Ga0207708_11133371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 683 | Open in IMG/M |
| 3300026078|Ga0207702_12329618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 523 | Open in IMG/M |
| 3300026089|Ga0207648_10010409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8816 | Open in IMG/M |
| 3300026089|Ga0207648_10225879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1665 | Open in IMG/M |
| 3300026089|Ga0207648_10586204 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300026089|Ga0207648_10623065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 996 | Open in IMG/M |
| 3300026089|Ga0207648_11241853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300026116|Ga0207674_11005323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300026116|Ga0207674_11347200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300026142|Ga0207698_12150299 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027691|Ga0209485_1286406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 541 | Open in IMG/M |
| 3300027693|Ga0209704_1051279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1128 | Open in IMG/M |
| 3300027715|Ga0208665_10122407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 808 | Open in IMG/M |
| 3300027812|Ga0209656_10318594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300027877|Ga0209293_10523177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 623 | Open in IMG/M |
| 3300027880|Ga0209481_10710021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300027890|Ga0209496_10087497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1302 | Open in IMG/M |
| 3300027897|Ga0209254_10906459 | Not Available | 585 | Open in IMG/M |
| 3300028379|Ga0268266_12131964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia ginsengisoli | 533 | Open in IMG/M |
| 3300028380|Ga0268265_10363242 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300029980|Ga0302298_10322260 | Not Available | 516 | Open in IMG/M |
| 3300029984|Ga0311332_11605213 | Not Available | 528 | Open in IMG/M |
| 3300029989|Ga0311365_11196733 | Not Available | 655 | Open in IMG/M |
| 3300030339|Ga0311360_10579645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 897 | Open in IMG/M |
| 3300030838|Ga0311335_11025162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 589 | Open in IMG/M |
| 3300030943|Ga0311366_11173099 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300030943|Ga0311366_11576729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 562 | Open in IMG/M |
| 3300031232|Ga0302323_100444189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1380 | Open in IMG/M |
| 3300031521|Ga0311364_12231689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 535 | Open in IMG/M |
| 3300031548|Ga0307408_101532147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 631 | Open in IMG/M |
| 3300031716|Ga0310813_10373188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1221 | Open in IMG/M |
| 3300031716|Ga0310813_10654438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300031719|Ga0306917_10452681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1005 | Open in IMG/M |
| 3300031720|Ga0307469_11615823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 623 | Open in IMG/M |
| 3300031736|Ga0318501_10016630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2998 | Open in IMG/M |
| 3300031740|Ga0307468_100400622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1047 | Open in IMG/M |
| 3300031748|Ga0318492_10395700 | Not Available | 726 | Open in IMG/M |
| 3300031751|Ga0318494_10741652 | Not Available | 575 | Open in IMG/M |
| 3300031772|Ga0315288_10184183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2286 | Open in IMG/M |
| 3300031820|Ga0307473_10539838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300031821|Ga0318567_10073238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1814 | Open in IMG/M |
| 3300031831|Ga0318564_10043750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1939 | Open in IMG/M |
| 3300031847|Ga0310907_10337837 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300031918|Ga0311367_12395422 | Not Available | 503 | Open in IMG/M |
| 3300031938|Ga0308175_101200833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 843 | Open in IMG/M |
| 3300031941|Ga0310912_10782377 | Not Available | 737 | Open in IMG/M |
| 3300031943|Ga0310885_10078190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1452 | Open in IMG/M |
| 3300031954|Ga0306926_12445890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 574 | Open in IMG/M |
| 3300031995|Ga0307409_100150086 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
| 3300031997|Ga0315278_10224029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1938 | Open in IMG/M |
| 3300031997|Ga0315278_11120570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 777 | Open in IMG/M |
| 3300031997|Ga0315278_11539317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 638 | Open in IMG/M |
| 3300031997|Ga0315278_11807256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
| 3300032005|Ga0307411_10227286 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300032044|Ga0318558_10177276 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300032052|Ga0318506_10225758 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300032074|Ga0308173_11169032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia ginsengisoli | 719 | Open in IMG/M |
| 3300032164|Ga0315283_11078999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 845 | Open in IMG/M |
| 3300032164|Ga0315283_12418215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 511 | Open in IMG/M |
| 3300032174|Ga0307470_10402646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 968 | Open in IMG/M |
| 3300032177|Ga0315276_10128974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2606 | Open in IMG/M |
| 3300032180|Ga0307471_103520650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 554 | Open in IMG/M |
| 3300032205|Ga0307472_101814803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 606 | Open in IMG/M |
| 3300032256|Ga0315271_10054288 | All Organisms → cellular organisms → Bacteria | 2910 | Open in IMG/M |
| 3300032256|Ga0315271_10251235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
| 3300032256|Ga0315271_10667843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 891 | Open in IMG/M |
| 3300032256|Ga0315271_11123160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 679 | Open in IMG/M |
| 3300032397|Ga0315287_10401875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1623 | Open in IMG/M |
| 3300032397|Ga0315287_12248284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
| 3300032401|Ga0315275_10074266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3682 | Open in IMG/M |
| 3300032401|Ga0315275_11540346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 713 | Open in IMG/M |
| 3300032401|Ga0315275_12186818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 579 | Open in IMG/M |
| 3300032516|Ga0315273_11281107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 917 | Open in IMG/M |
| 3300032516|Ga0315273_11798301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 737 | Open in IMG/M |
| 3300032782|Ga0335082_10185623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1986 | Open in IMG/M |
| 3300033004|Ga0335084_11796391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 601 | Open in IMG/M |
| 3300033004|Ga0335084_12297852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 521 | Open in IMG/M |
| 3300033418|Ga0316625_100719278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 841 | Open in IMG/M |
| 3300033418|Ga0316625_100851447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 790 | Open in IMG/M |
| 3300033419|Ga0316601_100847927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 905 | Open in IMG/M |
| 3300033434|Ga0316613_10519832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 809 | Open in IMG/M |
| 3300033482|Ga0316627_100439385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1136 | Open in IMG/M |
| 3300033487|Ga0316630_10253908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1327 | Open in IMG/M |
| 3300033487|Ga0316630_10967124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 742 | Open in IMG/M |
| 3300034090|Ga0326723_0078526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1414 | Open in IMG/M |
| 3300034126|Ga0370486_186629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 514 | Open in IMG/M |
| 3300034127|Ga0370489_0213379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 575 | Open in IMG/M |
| 3300034354|Ga0364943_0090799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1057 | Open in IMG/M |
| 3300034354|Ga0364943_0284615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 623 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.31% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.16% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.16% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.29% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.86% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.86% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.43% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.43% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.43% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.43% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.43% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.43% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.43% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.43% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.43% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026059 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026069 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
| 3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0445.00000510 | 2162886012 | Miscanthus Rhizosphere | DYIAVRNGIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIRKDGED |
| INPhiseqgaiiFebDRAFT_1009132941 | 3300000364 | Soil | HGLALRIPHPEGYDHPNLLIVLGAAMLGSTRXXXNVDVVQGASED* |
| soilH1_100872351 | 3300003321 | Sugarcane Root And Bulk Soil | GLRIPHPEGFDNPHVLIVLAAAHLGATRLIDNVDVVKKDGED* |
| Ga0031654_101693452 | 3300003861 | Freshwater Lake Sediment | DYVAVRHGLALRIPHPEGYDHPNLLIVLAAATIGTTRLIDNVDVIKKDGED* |
| Ga0062384_1005305131 | 3300004082 | Bog Forest Soil | ALRVPHPEGYDHPNLLIVLGAAMLGTTRLIDNVDVVQGASED* |
| Ga0066395_103007111 | 3300004633 | Tropical Forest Soil | VDYIAIRHGLGMRIPHPEGFDHPNLLIVLGAATLGSTRLIDNVDVIPKEGED* |
| Ga0062383_100579991 | 3300004778 | Wetland Sediment | AIRHGLALRIPHPEGYDHPNLLIVLAAATLGSTRLIDNVDVIKKDGED* |
| Ga0066676_107167221 | 3300005186 | Soil | RIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVVPRHGED* |
| Ga0066675_103273122 | 3300005187 | Soil | DYIAVRHGLGLRIPHPEGLDHPHLLIVLGAATLGSTRLIDNVDVVPKDGED* |
| Ga0065715_108637341 | 3300005293 | Miscanthus Rhizosphere | AVRNGIGLRIPHPEGFDHPNLLIVLGAATLGTTRLIDNVDVIKKDGED* |
| Ga0070666_103366192 | 3300005335 | Switchgrass Rhizosphere | GLGLRIPHPEGFDHPNLLIALGAATLGSTRLIDNVDVIRKDGDD* |
| Ga0068868_1006051452 | 3300005338 | Miscanthus Rhizosphere | GIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIRKDGED* |
| Ga0070660_1003626871 | 3300005339 | Corn Rhizosphere | DYIAVRNGIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIKKDGED* |
| Ga0070692_101045123 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | IGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIKKDGED* |
| Ga0070668_1008863942 | 3300005347 | Switchgrass Rhizosphere | VDYVAVRHGLGLRIPHPEGFDHPNLLIVLGAATLGSTRLIDNVDVIRKDGED* |
| Ga0070659_1013995111 | 3300005366 | Corn Rhizosphere | RNGIGLRIPHPEGYDHPNLLIVLGAATLGATRLIDNVDVTPKDGED* |
| Ga0070711_1020322291 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | NGIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIKKDGED* |
| Ga0070700_1007148442 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | RIPHPERFDHPSRLIVLAAAALGTTRLIDNVDVVPRQDDD* |
| Ga0070663_1019279291 | 3300005455 | Corn Rhizosphere | AIRHGLGMRIPHPEGFDHPNLLIVLGAAGLGGTRLIDNVDVIPKDGED* |
| Ga0070681_104563062 | 3300005458 | Corn Rhizosphere | RNGIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIKKDGED* |
| Ga0068867_1004097471 | 3300005459 | Miscanthus Rhizosphere | HGLALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED* |
| Ga0068867_1005254561 | 3300005459 | Miscanthus Rhizosphere | YMAVRHGLALRIPHPEGYDHPNLLIVLAAATLGSTRLIDNVDVIRKDGED* |
| Ga0068853_1016790921 | 3300005539 | Corn Rhizosphere | GMRIPHPEGYDHPHLLIVLGAAGLGSTRLIDNVDVVPKDGED* |
| Ga0070672_1009200132 | 3300005543 | Miscanthus Rhizosphere | EGFDHPNLLIVLGAATIGTTRLIDNVDVITKEGED* |
| Ga0070693_1014223081 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | YIAVRNGIGLRIPHPEGYDHPNVLIVLGAATLGTMRLIDNVDVTQKDGED* |
| Ga0068857_10000334412 | 3300005577 | Corn Rhizosphere | HPEGFDHPNLLIVLAAATLGTTRLIDNVDVVRQDGKD* |
| Ga0068857_1010121961 | 3300005577 | Corn Rhizosphere | HPEGFDHPNLLIVLGAATLGTTRLIDNVDVIKKDGED* |
| Ga0068854_1022210371 | 3300005578 | Corn Rhizosphere | LRIPHPEGFDHPNLLIVLGAATLGSTRLIDIVDVVKKDGED* |
| Ga0066691_102730261 | 3300005586 | Soil | GYDHPNLLIVLGAAMLSTTRLIDNVDVVQGAHDD* |
| Ga0070702_1009707891 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | RHGLALRIPHPEGFDHPNLLIVLAAATLGTTRLIDNVDVVRQDGKD* |
| Ga0070702_1010604582 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GLALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIRKDGED* |
| Ga0068852_1014353131 | 3300005616 | Corn Rhizosphere | HPEGFDHPNLLIVLGAATIGTTRLIDNVDVITKEGED* |
| Ga0066903_1066964871 | 3300005764 | Tropical Forest Soil | LRIPHPEGFDHPNLLIVLGAAALGTTRLIDNVDVIKKDGED* |
| Ga0066903_1067972332 | 3300005764 | Tropical Forest Soil | IRHGLALRIPHPEGYDHPNLLIVLGAATLGTTRLIDNVDVRTGVLDD* |
| Ga0066903_1081150172 | 3300005764 | Tropical Forest Soil | RIPHPEGYDHPNLLIVLGAATLGTTRLIDNVDVIKKDGED* |
| Ga0068863_1006516672 | 3300005841 | Switchgrass Rhizosphere | YVAIRHGLALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIRKDGED* |
| Ga0068860_1020190352 | 3300005843 | Switchgrass Rhizosphere | IRHGLALRIPHPEGFDHPNLLIVLAAATLGNTRLIDNVDVTKRDGED* |
| Ga0068862_1015103011 | 3300005844 | Switchgrass Rhizosphere | PEGFDHPNLLIVLGAATIGTTRLIDNVDVITKEGED* |
| Ga0079037_1008244801 | 3300006224 | Freshwater Wetlands | PHPEGYDHPNLLIVLGAAGLGTTRLIDNVDVVPGQHED* |
| Ga0079037_1009231972 | 3300006224 | Freshwater Wetlands | RNGLGLRIPHPEGYDHPNLLIVLGAATLGTTRLIDNVDVIRKEGED* |
| Ga0068871_1001106133 | 3300006358 | Miscanthus Rhizosphere | PEGYDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED* |
| Ga0068871_1010430531 | 3300006358 | Miscanthus Rhizosphere | PEGFDHPNLLIVLGAATLGSTRLIDNVDVVRKDGED* |
| Ga0079222_100041991 | 3300006755 | Agricultural Soil | PHPEGYDHPNLLIVLGAAMLGTTRLIDNVDVVQGAHDD* |
| Ga0066653_103033052 | 3300006791 | Soil | MDRFQKKLSRHGLALRIPHPEGYDHPNLLIVLGAAMLGSTRLIDNVDVVQGASED* |
| Ga0066659_118259742 | 3300006797 | Soil | RIPHPEGYDHPNLLIVLGAATLGSTRLIDNVDVVTGAGED* |
| Ga0079221_100064571 | 3300006804 | Agricultural Soil | PHPEGFDHPNLLIVLGAATLGSTRLIDNVDVIKKEGED* |
| Ga0075425_1013737031 | 3300006854 | Populus Rhizosphere | RIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVVPKHGED* |
| Ga0075425_1014840921 | 3300006854 | Populus Rhizosphere | PEGFDHPNLLIVLGAATLGTTRLIDNVDVIKKDGED* |
| Ga0075434_1023545291 | 3300006871 | Populus Rhizosphere | KVDYIAIRHGLGMRIPHPEGYDHPNLLIVLGAAALGNTRLIDNVDVIPKDGED* |
| Ga0068865_1016957741 | 3300006881 | Miscanthus Rhizosphere | IRHGLALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIRKDGED* |
| Ga0075424_1002488951 | 3300006904 | Populus Rhizosphere | PHPEGFDHPNLLIVLGAATIGTTRLIDNVDVITKEGED* |
| Ga0075424_1010810851 | 3300006904 | Populus Rhizosphere | YIAIRHGLALRIPHPEGYDHPNLLIVLGAAMLGSTRLIDNVDVVQGASED* |
| Ga0075424_1013193422 | 3300006904 | Populus Rhizosphere | LRIPHPEGFDHPNLLIVLGAATLGSTRLIDNVDVTPKDGED* |
| Ga0075435_1005930511 | 3300007076 | Populus Rhizosphere | PHPEGYDHPNLLIVLAAATLGSTRLIDNVDVIKKDGED* |
| Ga0102894_12205921 | 3300007632 | Estuarine | VRHGLALRIPHPEGFDHPNLLIVLGAATLGSTRLIDNWEF* |
| Ga0105090_110215002 | 3300009075 | Freshwater Sediment | PHPEGFDHPNLLIVLGAAKLGNTRLIDNVDVVPKHNED* |
| Ga0102851_100878873 | 3300009091 | Freshwater Wetlands | DYVAIRHGLGLRIPHPEGYDHPNLLIVLGAAGLGNTRLIDNVDVVPGQHED* |
| Ga0102851_104549791 | 3300009091 | Freshwater Wetlands | GFDHPNLLIVLGAAKLGNTRLIDNVDVVPKHNED* |
| Ga0115026_102455001 | 3300009111 | Wetland | GLGLRIPHPEGYDHPNLLIVLGAAGLGNTRLIDNVDVVPGQHED* |
| Ga0075423_105092781 | 3300009162 | Populus Rhizosphere | IAVRHGLGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVVPKHGED* |
| Ga0105248_102955491 | 3300009177 | Switchgrass Rhizosphere | PHPEGFDHPNLLIVLAAATLGTTRLIDNVDVVRQDGKD* |
| Ga0105248_107950081 | 3300009177 | Switchgrass Rhizosphere | KVDYLAVRHGLGLRIPHPEGFDQPNLLIVLGAATIGTTRLIDNVDVIRKDGED* |
| Ga0115028_103724061 | 3300009179 | Wetland | IAVRNGLGLRIPHPEGYDHPNLLIVLGAATLGSTRLIDNVDVIRKEGED* |
| Ga0126304_110983931 | 3300010037 | Serpentine Soil | HGLGMRIPHPEGYDHPNLLIVLGAAGLGGTRLIDNVDVIPKDGED* |
| Ga0134128_106053801 | 3300010373 | Terrestrial Soil | PHPEGFDHPNLLIVLGAATLGTTRLIDNVDVIRKEGED* |
| Ga0134121_121076081 | 3300010401 | Terrestrial Soil | YIAVRNGIGLRIPHPEGFDHPDVLIVLGAATLGTTRLIDNVDVIRKDGED* |
| Ga0136631_104068732 | 3300012043 | Polar Desert Sand | YIAVRHGLGLRIPHPEAFDHPNLLIVLGAAKLGNTRLIDNVDVVPKHNED* |
| Ga0137380_110999301 | 3300012206 | Vadose Zone Soil | GYDHPNLLIVLGAAMLGSTRLIDNVDVVQGASED* |
| Ga0137381_105931601 | 3300012207 | Vadose Zone Soil | IAIRHGLALRIPHPEGYDHPNLLIVLGAAMLGSTRLIDNVDVVQGASED* |
| Ga0137370_103786571 | 3300012285 | Vadose Zone Soil | IPHPEGYDHPNLLIVLGAAMLGSTRLIDNVDVVQGASED* |
| Ga0137386_100967743 | 3300012351 | Vadose Zone Soil | HPEGYDHPNLLIVLGAAMLGTTRLIDNVDVVQGAHDD* |
| Ga0137384_110477052 | 3300012357 | Vadose Zone Soil | IRHGLALRIPHPEGYDHPNLLIVLGAAMLGSTRLIDNVDVVQGASED* |
| Ga0137368_100175807 | 3300012358 | Vadose Zone Soil | WKVDYIAIRHGLALRIPHPEGYDHPNLLIVLGAAMLGFTRLIDNVDVVQGASED* |
| Ga0157353_10237702 | 3300012496 | Unplanted Soil | LRIPHPEGYDHPNLLIVLAAATLGTTRLIDNVDVIKKDGED* |
| Ga0137373_110564402 | 3300012532 | Vadose Zone Soil | RHGLALRIPHPEGYDHPNLLIVLGAAMLGSTRLIDNVDVVQGASED* |
| Ga0138256_110081411 | 3300012533 | Active Sludge | EAFDHPNLLIVLGAAKLGATRLIDNVDVVPMPDVD* |
| Ga0157289_104200981 | 3300012903 | Soil | LALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED* |
| Ga0157296_102245001 | 3300012905 | Soil | IAVRNGIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIRKDGED* |
| Ga0157283_103836992 | 3300012907 | Soil | EGYDHPNLLIVLAAATLGNTRLIDNVDVIRKDGED* |
| Ga0157310_104894832 | 3300012916 | Soil | LRIPHPEGFDHPNLLVVLGAAKLGATRLIDNVDVVPQYGRD* |
| Ga0164300_108571392 | 3300012951 | Soil | YIAVRNGIGLRIPHPEGFDHPNLLIVLGAATLGTTRLIDNVDVIRKDGED* |
| Ga0164308_123071852 | 3300012985 | Soil | VDYIAVRNGIGLRIPHPEGYDHPNVLIVLGAATLGTTRLIDNVDVTPKDGED* |
| Ga0164306_118508541 | 3300012988 | Soil | GYDHPNVLIVLGAATLGTTRLIDNVDVTPKDGED* |
| Ga0164306_119885111 | 3300012988 | Soil | IPHPEGFDHPNLLIVLGAATLGSTRLIDNVDVIKKDGED* |
| Ga0157373_111331851 | 3300013100 | Corn Rhizosphere | RIPHPEGYDHPNLLIVLGAATLGATRLIDNVDVTPKDGED* |
| Ga0157370_102856183 | 3300013104 | Corn Rhizosphere | YIAVRNGIGLRIPHPEGYDHPNVLIVLGAATLGTTRLIDNVDVTPKDGED* |
| Ga0157369_124779092 | 3300013105 | Corn Rhizosphere | IGLRIPHPEGFDNPHVLIVLAAAQLGATRLIDNVDVIKKDGED* |
| Ga0157378_127151382 | 3300013297 | Miscanthus Rhizosphere | GYDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED* |
| Ga0163162_100669111 | 3300013306 | Switchgrass Rhizosphere | DYVAIRHGLALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED* |
| Ga0163162_119885892 | 3300013306 | Switchgrass Rhizosphere | AVRHGLGLRIPHPEGFDHPNLLIVLGAATIGTTRLIDNVDVIRKDGED* |
| Ga0163162_124614322 | 3300013306 | Switchgrass Rhizosphere | RIPHPEGFDHPNLLIVLGAAGLGGTRLIDNVDVIPKDGED* |
| Ga0157372_100465634 | 3300013307 | Corn Rhizosphere | YIAVRNGIGLRIPHPEGFDHPNLLIVLGAATLGSTRLIDNVDVVKKDGED* |
| Ga0157372_109241392 | 3300013307 | Corn Rhizosphere | VRNGIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIRKDGED* |
| Ga0157375_100092461 | 3300013308 | Miscanthus Rhizosphere | PEGFDHPNLLIVLAAATLGTTRLIDNVDVVRQDGKD* |
| Ga0157375_110873221 | 3300013308 | Miscanthus Rhizosphere | IPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIRKDGED* |
| Ga0075349_10025851 | 3300014305 | Natural And Restored Wetlands | AFDHPNLLIVLGAAKLGNTRLIDNVDVVPKHNED* |
| Ga0075350_10938592 | 3300014315 | Natural And Restored Wetlands | KVDYVAIRHGLALRIPHPEGFDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED* |
| Ga0075348_10072911 | 3300014319 | Natural And Restored Wetlands | YVAIRHGLALRIPHPEGFDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED* |
| Ga0163163_118132511 | 3300014325 | Switchgrass Rhizosphere | GFDHPNLLIVLGAATLGTTRLIDNVDVIKKDGED* |
| Ga0157377_115922191 | 3300014745 | Miscanthus Rhizosphere | IPHPEAFDHPNLLIVLGAAHLGSTRLIDNVDVIRKDGED* |
| Ga0157379_110889942 | 3300014968 | Switchgrass Rhizosphere | GFDHPDVLIVLGAATLGTTRLIDNVDVIRKDGED* |
| Ga0157376_103262183 | 3300014969 | Miscanthus Rhizosphere | PEGFDHPNLLIVLGAATLGSTRLIDNVDVIRKDGED* |
| Ga0157376_113612992 | 3300014969 | Miscanthus Rhizosphere | ALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIRKDGED* |
| Ga0137418_110263751 | 3300015241 | Vadose Zone Soil | ALRIPHPEGYDHPNLLIVLGAAMLGSTRLIDNVDVVQGASED* |
| Ga0180085_12158452 | 3300015259 | Soil | GLALRIPHPEGYDHPNLLIVLGAATLGSTRLIDNVDVIKKDGED* |
| Ga0163144_114119602 | 3300015360 | Freshwater Microbial Mat | DYIAIRNGMGLRIPHPEGFDHPSVLLVLAAATLGATRLIDNIDVIRQEGKDPGG* |
| Ga0132258_134577492 | 3300015371 | Arabidopsis Rhizosphere | KVDYVAIRHGLALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIRKDGED* |
| Ga0132255_1026329101 | 3300015374 | Arabidopsis Rhizosphere | VDYVAVRHGLALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVFKRDGED* |
| Ga0182041_106293552 | 3300016294 | Soil | GLGLRIPHPEGFDHPNLLIVLGAAALGTTRLIDNVDVIKKDGED |
| Ga0182038_100538341 | 3300016445 | Soil | LGLRIPHPEGFDHPNLLIVLAAATLGTTRLIDNVDVIPKDGED |
| Ga0187825_104042091 | 3300017930 | Freshwater Sediment | KVDYVAIRHGLALRIPHPEGYDHPNLLIVLGAAMLGTTRLIDNVDVVQGASED |
| Ga0184605_101473662 | 3300018027 | Groundwater Sediment | RIPHPEGLDHPHLLIVLGAATLGSTRLIDNVDVITKEGED |
| Ga0184605_102234121 | 3300018027 | Groundwater Sediment | IRHGLALRIPHPEGYDHPNLLIVLGAAMLGSTRLIDNVDVVQGASED |
| Ga0184626_104527262 | 3300018053 | Groundwater Sediment | YLAVRHGIGLRIPHPEGFDHPNLLIVLCAATLGSTRLIDNVDVIPAHGVD |
| Ga0184625_105137341 | 3300018081 | Groundwater Sediment | AIRHGLALRIPHPEGFDHPNLLIVLAAATLGTTRLIDNVDVIRQEGKD |
| Ga0184639_101629771 | 3300018082 | Groundwater Sediment | HGLALRIPHPEGYDHPHLLIVLAAATLGSTRLIDNVDVIKKDGED |
| Ga0066655_103991602 | 3300018431 | Grasslands Soil | GLRIPHPEGLDHPHLLIVLGAATLGSTRLIDNVDVVPKDGED |
| Ga0066667_102606591 | 3300018433 | Grasslands Soil | DYIAVRHGLGLRIPHPEGLDHPHLLIVLGAATLGSTRLIDNVDVVPKDGED |
| Ga0066669_118496672 | 3300018482 | Grasslands Soil | LRIPHPEGLDHPHLLIVLGAATLGSTRLIDNVDVVPKDGED |
| Ga0173481_104767761 | 3300019356 | Soil | VRNGIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIRKDGED |
| Ga0193724_10318701 | 3300020062 | Soil | GLGLRIPHPEGLDHPHLLIVLGAATIGTTRLIDNVDVVPKDGED |
| Ga0193719_100116581 | 3300021344 | Soil | LRIPHPEGFDHPHLLIVLGAATLGSTRLIDNVDVITKEGED |
| Ga0182009_106808021 | 3300021445 | Soil | IPHPEGFDHPNLLIVLGAATLGTTRLIDNVDVIKKEGED |
| Ga0207680_110523692 | 3300025903 | Switchgrass Rhizosphere | RIPHPEGFDHPNLLIALGAATLGSTRLIDNVDVIRKDGDD |
| Ga0207645_103124871 | 3300025907 | Miscanthus Rhizosphere | PEGYDHPNVLIVLGAATLGTTRLIDNVDVTPKDGED |
| Ga0207662_111121201 | 3300025918 | Switchgrass Rhizosphere | DYIAIRTGLGMRIPHPEGFDHPNLLIVLGAAALGNTRLIDNVDVIPKDGED |
| Ga0207657_104889351 | 3300025919 | Corn Rhizosphere | DYMAVRHGLALRIPHPEGYDHPNLLIVLAAATLGSTRLIDNVDVIRKDGED |
| Ga0207649_101589493 | 3300025920 | Corn Rhizosphere | RIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIKKDGED |
| Ga0207652_101715543 | 3300025921 | Corn Rhizosphere | AVRNGIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVVKKDGED |
| Ga0207652_114474981 | 3300025921 | Corn Rhizosphere | KVDYIAVRNGIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVVKKDGED |
| Ga0207681_102005263 | 3300025923 | Switchgrass Rhizosphere | RIPHPEGFDHPNLLIVLAAATLGTTRLIDNVDVITQEGRD |
| Ga0207664_101754431 | 3300025929 | Agricultural Soil | EGFDHPNLLIVLGAATLGATRLIDNVDVIKKDGED |
| Ga0207690_101329613 | 3300025932 | Corn Rhizosphere | PHPEGFDHPNLLIVLGAATLGATRLIDNVDVIKKDGED |
| Ga0207670_107512321 | 3300025936 | Switchgrass Rhizosphere | DYVAVRHGLGLRIPHPEGFDHPNLLIVLGAATLGSTRLIDNVDVIRKDGED |
| Ga0207704_100835213 | 3300025938 | Miscanthus Rhizosphere | HPEGFDHPNLLIVLGAATLGSTRLIDNVDVIRKDGED |
| Ga0207711_101906473 | 3300025941 | Switchgrass Rhizosphere | HPEGFDHPNLLIVLAAATLGTTRLIDNVDVVRQDGKD |
| Ga0207667_120454921 | 3300025949 | Corn Rhizosphere | RIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVVKKDGED |
| Ga0207667_121729912 | 3300025949 | Corn Rhizosphere | LRIPHPEGYDHPNLLIVLAAATLGSTRLIDNVDVIRKDGED |
| Ga0207640_104006042 | 3300025981 | Corn Rhizosphere | PEGFDHPNLLIVLGAATLGSTRLIDNVDVIRKDGED |
| Ga0207677_112840771 | 3300026023 | Miscanthus Rhizosphere | IGLRIPHPEGFDHPNLLIVLCAAILGTTRLIDNIDVIRKDGED |
| Ga0207639_101841133 | 3300026041 | Corn Rhizosphere | RHGLALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVFKRDGED |
| Ga0208540_10218231 | 3300026059 | Natural And Restored Wetlands | YVAIRHGLALRIPHPEGFDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED |
| Ga0208539_10238042 | 3300026069 | Natural And Restored Wetlands | YVAIRHGLALRIPHPEGFDHPNLLIVLGAAKLGNTRLIDNVDVVPKHNED |
| Ga0207708_111333711 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | RIPHPERFDHPSRLIVLAAAALGTTRLIDNVDVVPRQDDD |
| Ga0207702_123296182 | 3300026078 | Corn Rhizosphere | HPEGFDHPNLLIVLGAATLGATRLIDNVDVVKKDGED |
| Ga0207648_100104091 | 3300026089 | Miscanthus Rhizosphere | PHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED |
| Ga0207648_102258793 | 3300026089 | Miscanthus Rhizosphere | MRIPHPEGFDHPNLLIVLGAAGLGGTRLIDNVDVITKEGED |
| Ga0207648_105862041 | 3300026089 | Miscanthus Rhizosphere | YIAVRNGIGLRIPHPEGYDHPNVLIVLGAATLGTTRLIDNVDVTPKDGED |
| Ga0207648_106230651 | 3300026089 | Miscanthus Rhizosphere | RIPHPEGFDHPNLLIVLGAATIGTTRLIDNVDVIRKDGED |
| Ga0207648_112418533 | 3300026089 | Miscanthus Rhizosphere | VRHGLALRIPHPEGYDHPNLLIVLAAATLGSTRLIDNVDVIRKDGE |
| Ga0207674_110053231 | 3300026116 | Corn Rhizosphere | PHPEGFDHPNLLIVLGAATLGTTRLIDNVDVIKKDGED |
| Ga0207674_113472002 | 3300026116 | Corn Rhizosphere | PEGFDHPNLLIVLGAATLGATRLIDNVDVVKKDGED |
| Ga0207698_121502992 | 3300026142 | Corn Rhizosphere | MRIPHPEGYDHPHLLIVLGAAGLGSTRLIDNVDVVPKDGED |
| Ga0209485_12864062 | 3300027691 | Agricultural Soil | HPEGFDHPNLLIVLGAAKLGTTRLIDNVDVVPKHNED |
| Ga0209704_10512792 | 3300027693 | Freshwater Sediment | VRNGLGMRIPHPEGFDHPNLLIVLGAAKLGNTRLIDNVDVVPKHNED |
| Ga0208665_101224072 | 3300027715 | Deep Subsurface | GLRIPHPEGFDHPNLLIVLGAAKLGNTRLIDNVDVVPKHNED |
| Ga0209656_103185941 | 3300027812 | Bog Forest Soil | GLALRIPHPEGYDHPNLLIVLGAAMLGATRLIDNVDVVQGASED |
| Ga0209293_105231771 | 3300027877 | Wetland | VRNGLGLRIPHPEGYDHPNLRIVLGAATIGTTRLIDNVDVIRKEGED |
| Ga0209481_107100212 | 3300027880 | Populus Rhizosphere | PHPERFDHPSRLIVLAAAALGTTRLIDNVDVVPRQDDD |
| Ga0209496_100874973 | 3300027890 | Wetland | PHPEGFDHPNLLIVLGAATLGNTRLIDNVDVVKQDGKD |
| Ga0209254_109064591 | 3300027897 | Freshwater Lake Sediment | VRHGLALRIPHPEAYDHPNLLIVLAAAKLGATRLIDNVDVVPKHNED |
| Ga0268266_121319641 | 3300028379 | Switchgrass Rhizosphere | VRHGLALRIPHPEGYDHPNLLIVLAAATLGTTRLIDNVDVIRKDGED |
| Ga0268265_103632423 | 3300028380 | Switchgrass Rhizosphere | EGFDHPHLLIVLAAATLGTTRLIDNVDVITQEGRD |
| Ga0302298_103222601 | 3300029980 | Fen | VDYVAVRHGLALRIPHPEGYDHPNLLIVLAAATIGSTRLIDNVDVIKKDGED |
| Ga0311332_116052132 | 3300029984 | Fen | YVAIRHGLALRIPHPEGFDHPNLLIVLAAATLGSTRLIDNVDVIPKHGED |
| Ga0311365_111967332 | 3300029989 | Fen | EGYDHPNLLIVLGAAGLGSTRLIDNVDVIPKEGED |
| Ga0311360_105796452 | 3300030339 | Bog | EGFDHPHLLVVLGAATLGSTRLIDNVDIVPNQAEI |
| Ga0311335_110251621 | 3300030838 | Fen | KVYYVAVRHGIGLRVPHPEGFDHPHFLVVLGAATLGSTRLIDNVDIVPNQAET |
| Ga0311366_111730992 | 3300030943 | Fen | PHPEGYDHPNLLIVLAAATIGTTRLIDNVDVIKKDGED |
| Ga0311366_115767291 | 3300030943 | Fen | LRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIRNDGVD |
| Ga0302323_1004441893 | 3300031232 | Fen | VRHGLALRIPHPEGYDHPNLLIVLAAATIGSTRLIDNVDVIKKDGED |
| Ga0311364_122316892 | 3300031521 | Fen | RHGLALRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIRNDGVD |
| Ga0307408_1015321471 | 3300031548 | Rhizosphere | YMAVRHGLALRTPHPEGYDHPNLLIVLAAATLGTTRLIDNVDVVRKDGED |
| Ga0310813_103731881 | 3300031716 | Soil | IPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIRKDGED |
| Ga0310813_106544381 | 3300031716 | Soil | PHPEGFDHPNLLIVLGAATLGATRLIDNVDVVKKDGED |
| Ga0306917_104526811 | 3300031719 | Soil | IPHPEGFDHPNLLIVLAAATLGTTRLIDNVDVIPKDGED |
| Ga0307469_116158231 | 3300031720 | Hardwood Forest Soil | DYIAIRHGLALRTPHPEGYDHPNLLIVLGAAMLGSTRLIDNVDVRTGALDD |
| Ga0318501_100166301 | 3300031736 | Soil | IPHPEGYDHPNLLIVLGAATLGTTRLIDNVDVRTGALDD |
| Ga0307468_1004006221 | 3300031740 | Hardwood Forest Soil | RHGLGLRIPHQEGFDHPNLLIVLCAATLGSTRLIDNVDVTPKDGED |
| Ga0318492_103957001 | 3300031748 | Soil | RIPHPEGFDHPNLLIVLAAATLGTTRLIDNVDVIPKDGED |
| Ga0318494_107416521 | 3300031751 | Soil | PEGFDHPNLLIVLAAATLGTTRLIDNVDVIPKDGED |
| Ga0315288_101841833 | 3300031772 | Sediment | YVAIRHGLGLRIPHPEGFDHPNLLIVLGAAMLGSTRLIDNVDVIKKDGED |
| Ga0307473_105398381 | 3300031820 | Hardwood Forest Soil | IAVRHGLGLRIPHPEGFDHPNLLIVLGAAALGSTRLIDNVDVIPKEGED |
| Ga0318567_100732383 | 3300031821 | Soil | RHGLGLRIPHPEGFDHPNLLIVLAAATLGTTRLIDNVDVIPKDGED |
| Ga0318564_100437501 | 3300031831 | Soil | HGLGLRIPHPEGFDHPNLLIVLAAATLGTTRLIDNVDVIPKDGED |
| Ga0310907_103378372 | 3300031847 | Soil | IGLRIPHPEGYDHPNVLIVLGAATLGTTRLIDNVDVTPKDGED |
| Ga0311367_123954222 | 3300031918 | Fen | IPNPEGFDHPNLLIVLAAATLGSTRLIDNVDVIPKHGED |
| Ga0308175_1012008331 | 3300031938 | Soil | GIGLRIPHPEGFDHPNLLIVLGAATLGATRLIDNVDVIKKDGED |
| Ga0310912_107823772 | 3300031941 | Soil | IAIRHGLGLRIPHPEGFDHPNLLIVLAAATLGTTRLIDNVDVIPKDGED |
| Ga0310885_100781903 | 3300031943 | Soil | VRDGLGLRVPPPREVDPPTRLVALGAARLGSTRLIDNVDVVPRADDD |
| Ga0306926_124458902 | 3300031954 | Soil | KVDYIVIRHGLALRIPHPEGYDHPNLLIVLGAATLGTTRLIDNVDVRTGALDD |
| Ga0307409_1001500861 | 3300031995 | Rhizosphere | LRIPHPEGFDHPNLLIVLGAAKLGSTRLIDNVDVVPKHNED |
| Ga0315278_102240294 | 3300031997 | Sediment | GLALRIPHPEGFDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED |
| Ga0315278_111205701 | 3300031997 | Sediment | AIRQGLGLRVPHPEGFDHPHLLVVLGAATLGSTRLIDNVDIVPNQTEI |
| Ga0315278_115393171 | 3300031997 | Sediment | LRIPHPEGFDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED |
| Ga0315278_118072562 | 3300031997 | Sediment | LRIPHPEGYDHPNLLIVLAAATLGSTRLIDNVDVIKKDGED |
| Ga0307411_102272861 | 3300032005 | Rhizosphere | HPEGFDHPNLLIVLGAAKLGSTRLIDNVDVVPKHNED |
| Ga0318558_101772762 | 3300032044 | Soil | HPEGFDHPNLLIALGAATLGGTRLIDNVDVITKEGED |
| Ga0318506_102257582 | 3300032052 | Soil | VDYVAVRHGLGLRIPHPEGFDHPNLLIALGAATLGGTRLIDNVDVITKEGED |
| Ga0308173_111690322 | 3300032074 | Soil | PHPEGYDHPNLLIVLAAATLGSTRLIDNVDVIRKDGED |
| Ga0315283_110789992 | 3300032164 | Sediment | PEGFDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED |
| Ga0315283_124182151 | 3300032164 | Sediment | PHPEGFDHPHLLVVLGAATLGSTRLIDNVDIVPNQTET |
| Ga0307470_104026462 | 3300032174 | Hardwood Forest Soil | LALRIPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED |
| Ga0315276_101289741 | 3300032177 | Sediment | PHPEGYDHPNLLIVLAAATLGTTRLIDNVDVIKKDGED |
| Ga0307471_1035206502 | 3300032180 | Hardwood Forest Soil | GLALRIPHPEGYDHPNLLIVLAAATLGTTRLIDNVDVIKKDGED |
| Ga0307472_1018148032 | 3300032205 | Hardwood Forest Soil | YIAIRHGLGMRIPHPEGFDHPNLLIVLGAASLGTTRLIDNVDVIPKEGED |
| Ga0315271_100542884 | 3300032256 | Sediment | VDYVAIRQGLGLRVPHPEGFDHPHLLVVLGAATLGSTRLIDNVDIVPNLAET |
| Ga0315271_102512351 | 3300032256 | Sediment | RHGLGLRIPHPEGFDHPNLLVVLGAATLGTTRLIDNVDVIPKDGED |
| Ga0315271_106678431 | 3300032256 | Sediment | IPHPEGYDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED |
| Ga0315271_111231601 | 3300032256 | Sediment | VDYVAIRHGLALRIPHPEGFDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED |
| Ga0315287_104018753 | 3300032397 | Sediment | PEGYDHPNLLIVLGAATQGSTRLIDNVDVIPRPGED |
| Ga0315287_122482841 | 3300032397 | Sediment | GMRIPHPEGYDHPNLLIVLGAATQGSTRLIDNVDVIPRPGED |
| Ga0315275_100742664 | 3300032401 | Sediment | VAIRHGLGLRIPHPEGFDHPNLLIVLGAAMLGSTRLIDNVDVIKKDGED |
| Ga0315275_115403461 | 3300032401 | Sediment | RIPHPEGYDHPNLLIVLGAAALGSTRLIDNVDVIPKDGED |
| Ga0315275_121868181 | 3300032401 | Sediment | LALRIPHPEGFDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED |
| Ga0315273_112811072 | 3300032516 | Sediment | IRHGLGIRIPHPEGYDHPNLLIVLGAAALGSTRLIDNVDVIPKDGED |
| Ga0315273_117983011 | 3300032516 | Sediment | HGLALRIPHPEGFDHPNLLIVLAAATLGNTRLIDNVDVIKKDGED |
| Ga0335082_101856233 | 3300032782 | Soil | YIAVRHGLALRIPHPEGYDHPNLLIVLGAAALGSTRLIDNVDVIKKDGED |
| Ga0335084_117963912 | 3300033004 | Soil | RHGLGMRIPHPEGYDHPNLLIVLGAAALGSTRLIDNVDVIPKDGED |
| Ga0335084_122978521 | 3300033004 | Soil | LRIPHPEGYDHPNLLIVLAAATLGTTRLIDNVDVIKKDGED |
| Ga0316625_1007192781 | 3300033418 | Soil | LRIPHPEGFDHPNLLIVLAAATLGATRLIDNVDVIKKDGED |
| Ga0316625_1008514471 | 3300033418 | Soil | RIPHPEGFDHPNLLIVLGAAKLGNTRLIDNVDVVPKHNED |
| Ga0316601_1008479272 | 3300033419 | Soil | PHPEGFDHPNLLIVLGAAKLGNTRLIDNVDVVPKHNED |
| Ga0316613_105198321 | 3300033434 | Soil | AVRNGLGLRIPHPEGFDHPNLLIVLGAAKLGNTRLIDNVDVVPKHNED |
| Ga0316627_1004393851 | 3300033482 | Soil | RNGLGLRIPHPEGYDHPNLLIVLGAATLGTTRLIDNVDVIRKEGED |
| Ga0316630_102539083 | 3300033487 | Soil | IALRIPHPEGFDHPNLLIVLAAATLGTTRLIDNVDVIKKDGED |
| Ga0316630_109671241 | 3300033487 | Soil | LGLRIPHPEGFDHPNLLIVLGAAALGTTRLIDNVDVTPRYGED |
| Ga0326723_0078526_1245_1403 | 3300034090 | Peat Soil | VDYIAIRHGLALRIPHPEGYDHPNLLIVLGAAMLGTTRLIDNVDVVQGANDD |
| Ga0370486_186629_3_110 | 3300034126 | Untreated Peat Soil | EGFDQPSVLIVLAAATLGATRLIDNLDVIRQDGKD |
| Ga0370489_0213379_3_128 | 3300034127 | Untreated Peat Soil | LRVPHPEGFDHPNLLIVLGAATLGATRLIDNVDVVKQDGKD |
| Ga0364943_0090799_944_1057 | 3300034354 | Sediment | HPEGYDHPNLLIVLGAAMLGSTRLIDNVDVRTGALDD |
| Ga0364943_0284615_1_126 | 3300034354 | Sediment | LRIPHPEGYDHPNLLIVLGAAGLGNTRLIDNVDVVPGHHED |
| ⦗Top⦘ |