


| Basic Information | |
|---|---|
| Family ID | F018939 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 232 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MFRHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGL |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 232 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 24.55 % |
| % of genes near scaffold ends (potentially truncated) | 94.83 % |
| % of genes from short scaffolds (< 2000 bps) | 92.24 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.621 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (52.586 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.328 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.534 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.24% β-sheet: 0.00% Coil/Unstructured: 75.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.62 % |
| All Organisms | root | All Organisms | 16.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 52.59% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.64% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 8.62% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.76% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.88% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.88% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.16% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.16% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.72% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.86% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.86% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.43% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.43% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.43% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.43% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.43% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.43% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.43% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.43% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300003498 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005428 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 | Environmental | Open in IMG/M |
| 3300005516 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300013181 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 9m_Station6_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300016742 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020314 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974) | Environmental | Open in IMG/M |
| 3300020320 | Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556072-ERR598990) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022905 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300024243 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_150_MG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100980194 | 3300000101 | Marine | MHVFKHPKYYKELRARNKSDQVISSRNAATAAGRRAPGQGQS |
| KVRMV2_1002214981 | 3300002231 | Marine Sediment | MHTFKHPKYYKELRKRNKLDQAISEPSATAQVERAPD |
| KVWGV2_100191822 | 3300002242 | Marine Sediment | MHTFKHPKYYKELRKRNKLDQAISEPSATAQVERAPDPGPKQQATSY |
| KVWGV2_102516751 | 3300002242 | Marine Sediment | MWKHPKYYKELRKRNKLDQAISKEPATAGNQRSPGPXPQ |
| KVWGV2_104127591 | 3300002242 | Marine Sediment | MFKHPKYYKELRKRNKLDQAISKEPATAGNQRSPGP |
| JGI25127J35165_10505841 | 3300002482 | Marine | MFRHPKYYKELRKRNKSDQVISGASATAPVQRAPGPGLKRQASSVKPQAP |
| JGI25127J35165_10875761 | 3300002482 | Marine | MVNIKMHVFKHPKYYKELRKRNKSDQVISKEPATAGNQRAPGP |
| JGI25127J35165_11224562 | 3300002482 | Marine | MVNIKMHVFKHPKYYKELRKRNKSDQVISKEPATAGNQRAPG |
| JGI25132J35274_11046762 | 3300002483 | Marine | MHVFKHPKYYKELRKRNKSDQVISPEAHDGERERAPGPGL |
| JGI25128J35275_10536041 | 3300002488 | Marine | MFRHPKYYKELRKLRNRVVQSSRTASPQSDQAISLRAHDGECERAPGQGLKQQA |
| JGI25133J35611_101018712 | 3300002514 | Marine | MWHHPKYYKELRKLRNKSDQAISSEAGDGKRERAPGQGHKPQ |
| JGI26239J51126_10165716 | 3300003498 | Marine | MVNTNMFYHPKYYKELRKRNKSDQVISRGDSTEAGRRSPG |
| Ga0068511_10306991 | 3300005057 | Marine Water | MFRHPKYYKELRKRNKSDQVISGANATAKVERAPGPGLKPRYT |
| Ga0066863_103437411 | 3300005428 | Marine | MFEFKHPKYYKELRKRNKSDQVISSKSSTEQLQRAPGSGHKLQA |
| Ga0066831_100883553 | 3300005516 | Marine | MFEFKHPKYYKELRKRNKSDQVISSKSSTEQLQRAPGSGHKLQ |
| Ga0066853_101849721 | 3300005603 | Marine | MTHIFQHPKYYKELRKRNKSDQVISSKSSTEQLQRAPGSGHK |
| Ga0066852_103146271 | 3300005604 | Marine | MTHIFQHPKYYKELRKRNKSDQVISSKSSTEQLQRAPGSGHKLQAP |
| Ga0066835_103589161 | 3300005606 | Marine | MWHHPKYYKELRKRNKSDQAISLRESETSAGERAPGQGLKP |
| Ga0099693_10675061 | 3300006345 | Marine | MTFVFKHPKYYKELRSRNKLDQAISLRESETSAGERSPGP |
| Ga0098038_10429845 | 3300006735 | Marine | MWYHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGLKVTSYK |
| Ga0098038_10474854 | 3300006735 | Marine | MWHHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGLKQQAA |
| Ga0098038_10904843 | 3300006735 | Marine | MFRHPKYYKELRKRNKSDQVISSDTATAASERAPGPGLK |
| Ga0098038_11252502 | 3300006735 | Marine | MTHTFHHPKYYKELRKRNKSDQIISPRVATASARRASGPGLKP |
| Ga0098038_11536521 | 3300006735 | Marine | MVNIDMFRHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGQQHQASS |
| Ga0098038_12409942 | 3300006735 | Marine | MHVFKHPKYYKELRERNKSDQVISKEPATAGNQRAPGPGLKLQ |
| Ga0098037_10388891 | 3300006737 | Marine | MFRHPKYYKELRKRNKSDQVISKQQATASGERSPG |
| Ga0098037_10577331 | 3300006737 | Marine | MWYHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGL |
| Ga0098037_11548371 | 3300006737 | Marine | MVNIKMFRHPKYYKELRKRNKSDQVISKEPATAGNQRAP |
| Ga0098037_11728271 | 3300006737 | Marine | MWHHPKYYKELRKRNKSDQAISKEPATAGNQRSPGPGPKASSSK |
| Ga0098037_12157182 | 3300006737 | Marine | MWHHPKYYKELRKRNKSDQVISLRAHDGECERASGPGLKQQATS |
| Ga0098037_12183742 | 3300006737 | Marine | MEFRHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGP |
| Ga0098035_10915514 | 3300006738 | Marine | MTHIFHHPKYYKELRKRNKSDQVISSKSSTEQLQRAPGSG |
| Ga0098042_10192755 | 3300006749 | Marine | MENIKMHEFKHPNYYKELRKRNKSDQVISRGDSTEAGRRAPGPGHKQ |
| Ga0098042_10398201 | 3300006749 | Marine | MVNTKMHIFRHPKYYTELRKRNKSDQAISKESSTEENQRAPGQGL |
| Ga0098042_10868131 | 3300006749 | Marine | MTHTFHHPKYYKELRKRNKSDQVISGANATAKVERAPGPG |
| Ga0098058_11206311 | 3300006750 | Marine | MWRHPKYYKELRKLRNKSDRVISGAEATAEVERAPGQ |
| Ga0098058_11906581 | 3300006750 | Marine | MEFKHPKYYKELRKRNKSDQVISKSTCDGESERAPGQ |
| Ga0098039_13043882 | 3300006753 | Marine | MVNTSMWYHPKYYKELRKLRNNLDQVISKQQATASSERA |
| Ga0098039_13095151 | 3300006753 | Marine | MFEFKHPNYYKELRSIRNKLDQAISKEPATAGNQRSPDPGLKP |
| Ga0098044_12546412 | 3300006754 | Marine | MFVFKHPKYYKELRERNKTDQVISKEPATAGNQRAPGPGLKPQ |
| Ga0098074_11515952 | 3300006790 | Marine | MWRHPKYYKELRKRNKLDQAISTSDSTECSDKRSPGPGPKLQ |
| Ga0098055_10687971 | 3300006793 | Marine | MVNTKMHIFRHPKYYTELRKRNKSDQAISKESSTEENQRAPGQGLKL |
| Ga0098055_12295652 | 3300006793 | Marine | MHEFKHPNYYKELRKRNKSDQVISETKPTGDGERA |
| Ga0098060_10353771 | 3300006921 | Marine | MFEFKHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGLKVS |
| Ga0098045_11346882 | 3300006922 | Marine | MHVFKHPKYYKELRERNKSDQVISKEPATAGNQRAPGPGPKLQATSCKRQALS |
| Ga0098057_10697841 | 3300006926 | Marine | MTHTFHHPKYYKELRKRNKSDQVISSKSSTEQLQRAPGSGQ |
| Ga0098041_11777831 | 3300006928 | Marine | MEFKHPKYYKELRKRNKSDQVISETKPTGDGERAPGQG |
| Ga0098036_10314801 | 3300006929 | Marine | MFEFKHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGLKVTSYK |
| Ga0098036_11463202 | 3300006929 | Marine | MWHHPKYYKELRKRNKSDQVISPEAHDGERERAPGPGLKQQASSIK |
| Ga0098036_11681042 | 3300006929 | Marine | MFRHPKYYKELRKRNKSDQVISRGDSTEAGRRAPGPGLK |
| Ga0098036_11927561 | 3300006929 | Marine | MEFRHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGPKQQA |
| Ga0098036_12427621 | 3300006929 | Marine | MWHHPKYYKELRKRNKSDQVISLRAHDGECERASGPGLKQQA |
| Ga0098046_11449421 | 3300006990 | Marine | MHVFKHPKYYKELRKRNKSDQVISETKPTGDGERAPGQG |
| Ga0075468_101551552 | 3300007229 | Aqueous | MVFYHPKYYKELRKRNKLDQVISNAEATAASERAP |
| Ga0075468_102073392 | 3300007229 | Aqueous | MFRHPKYYKELRKRNKSDRVISGAEATAEVERAPGQGLRGQ |
| Ga0099847_10891743 | 3300007540 | Aqueous | MFRHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGL |
| Ga0099847_12159861 | 3300007540 | Aqueous | MWHHPKYYKELRKRNKLDQAISKEPATAGNQRSPGPGPKQ |
| Ga0110931_10120195 | 3300007963 | Marine | MFEFKHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGLKVSSC |
| Ga0110931_10455121 | 3300007963 | Marine | MWYHPKYYKELRKRNKLDQAISKEPATAGNQRSPGPG |
| Ga0110931_10928381 | 3300007963 | Marine | MVNTKMFRHPKYYKELRKRNKLDQAISKEPATAGNQRSPGPG |
| Ga0110931_10938083 | 3300007963 | Marine | MFRHPKYYKELRKRNKSDRVISNAEATAASERAPGQGLK |
| Ga0110931_10985413 | 3300007963 | Marine | MWYHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGLKVTSYKQQA |
| Ga0110931_11317372 | 3300007963 | Marine | MFRHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGLKVSSC |
| Ga0110931_12223781 | 3300007963 | Marine | MWHHPKYYKELRKRNKLDQAISKEPATAGNQRSPGPGPK |
| Ga0114898_11195432 | 3300008216 | Deep Ocean | MHEFKHPKYYKELRKLRNKLDQAISEPSATAQVERAPDPGPK |
| Ga0114905_10252601 | 3300008219 | Deep Ocean | MFVFKHPKYYKELRKRNKSDRVISNAEATAASERAPGQGLK |
| Ga0114905_10443361 | 3300008219 | Deep Ocean | MEFKHPKYYKELRKRNKSDQVISHSASTEANSRRAPG |
| Ga0114905_12301621 | 3300008219 | Deep Ocean | MFRHPKYYKELRKLRNKLDQAISEPSATAQVERAPDPG |
| Ga0102854_11711222 | 3300009058 | Estuarine | MFRHPKYYKELRKRNKLDQAISEPSSTEQVERAPGPGLKR |
| Ga0114908_12752112 | 3300009418 | Deep Ocean | MFVFKHPKYYKELRKRNKSDQAISEPSSTEQVERAPGP |
| Ga0114932_101400471 | 3300009481 | Deep Subsurface | MFRHPKYYKELRKLRNKLDQAISEPSATAQVERAPDPGPKQQA |
| Ga0114932_101514221 | 3300009481 | Deep Subsurface | MFRHPKYYKELRKRNKSDQAISEPSSTEQVERAPGPGLK |
| Ga0114925_112250171 | 3300009488 | Deep Subsurface | MFKHPNYYKELRKLRNKLDQAISETKPTGDGERAPGPGLKHQA |
| Ga0115011_114082781 | 3300009593 | Marine | MFRHPKYYKELRKLRNKSDQVISPRVATASARRAPGP |
| Ga0114901_11409111 | 3300009604 | Deep Ocean | MHEFKHPKYYKELRKLRNKLDQAISEPSATAQVERAPDP |
| Ga0114933_104797251 | 3300009703 | Deep Subsurface | MWRHPKYYKELRKLRNKLDQAISEPSATAQVERAPDPGPKQQA |
| Ga0114933_109800461 | 3300009703 | Deep Subsurface | MFRHTKYYKELRKLRNKLDQAISEPSATAQVERAPDPG |
| Ga0115012_114177382 | 3300009790 | Marine | MHVFKHPKYYKELRKRNKSDQVISETKPTGDGERAPGQ |
| Ga0115012_116467212 | 3300009790 | Marine | MHVFKHPKYYKELRKRNKSDQAISSEAHDGERERAPGPGLKLQASSGK |
| Ga0115012_118731121 | 3300009790 | Marine | MFRHPKYYKELRKRNKSDQAISQLAEPVAGRRAPGQGQQL |
| Ga0098043_10250521 | 3300010148 | Marine | MHVFKHPKYYKELRERNKLDQAISKEPATAGNQRSPGPGPK |
| Ga0098043_11324002 | 3300010148 | Marine | MWRHPKYYKELRKRNKSDQVISLRAHDGECERAPGQGLK |
| Ga0098043_11506782 | 3300010148 | Marine | MHVFKHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGLKQQ |
| Ga0098056_11111071 | 3300010150 | Marine | MHVFKHPKYYKELRKRNKSDQVISSKNRDGECERAPGQGLK |
| Ga0098056_11807981 | 3300010150 | Marine | MWHHPKYYKELRKRNKSDQVISPEAHDGERERAPGPGLKQQA |
| Ga0098056_12394332 | 3300010150 | Marine | MVNIKMVFYHPKYYKELRKRNKSDQVISSKNRDGECERAPGQGL |
| Ga0098061_10584561 | 3300010151 | Marine | MTHIFHHPKYYKELRKRNKSDQVISSKSSTEQLQRAPGSGHKHQ |
| Ga0098059_10513061 | 3300010153 | Marine | MTHIFHHPKYYKELRKRNKSDQVISSKSSTEQLQRAPG |
| Ga0098059_10599913 | 3300010153 | Marine | MWHHPKYYKELRKRNKSDQVISLRAHDGECERAPGPGLKQQAA |
| Ga0160423_101112591 | 3300012920 | Surface Seawater | MHVFRHPKYYKELRERNKLDQAISKEPATAGNQRSPGP |
| Ga0160423_102398291 | 3300012920 | Surface Seawater | MHVFKHPKYYTELRKRNKLDQVISRGDSTEAGRRAPG |
| Ga0160423_102487103 | 3300012920 | Surface Seawater | MWHHPKYYKELRKRNKSDQVISGASATAPVQRAPGPGLKPQ |
| Ga0160423_104070101 | 3300012920 | Surface Seawater | MFVFKHPKYYKELRERNKLDQAISKEPATAGNQRSPGP |
| Ga0160423_108953741 | 3300012920 | Surface Seawater | MFRHPKYYKELRKRNKSDQVISETKPTGDGERAPGQG |
| Ga0160423_109376771 | 3300012920 | Surface Seawater | MHVFKHPKYYTELRKLRNKSDQVISDECATAPRERAPGR |
| Ga0160423_110234951 | 3300012920 | Surface Seawater | MHVFKHPKYYKELRERNKLDQAISKEPATAGNQRSP |
| Ga0160423_110261053 | 3300012920 | Surface Seawater | MWRHPKYYKELRKRNKSDQVISSCSSSTELAQRAPGPGLSEKV |
| Ga0163109_107037101 | 3300012936 | Surface Seawater | MFRHPKYYKELRKLRNKSDQVISDECATAPRERAPG |
| Ga0163108_107455282 | 3300012950 | Seawater | MTFVFKHPKYYKELRSRNKLDQAISLRELETSAGERSPGPGLKL |
| Ga0116836_10114512 | 3300013181 | Marine | MFVFKHPKYYTELRKRNKSDQAISSESGTPPNERAPGPGPKLQA |
| Ga0182052_13479093 | 3300016742 | Salt Marsh | MTFTFKHPKYYKELRTRNKSDQVISGANATAKVERAPGPGHK |
| Ga0181372_10584702 | 3300017705 | Marine | MWRHPKYYKELRKRNKSDQVISSKSSTEQLQRAPGSGHK |
| Ga0181387_10638891 | 3300017709 | Seawater | MHEFKHPKYYTELRKRNKSDQAISKEPATAGNQRSPGPG |
| Ga0181404_10861812 | 3300017717 | Seawater | MVFIKMWHHPKYYKELRKRNKSDQVISKEPATAGNQRAP |
| Ga0181383_11029222 | 3300017720 | Seawater | MFRHPKYYKELRKRNKSDQVISSESGTPPNERAPGPGLKQQAPS |
| Ga0181388_10607502 | 3300017724 | Seawater | MEFKHPKYYKELRKRNKSDQVISRKDSTEARRRAPGPGLKQ |
| Ga0181396_10817022 | 3300017729 | Seawater | MEFKHPKYYKELRKRNKLDQAISKEPATAGNQRSPG |
| Ga0181415_10079075 | 3300017732 | Seawater | MFRHPKYYKELRKRNKSDQVISSESGTPPNERAPGPGLKPRYT |
| Ga0181415_11371302 | 3300017732 | Seawater | MHVFKHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGLK |
| Ga0181426_11072112 | 3300017733 | Seawater | MEFTKMFRHPKYYKELRKRNKSDQVISKEPATAGNQ |
| Ga0187218_10499313 | 3300017737 | Seawater | MEFKHPKYYKELRKRNKLDQAISKEPATAGNQRSPGPGLKPQAA |
| Ga0181433_10383961 | 3300017739 | Seawater | MFRHPKYYKELRKLRNKLDQAISEPSATAQVERAPDPGPKQQ |
| Ga0181433_10680312 | 3300017739 | Seawater | MVNIDMFKHPKYYKELRKRNKSDQVISSGSEGSALPQRAPGQG |
| Ga0181421_11796002 | 3300017741 | Seawater | MFRHPKYYKELRKRNKLDQAISKEPATAGNQRSPGPGLKPQAA |
| Ga0181397_11953682 | 3300017744 | Seawater | MWKHPKYYKELRKLRNKLDQAISEPSSTEQVERAPDPG |
| Ga0181427_11390701 | 3300017745 | Seawater | MHVFKHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPG |
| Ga0181382_10979991 | 3300017756 | Seawater | MFRHPKYYKELRKRNKSDQAISESSATAQAKRAPGPG |
| Ga0181409_10895812 | 3300017758 | Seawater | MTHVFKHPKYYTELRKRNKSDQVISKEPATAGNQRAPG |
| Ga0181385_10570753 | 3300017764 | Seawater | MHVFKHPKYYKELRKRNKSDQVISNAEATAASERAPGQGQ |
| Ga0181413_12036642 | 3300017765 | Seawater | MEIRHPKYYKELRKLRNRVVQSSRTDSPQSDQAISEPSSTEQVERAPGPGLKRQAT |
| Ga0181406_10339315 | 3300017767 | Seawater | MVNIKMHVFKHPKYYKELRKRNKSDQVISKEPATAGNQRA |
| Ga0187220_10511081 | 3300017768 | Seawater | MHVFKHPKYYKELRKRNKSDQVISNAEATAASERAPGQG |
| Ga0181425_11358002 | 3300017771 | Seawater | MWRHPKYYKELRKLRNNSDQAISKESSTEENQRAPD |
| Ga0181430_11667101 | 3300017772 | Seawater | MVNTKMFRHPKYYKELRKLRNNSDQVISGANATAKVER |
| Ga0181386_10857003 | 3300017773 | Seawater | MHTFKHPKYYKELRKRNKSDQVISNAEATAASERAPGQGHKPQ |
| Ga0181386_11134831 | 3300017773 | Seawater | MHVFKHPKYYKELRKRNKSDQVISNAEATAASERAPGQGQSIKP |
| Ga0181395_11820901 | 3300017779 | Seawater | MHVFKHPKYYKELRKRNKSDQVISNAEATAASERAP |
| Ga0181379_12689691 | 3300017783 | Seawater | MFRHPKYYKELRKRNKSDQVISSESGTPPNERAPGPGLKQQAPSNK |
| Ga0181577_108994562 | 3300017951 | Salt Marsh | MHVFKHPKYYTELRKRNKSDRVISGAEATAEVERAPGQGLQ |
| Ga0181580_108363912 | 3300017956 | Salt Marsh | MWHHPKYYKELRKRNKSDQAISSESGTPPNERATGPGHKLQARE |
| Ga0181571_106643181 | 3300017957 | Salt Marsh | MSFTFKHPKYYKELRERNKLDQAISKEPATAGNQRS |
| Ga0181590_105909341 | 3300017967 | Salt Marsh | MVNTSMFVFKHPKYYKELRERNKSDQVISKEPATAGNQRAPGPGHK |
| Ga0181590_108087642 | 3300017967 | Salt Marsh | MWRHPKYYKELRKRNKSDQAISKEPATAGNQRSPGPGLK |
| Ga0181560_102180861 | 3300018413 | Salt Marsh | MSFTFKHPKYYKELRERNKLDQAISKEPATAGNQRSP |
| Ga0181560_105345521 | 3300018413 | Salt Marsh | MEFRHPKYYKELRKLRNKLDQAISDECATAPRERSPGPGPKR |
| Ga0181553_102117233 | 3300018416 | Salt Marsh | MWRHPKYYKELRKRNKLDQVISSDTATAASERAPG |
| Ga0181563_101185531 | 3300018420 | Salt Marsh | MWHHPKYYKELRKRNKSDRVISGAEATAEVERAPGQG |
| Ga0181568_103046081 | 3300018428 | Salt Marsh | MSFTFKHPKYYKELRERNKLDQAISKEPATAGNQRSPGP |
| Ga0181568_114837702 | 3300018428 | Salt Marsh | MWHHPKYYKELRKRNKSDRVISGAEATAEVERAPGQGLQPAS |
| Ga0194029_10212213 | 3300019751 | Freshwater | MLVYRHPKYYTEIRKRAKEQQKELRKRNKSDRVISGAEATAEVERAPG |
| Ga0181570_105564792 | 3300020207 | Salt Marsh | MFRHPKYYKELRKRNKSDQAISSESGTPPNERATGP |
| Ga0211522_10406171 | 3300020314 | Marine | MWHHPKYYKELRKLRNKSDQAISKEPATAGNQRSPG |
| Ga0211597_10290081 | 3300020320 | Marine | MWHHPKYYKELRKLRNKLDQAISKEPATAGNQRSPG |
| Ga0211647_102922321 | 3300020377 | Marine | MFRHPKYYKELRKRNKSDQIISPRVATASARRASGPGLQQEEE |
| Ga0211659_102297312 | 3300020404 | Marine | MHVFKHPKYYKELRERNKSDQVISKEPATAGNQRAPGPGL |
| Ga0211659_102366671 | 3300020404 | Marine | MVNTKMFRHPKYYKELRKRNKLDQAISKEPATAGNQRSPG |
| Ga0211651_103465132 | 3300020408 | Marine | MVFYHPKYYKELRKRNKLDQAISKEPATAGNQRSPGPGPKAS |
| Ga0211699_100578785 | 3300020410 | Marine | MFRHPKYYKELRKLRNKLDQAISKEPATAGNQRAPGP |
| Ga0211699_100995613 | 3300020410 | Marine | MEFKHPKYYKELRRRNKLDQAISKPEPTGHARVRPGPGL |
| Ga0211516_102860861 | 3300020413 | Marine | MEFRHPKYYKELRKLRNKLDQSISLSPGDGQVERSTGPG |
| Ga0211528_102116862 | 3300020417 | Marine | MHEFKHPKYYKELRERNKSDQVISSEAHDGERERAPGPGL |
| Ga0211708_100398991 | 3300020436 | Marine | MHVFKHPKYYKELRSIRNKSDQAISSEDHDGDRERAPGPGHKLPDST |
| Ga0211559_105711672 | 3300020442 | Marine | MEFKHPKYYKELRARNKSDQAISKEPATAGNQRASD |
| Ga0224906_10800051 | 3300022074 | Seawater | MHVFKHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGLKQR |
| Ga0255756_11828401 | 3300022905 | Salt Marsh | MSFTFKHPKYYKELRERNKLDQAISKEPATAGNQRSPGPGP |
| Ga0255783_103385382 | 3300022923 | Salt Marsh | MWRHPKYYKELRKRNKSDQAISKEPATAGNQRSPGSGLKQQGSG |
| Ga0255773_102494872 | 3300022925 | Salt Marsh | MSFTFKHPKYYKELRERNKLDQAISKEPATAGNQRSPGPGPKQQAS |
| Ga0255752_102617961 | 3300022929 | Salt Marsh | MHVFKHPKYYTELRKRNKSDRVISGAEATAEVERAPGQG |
| Ga0255752_103608331 | 3300022929 | Salt Marsh | MWHHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGLKL |
| (restricted) Ga0233427_101793563 | 3300022933 | Seawater | MFYHPKYYKELRKRNKSDQVISKSSHDGESERAPGP |
| Ga0255781_103124591 | 3300022934 | Salt Marsh | MHVFKHPKYYTELRKRNKSDRVISGAEATAEVERAPGQGL |
| (restricted) Ga0233436_12019131 | 3300024243 | Seawater | MHEFKHPKYYKELRKRNKSDQVISKSSHDGESERAPGPGLKPQDNNAS |
| Ga0233451_101895972 | 3300024301 | Salt Marsh | MSFTFKHPKYYTELRKRNKLDQAISKEPATAGNQRSP |
| Ga0209992_100672284 | 3300024344 | Deep Subsurface | MFRHPKYYKELRKLRNKLDQAISEPSATAQVERAPDPGPKQQAT |
| Ga0208157_10504712 | 3300025086 | Marine | MFRHPKYYKELRKRNKSDQVISETTATANGERAPGPGQQHQ |
| Ga0208157_10887231 | 3300025086 | Marine | MFRHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGLKVSSCKLQ |
| Ga0208434_10330435 | 3300025098 | Marine | MTHIFHHPKYYKELRKRNKLDQVISKQQATASSTRAPGPGLKP |
| Ga0208669_11160261 | 3300025099 | Marine | MFRHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGLKVSS |
| Ga0208159_10281762 | 3300025101 | Marine | MVFIKMWHHPKYYKELRKRNKSDQVISKEPATAGN |
| Ga0208159_10298232 | 3300025101 | Marine | MFRHPKYYKELRKRNKSDQVISKQQATASGERSPGP |
| Ga0208159_10305961 | 3300025101 | Marine | MHEFKHPKYYKELRKRNKSDQVISETTATANGERAPG |
| Ga0208159_10308572 | 3300025101 | Marine | MFRHPKYYKELRKRNKSDQVISETTATANGERAPG |
| Ga0208159_10589361 | 3300025101 | Marine | MFRHPKYYKELRKRNKSDQIISPRVATASARRASG |
| Ga0208159_10605732 | 3300025101 | Marine | MVNIDMFRHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPG |
| Ga0208159_10726951 | 3300025101 | Marine | MVNTKMHIFRHPKYYTELRKRNKSDQAISKESSTEENQRAPG |
| Ga0208666_10654123 | 3300025102 | Marine | MHVFKHPKYYKELRERNKSDQVISKEPATAGNQRAPGPGLKQQAASAKLQA |
| Ga0208666_10776813 | 3300025102 | Marine | MVNTNMFRHPKYYKELRKRNKSDQVISETTATANGERAPGPGQQH |
| Ga0208158_10155395 | 3300025110 | Marine | MFEFKHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGLKVSSYKLPGPRP |
| Ga0208158_10251431 | 3300025110 | Marine | MWHHPKYYKELRKRNKSDQVISLRAHDGECERAPGPGLKQQAASAK |
| Ga0208158_10355682 | 3300025110 | Marine | MFRHPKYYKELRKRNKSDQVISETTATANGERAPGPGQQHQASS |
| Ga0208158_10515262 | 3300025110 | Marine | MWRHPKYYKELRKRNKSDQVISNAEATAASERALGPGLKLP |
| Ga0208158_10803722 | 3300025110 | Marine | MWYHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGLKVTSYKQ |
| Ga0208158_10875461 | 3300025110 | Marine | MVNTNMFRHPKYYKELRKRNKSDQVISETTATANGERAPGPGQQHQA |
| Ga0209349_12057662 | 3300025112 | Marine | MFRHPKYYKELRKLRNKSDQAISQLAEPVAGRRAPGQ |
| Ga0209535_10411186 | 3300025120 | Marine | MEFKHPKYYKELRKRNKSDQVISNAEATAASQRAPGPG |
| Ga0209434_10912423 | 3300025122 | Marine | MWHHPKYYKELRKRNKSDRAISSKNSTEESERSPGPGLKLRHGGLTP |
| Ga0209644_11188511 | 3300025125 | Marine | MEFKHPKYYKELRKRNKSDQVISETKPTGDGERAPGQGL |
| Ga0209348_10573561 | 3300025127 | Marine | MEFTKMFRHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPGLQ |
| Ga0209348_11140593 | 3300025127 | Marine | MWHHPKYYKELRKRNKSDQVISRGDSTEAGRRAPGPGLKQQ |
| Ga0209348_11163972 | 3300025127 | Marine | MWRHPKYYKELRKRNKSDQVISKQQATASGERSPGPGLK |
| Ga0209348_11371292 | 3300025127 | Marine | MFRHPKYYKELRKLRNKLDQAISEPSATAQVERAP |
| Ga0209348_11411551 | 3300025127 | Marine | MWRHPKYYKELRKRNKSDQVISPEAHDGERERAPGPGLKQQAA |
| Ga0209348_11574912 | 3300025127 | Marine | MTFIFKHPKYYKELRKLRNKSDQAISARETADDARAT |
| Ga0209348_11669211 | 3300025127 | Marine | MFRHPKYYKELRKLRNKLDQVISSEAGDGERERSPGP |
| Ga0208919_10181231 | 3300025128 | Marine | MHVFKHPKYYKELRERNKSDQVISKEPATAGNQRAPDPGLKQQA |
| Ga0208919_11304231 | 3300025128 | Marine | MVNTNMFRHPKYYKELRKRNKSDQVISETTATANGERAPGPGQQHQASSAK |
| Ga0208919_11325381 | 3300025128 | Marine | MVNTNMFRHPKYYKELRKRNKSDQVISGANATAKVERAPGPGQ |
| Ga0208919_11586561 | 3300025128 | Marine | MFRHPKYYKELRERNKSDQIISPRVATATARRASGPGHKLQA |
| Ga0209232_10573651 | 3300025132 | Marine | MFRHPKYYKELRKRNKSDQIISPRVATASARRASGPGQQ |
| Ga0209232_10594351 | 3300025132 | Marine | MWRHPKYYKELRKRNKLDQVISETKPTGDGERAPG |
| Ga0209232_10810053 | 3300025132 | Marine | MWHHPKYYKELRKLRNKSDQAISSEAGDGKRERAPGQGHKPQASSAK |
| Ga0209232_10885612 | 3300025132 | Marine | MFRHPKYYKELRKRNKSDRVISGAEATAEVERAPGQGLKRQ |
| Ga0209232_10979361 | 3300025132 | Marine | MFRHPNYYKELRKRNKSDQAISSEAGDGKRERAPGQGHKPQASSAK |
| Ga0209232_11153792 | 3300025132 | Marine | MWYHPKYYKELRKRNKSDQVISETKPTGDGERAPGQ |
| Ga0209232_11530581 | 3300025132 | Marine | MTFYHPKYYKELRKRNKLDQAISDAEATAASERATGPG |
| Ga0209232_12203651 | 3300025132 | Marine | MFRHPKYYKELRKRNKSDQAISLRESETSAGERAPG |
| Ga0208299_11991672 | 3300025133 | Marine | MHEFKHPNYYKELRKRNKSDQVISRGDSTEAGRRAPGP |
| Ga0209756_11170073 | 3300025141 | Marine | MFRHPKYYKELRKRNKLDQVISSEVHDGARERAPGPGL |
| Ga0209756_11963081 | 3300025141 | Marine | MFTFKHPKYYKELRKLRNKLDQSISSSPGDGQVER |
| Ga0209756_12691341 | 3300025141 | Marine | MHVFKHPKYYKELRKRNKSDQVISSKNRDGECERAPGQGLKHQASSSKPQ |
| Ga0209756_13139632 | 3300025141 | Marine | MTHIFQHPKHYKELRKRNKSDQVISSKSSTEQLQRAPGSGHK |
| Ga0209645_10339734 | 3300025151 | Marine | MFRHPKYYKELRKRNKSDQVISGASATAPVQRAPG |
| Ga0209645_10429751 | 3300025151 | Marine | MFRHPKYYKELRKRNKSDQVISGANATAKVERAPG |
| Ga0209645_11009532 | 3300025151 | Marine | MWKHPKYYKELRKRNKSDQVISGANATAKVERAPG |
| Ga0209645_11211653 | 3300025151 | Marine | MFEFKHPKYYKELRKRNKSDQVISPLAKPVAGRRAPGPGLK |
| Ga0209645_11343742 | 3300025151 | Marine | MFRHPKYYKELRRRNKSDQVISPRVATASARRAPGP |
| Ga0209645_11822102 | 3300025151 | Marine | MFRHPKYYKELRKRNKSDQIISPRVATASARRASGP |
| Ga0208449_11346392 | 3300025280 | Deep Ocean | MFVFKHPKYYTELRKRNKSDQVISKEPATAGNQRAPDPGLKLPGPR |
| Ga0208316_10905311 | 3300025296 | Deep Ocean | MFRHPKYYKELRKRNKSDQSISLREDSTEPGERSTGPGLKLPGP |
| Ga0208684_11312131 | 3300025305 | Deep Ocean | MFRHPKYYKELRKLRNKLDQAISEPSATAQVERAPD |
| Ga0208899_11518512 | 3300025759 | Aqueous | MFRHPKYYKELRKRNKSDRVISGAEATAEVERAPGQGQQH |
| Ga0209757_100516321 | 3300025873 | Marine | MYYHPNYYKELRKRNKLDQVISRGDSTEAGRRAPG |
| Ga0208641_12014321 | 3300026268 | Marine | MFEFKHPKYYKELRKRNKSDQVISSKSSTEQLQRAPGSGHKLQASSSK |
| Ga0209404_110057602 | 3300027906 | Marine | MWYHPKYYKELRKRNKSDRVISGAEATAASERAPGQGL |
| Ga0256382_10594863 | 3300028022 | Seawater | MFRHPKYYKELRKLRNKSDQAISNAEATAASERATGPG |
| Ga0183683_10305272 | 3300029309 | Marine | MVNIDMWHHPKYYKELRKRNKSDQAISTSDSTECSDKRAPGQG |
| Ga0185543_10362051 | 3300029318 | Marine | MWRHPKYYKELRKLRNKLDQVISETKPTGDGERAPGPGL |
| Ga0183755_10293125 | 3300029448 | Marine | MHVFKHPKYYKELRERNKSDQVISKEPATAGNQRAPGPGLKPQA |
| Ga0183755_10854002 | 3300029448 | Marine | MHVFKHPKYYKELRKRNKSDQAISSKSSTEQLQRAPGSGLKPQAS |
| Ga0183757_10251041 | 3300029787 | Marine | MFKHPKYYKELRKRNNSDRAISKESSTEENQRAPGPGLK |
| Ga0315315_105106484 | 3300032073 | Seawater | MHTFKHPKYYKELRKRNKSDQVISNAEATAASERAPGQGHKPQAPSFKLS |
| Ga0315315_117281252 | 3300032073 | Seawater | MEFTKMFRHPKYYKELRKRNKSDQVISKEPATAGNQRAPGPG |
| ⦗Top⦘ |