


| Basic Information | |
|---|---|
| Family ID | F018929 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 232 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MTNEEISELLNKESYRIWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 232 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 53.02 % |
| % of genes near scaffold ends (potentially truncated) | 19.83 % |
| % of genes from short scaffolds (< 2000 bps) | 69.83 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.68 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.879 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (14.655 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.621 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.345 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.00% β-sheet: 0.00% Coil/Unstructured: 48.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 232 Family Scaffolds |
|---|---|---|
| PF13640 | 2OG-FeII_Oxy_3 | 4.31 |
| PF01521 | Fe-S_biosyn | 2.59 |
| PF04973 | NMN_transporter | 2.59 |
| PF02945 | Endonuclease_7 | 2.16 |
| PF06067 | DUF932 | 1.72 |
| PF01844 | HNH | 1.72 |
| PF08007 | JmjC_2 | 0.86 |
| PF07235 | DUF1427 | 0.86 |
| PF09834 | DUF2061 | 0.86 |
| PF13578 | Methyltransf_24 | 0.86 |
| PF00255 | GSHPx | 0.86 |
| PF00011 | HSP20 | 0.86 |
| PF14279 | HNH_5 | 0.86 |
| PF00436 | SSB | 0.86 |
| PF04488 | Gly_transf_sug | 0.86 |
| PF12849 | PBP_like_2 | 0.86 |
| PF02467 | Whib | 0.86 |
| PF13524 | Glyco_trans_1_2 | 0.86 |
| PF00850 | Hist_deacetyl | 0.43 |
| PF04860 | Phage_portal | 0.43 |
| PF04577 | Glyco_transf_61 | 0.43 |
| PF05050 | Methyltransf_21 | 0.43 |
| PF05901 | Excalibur | 0.43 |
| PF01755 | Glyco_transf_25 | 0.43 |
| PF00154 | RecA | 0.43 |
| PF00037 | Fer4 | 0.43 |
| PF09723 | Zn-ribbon_8 | 0.43 |
| PF00082 | Peptidase_S8 | 0.43 |
| PF14025 | DUF4241 | 0.43 |
| PF01583 | APS_kinase | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 232 Family Scaffolds |
|---|---|---|---|
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 2.59 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 2.59 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 2.59 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.86 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.86 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.86 |
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 0.86 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.43 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.43 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.88 % |
| All Organisms | root | All Organisms | 46.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035265000|ErSWdraf_F5BXKTZ02GKZ6F | Not Available | 505 | Open in IMG/M |
| 2035265000|ErSWdraf_F5BXKTZ02JZUCD | Not Available | 548 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1014819 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300000756|JGI12421J11937_10005465 | Not Available | 5025 | Open in IMG/M |
| 3300000756|JGI12421J11937_10014338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2998 | Open in IMG/M |
| 3300000756|JGI12421J11937_10020426 | Not Available | 2446 | Open in IMG/M |
| 3300000756|JGI12421J11937_10070786 | Not Available | 1045 | Open in IMG/M |
| 3300000756|JGI12421J11937_10090733 | Not Available | 858 | Open in IMG/M |
| 3300002395|B570J29621_100042 | Not Available | 5577 | Open in IMG/M |
| 3300002408|B570J29032_109491559 | Not Available | 807 | Open in IMG/M |
| 3300002408|B570J29032_109543610 | Not Available | 856 | Open in IMG/M |
| 3300002835|B570J40625_100032846 | Not Available | 8061 | Open in IMG/M |
| 3300002835|B570J40625_100740022 | Not Available | 873 | Open in IMG/M |
| 3300002835|B570J40625_100750091 | Not Available | 866 | Open in IMG/M |
| 3300002835|B570J40625_100883780 | Not Available | 775 | Open in IMG/M |
| 3300003277|JGI25908J49247_10000873 | Not Available | 9422 | Open in IMG/M |
| 3300003394|JGI25907J50239_1109229 | Not Available | 538 | Open in IMG/M |
| 3300003395|JGI25917J50250_1122551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300003413|JGI25922J50271_10000797 | Not Available | 9277 | Open in IMG/M |
| 3300003413|JGI25922J50271_10001219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7555 | Open in IMG/M |
| 3300003429|JGI25914J50564_10026950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1696 | Open in IMG/M |
| 3300003429|JGI25914J50564_10065384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 947 | Open in IMG/M |
| 3300003490|JGI25926J51410_1020569 | All Organisms → Viruses → Predicted Viral | 1289 | Open in IMG/M |
| 3300003490|JGI25926J51410_1041242 | Not Available | 826 | Open in IMG/M |
| 3300003497|JGI25925J51416_10047621 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300003986|Ga0063233_10167062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 671 | Open in IMG/M |
| 3300004096|Ga0066177_10258069 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300004112|Ga0065166_10113916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 998 | Open in IMG/M |
| 3300004793|Ga0007760_10085050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300005517|Ga0070374_10210666 | Not Available | 999 | Open in IMG/M |
| 3300005517|Ga0070374_10258103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300005517|Ga0070374_10331330 | Not Available | 770 | Open in IMG/M |
| 3300005517|Ga0070374_10678196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 509 | Open in IMG/M |
| 3300005580|Ga0049083_10001350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9242 | Open in IMG/M |
| 3300005580|Ga0049083_10069225 | Not Available | 1236 | Open in IMG/M |
| 3300005581|Ga0049081_10030956 | All Organisms → Viruses → Predicted Viral | 2034 | Open in IMG/M |
| 3300005582|Ga0049080_10220928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300005583|Ga0049085_10005852 | Not Available | 4870 | Open in IMG/M |
| 3300005583|Ga0049085_10102040 | Not Available | 990 | Open in IMG/M |
| 3300005583|Ga0049085_10272988 | Not Available | 552 | Open in IMG/M |
| 3300005584|Ga0049082_10004817 | All Organisms → Viruses → Predicted Viral | 4459 | Open in IMG/M |
| 3300005584|Ga0049082_10035544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1746 | Open in IMG/M |
| 3300005584|Ga0049082_10181648 | Not Available | 724 | Open in IMG/M |
| 3300005584|Ga0049082_10328324 | Not Available | 508 | Open in IMG/M |
| 3300005585|Ga0049084_10166786 | Not Available | 763 | Open in IMG/M |
| 3300005662|Ga0078894_10186516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1875 | Open in IMG/M |
| 3300005662|Ga0078894_10525924 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300005805|Ga0079957_1004238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11966 | Open in IMG/M |
| 3300005805|Ga0079957_1007210 | Not Available | 8772 | Open in IMG/M |
| 3300005805|Ga0079957_1103003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1551 | Open in IMG/M |
| 3300005941|Ga0070743_10112736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 911 | Open in IMG/M |
| 3300005941|Ga0070743_10211153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 635 | Open in IMG/M |
| 3300006484|Ga0070744_10000666 | Not Available | 10049 | Open in IMG/M |
| 3300006484|Ga0070744_10001725 | Not Available | 6590 | Open in IMG/M |
| 3300006484|Ga0070744_10010729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2722 | Open in IMG/M |
| 3300006484|Ga0070744_10013918 | All Organisms → Viruses → Predicted Viral | 2385 | Open in IMG/M |
| 3300006484|Ga0070744_10096003 | Not Available | 857 | Open in IMG/M |
| 3300006639|Ga0079301_1072751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1080 | Open in IMG/M |
| 3300007546|Ga0102874_1089144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300007546|Ga0102874_1091223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 965 | Open in IMG/M |
| 3300007546|Ga0102874_1119386 | Not Available | 828 | Open in IMG/M |
| 3300007547|Ga0102875_1071745 | Not Available | 1120 | Open in IMG/M |
| 3300007551|Ga0102881_1240001 | Not Available | 502 | Open in IMG/M |
| 3300007553|Ga0102819_1054591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 673 | Open in IMG/M |
| 3300007590|Ga0102917_1153590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 808 | Open in IMG/M |
| 3300007590|Ga0102917_1194267 | Not Available | 709 | Open in IMG/M |
| 3300007593|Ga0102918_1238599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 556 | Open in IMG/M |
| 3300007627|Ga0102869_1166575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300007642|Ga0102876_1057998 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300007644|Ga0102902_1188175 | Not Available | 610 | Open in IMG/M |
| 3300007661|Ga0102866_1081293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300007708|Ga0102859_1164239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300007974|Ga0105747_1078638 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300007992|Ga0105748_10065106 | Not Available | 1424 | Open in IMG/M |
| 3300007992|Ga0105748_10250233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300008052|Ga0102893_1189262 | Not Available | 596 | Open in IMG/M |
| 3300008055|Ga0108970_10828618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
| 3300008107|Ga0114340_1003252 | Not Available | 9174 | Open in IMG/M |
| 3300008107|Ga0114340_1007157 | Not Available | 7314 | Open in IMG/M |
| 3300008108|Ga0114341_10101090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1752 | Open in IMG/M |
| 3300008110|Ga0114343_1025432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2543 | Open in IMG/M |
| 3300008110|Ga0114343_1071474 | Not Available | 1273 | Open in IMG/M |
| 3300008116|Ga0114350_1000743 | Not Available | 38180 | Open in IMG/M |
| 3300008259|Ga0114841_1001023 | Not Available | 19570 | Open in IMG/M |
| 3300009024|Ga0102811_1075732 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300009026|Ga0102829_1264787 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009026|Ga0102829_1326942 | Not Available | 514 | Open in IMG/M |
| 3300009059|Ga0102830_1107414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 826 | Open in IMG/M |
| 3300009068|Ga0114973_10286970 | Not Available | 880 | Open in IMG/M |
| 3300009068|Ga0114973_10592394 | Not Available | 569 | Open in IMG/M |
| 3300009079|Ga0102814_10027594 | All Organisms → Viruses → Predicted Viral | 3231 | Open in IMG/M |
| 3300009152|Ga0114980_10351628 | Not Available | 850 | Open in IMG/M |
| 3300009152|Ga0114980_10580595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300009158|Ga0114977_10537589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300009159|Ga0114978_10149048 | Not Available | 1508 | Open in IMG/M |
| 3300009159|Ga0114978_10294795 | Not Available | 995 | Open in IMG/M |
| 3300009180|Ga0114979_10010067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6137 | Open in IMG/M |
| 3300009183|Ga0114974_10246074 | All Organisms → Viruses → Predicted Viral | 1072 | Open in IMG/M |
| 3300009184|Ga0114976_10263798 | Not Available | 931 | Open in IMG/M |
| 3300009184|Ga0114976_10305106 | Not Available | 851 | Open in IMG/M |
| 3300009184|Ga0114976_10578973 | Not Available | 571 | Open in IMG/M |
| 3300009185|Ga0114971_10169205 | Not Available | 1308 | Open in IMG/M |
| 3300009419|Ga0114982_1000472 | Not Available | 21651 | Open in IMG/M |
| 3300009419|Ga0114982_1030482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1751 | Open in IMG/M |
| 3300010312|Ga0102883_1238455 | Not Available | 510 | Open in IMG/M |
| 3300010374|Ga0114986_1027792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
| 3300010885|Ga0133913_10203218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5280 | Open in IMG/M |
| 3300010965|Ga0138308_159246 | Not Available | 1488 | Open in IMG/M |
| 3300011010|Ga0139557_1091132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 505 | Open in IMG/M |
| 3300011116|Ga0151516_10482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19526 | Open in IMG/M |
| 3300012000|Ga0119951_1087486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 772 | Open in IMG/M |
| 3300012665|Ga0157210_1036658 | Not Available | 761 | Open in IMG/M |
| 3300013005|Ga0164292_10359218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
| 3300013372|Ga0177922_10045101 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300013372|Ga0177922_10800337 | Not Available | 738 | Open in IMG/M |
| 3300017774|Ga0181358_1022151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2532 | Open in IMG/M |
| 3300019784|Ga0181359_1022624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2389 | Open in IMG/M |
| 3300020141|Ga0211732_1018707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3253 | Open in IMG/M |
| 3300020141|Ga0211732_1085082 | All Organisms → cellular organisms → Bacteria | 4438 | Open in IMG/M |
| 3300020141|Ga0211732_1213095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → unclassified Acidiferrobacteraceae → Acidiferrobacteraceae bacterium | 975 | Open in IMG/M |
| 3300020141|Ga0211732_1595850 | All Organisms → Viruses → Predicted Viral | 2478 | Open in IMG/M |
| 3300020151|Ga0211736_10361315 | Not Available | 811 | Open in IMG/M |
| 3300020151|Ga0211736_10822639 | Not Available | 794 | Open in IMG/M |
| 3300020159|Ga0211734_10671045 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter | 3331 | Open in IMG/M |
| 3300020159|Ga0211734_10909747 | Not Available | 631 | Open in IMG/M |
| 3300020159|Ga0211734_11132921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7666 | Open in IMG/M |
| 3300020160|Ga0211733_10176330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1964 | Open in IMG/M |
| 3300020161|Ga0211726_10072033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3985 | Open in IMG/M |
| 3300020161|Ga0211726_10111479 | All Organisms → Viruses → Predicted Viral | 2752 | Open in IMG/M |
| 3300020161|Ga0211726_10500117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31288 | Open in IMG/M |
| 3300020162|Ga0211735_11321254 | Not Available | 958 | Open in IMG/M |
| 3300020172|Ga0211729_10079684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1082 | Open in IMG/M |
| 3300020172|Ga0211729_11229929 | Not Available | 672 | Open in IMG/M |
| 3300020205|Ga0211731_11372596 | Not Available | 759 | Open in IMG/M |
| 3300020205|Ga0211731_11467946 | Not Available | 671 | Open in IMG/M |
| 3300020519|Ga0208223_1001032 | Not Available | 6295 | Open in IMG/M |
| 3300020530|Ga0208235_1013247 | Not Available | 1040 | Open in IMG/M |
| 3300020536|Ga0207939_1000424 | Not Available | 12786 | Open in IMG/M |
| 3300021141|Ga0214163_1101528 | Not Available | 665 | Open in IMG/M |
| 3300021519|Ga0194048_10000992 | Not Available | 14070 | Open in IMG/M |
| 3300021519|Ga0194048_10196631 | Not Available | 747 | Open in IMG/M |
| 3300021962|Ga0222713_10597972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 644 | Open in IMG/M |
| 3300023174|Ga0214921_10000213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 115201 | Open in IMG/M |
| 3300023174|Ga0214921_10002171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32302 | Open in IMG/M |
| 3300023174|Ga0214921_10003743 | Not Available | 22995 | Open in IMG/M |
| 3300023174|Ga0214921_10117720 | Not Available | 1922 | Open in IMG/M |
| 3300023301|Ga0209414_1000657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16777 | Open in IMG/M |
| 3300024343|Ga0244777_10115586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1733 | Open in IMG/M |
| 3300024343|Ga0244777_10154962 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
| 3300024346|Ga0244775_10001832 | Not Available | 23992 | Open in IMG/M |
| 3300024346|Ga0244775_10012800 | Not Available | 7897 | Open in IMG/M |
| 3300024346|Ga0244775_10030604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 4798 | Open in IMG/M |
| 3300024346|Ga0244775_10118807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2241 | Open in IMG/M |
| 3300024346|Ga0244775_11212531 | Not Available | 587 | Open in IMG/M |
| 3300024348|Ga0244776_10343676 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300024348|Ga0244776_10923075 | Not Available | 515 | Open in IMG/M |
| 3300027084|Ga0208443_1056353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 814 | Open in IMG/M |
| 3300027193|Ga0208800_1028507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300027224|Ga0208164_1073147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300027244|Ga0208173_1034688 | Not Available | 951 | Open in IMG/M |
| 3300027259|Ga0208178_1090119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 542 | Open in IMG/M |
| 3300027418|Ga0208022_1088297 | Not Available | 649 | Open in IMG/M |
| 3300027529|Ga0255077_1006586 | All Organisms → Viruses → Predicted Viral | 2063 | Open in IMG/M |
| 3300027563|Ga0209552_1061558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1048 | Open in IMG/M |
| 3300027563|Ga0209552_1176549 | Not Available | 539 | Open in IMG/M |
| 3300027578|Ga0255075_1089452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 534 | Open in IMG/M |
| 3300027581|Ga0209651_1001110 | Not Available | 9698 | Open in IMG/M |
| 3300027586|Ga0208966_1000092 | Not Available | 27611 | Open in IMG/M |
| 3300027586|Ga0208966_1036782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1421 | Open in IMG/M |
| 3300027586|Ga0208966_1038910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1377 | Open in IMG/M |
| 3300027621|Ga0208951_1049712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1226 | Open in IMG/M |
| 3300027642|Ga0209135_1208662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 598 | Open in IMG/M |
| 3300027642|Ga0209135_1260691 | Not Available | 511 | Open in IMG/M |
| 3300027644|Ga0209356_1220697 | Not Available | 506 | Open in IMG/M |
| 3300027697|Ga0209033_1033844 | All Organisms → Viruses → Predicted Viral | 1942 | Open in IMG/M |
| 3300027707|Ga0209443_1314135 | Not Available | 518 | Open in IMG/M |
| 3300027710|Ga0209599_10000020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 124368 | Open in IMG/M |
| 3300027720|Ga0209617_10055102 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1071011 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter | 1702 | Open in IMG/M |
| 3300027734|Ga0209087_1155415 | Not Available | 915 | Open in IMG/M |
| 3300027736|Ga0209190_1077191 | Not Available | 1592 | Open in IMG/M |
| 3300027746|Ga0209597_1124548 | Not Available | 1131 | Open in IMG/M |
| 3300027763|Ga0209088_10012036 | Not Available | 4641 | Open in IMG/M |
| 3300027763|Ga0209088_10063750 | All Organisms → Viruses → Predicted Viral | 1757 | Open in IMG/M |
| 3300027769|Ga0209770_10091130 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300027782|Ga0209500_10151127 | Not Available | 1093 | Open in IMG/M |
| 3300027797|Ga0209107_10004060 | Not Available | 8128 | Open in IMG/M |
| 3300027797|Ga0209107_10081930 | Not Available | 1758 | Open in IMG/M |
| 3300027797|Ga0209107_10084322 | All Organisms → Viruses → Predicted Viral | 1729 | Open in IMG/M |
| 3300027797|Ga0209107_10396602 | Not Available | 630 | Open in IMG/M |
| 3300027805|Ga0209229_10012348 | All Organisms → Viruses → Predicted Viral | 3630 | Open in IMG/M |
| 3300027836|Ga0209230_10118567 | Not Available | 1487 | Open in IMG/M |
| 3300027892|Ga0209550_10062007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2955 | Open in IMG/M |
| 3300027892|Ga0209550_10569321 | Not Available | 669 | Open in IMG/M |
| 3300027976|Ga0209702_10141148 | Not Available | 1074 | Open in IMG/M |
| 3300028025|Ga0247723_1000015 | Not Available | 109057 | Open in IMG/M |
| 3300028025|Ga0247723_1002961 | Not Available | 8706 | Open in IMG/M |
| 3300028025|Ga0247723_1007917 | Not Available | 4451 | Open in IMG/M |
| 3300028025|Ga0247723_1012984 | Not Available | 3107 | Open in IMG/M |
| 3300028025|Ga0247723_1017033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2552 | Open in IMG/M |
| 3300028025|Ga0247723_1100513 | Not Available | 731 | Open in IMG/M |
| 3300028025|Ga0247723_1116378 | Not Available | 657 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1240589 | Not Available | 618 | Open in IMG/M |
| 3300031787|Ga0315900_11003805 | Not Available | 548 | Open in IMG/M |
| 3300032116|Ga0315903_10899515 | Not Available | 633 | Open in IMG/M |
| 3300033992|Ga0334992_0285267 | Not Available | 780 | Open in IMG/M |
| 3300033992|Ga0334992_0538389 | Not Available | 500 | Open in IMG/M |
| 3300033996|Ga0334979_0023640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4144 | Open in IMG/M |
| 3300034018|Ga0334985_0004747 | Not Available | 10993 | Open in IMG/M |
| 3300034062|Ga0334995_0076311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2619 | Open in IMG/M |
| 3300034062|Ga0334995_0107414 | Not Available | 2101 | Open in IMG/M |
| 3300034062|Ga0334995_0466053 | Not Available | 770 | Open in IMG/M |
| 3300034062|Ga0334995_0632150 | Not Available | 616 | Open in IMG/M |
| 3300034066|Ga0335019_0139622 | Not Available | 1603 | Open in IMG/M |
| 3300034068|Ga0334990_0044179 | Not Available | 2386 | Open in IMG/M |
| 3300034082|Ga0335020_0056218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2061 | Open in IMG/M |
| 3300034082|Ga0335020_0116893 | Not Available | 1354 | Open in IMG/M |
| 3300034082|Ga0335020_0307236 | Not Available | 776 | Open in IMG/M |
| 3300034093|Ga0335012_0269618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300034093|Ga0335012_0271778 | Not Available | 870 | Open in IMG/M |
| 3300034093|Ga0335012_0505259 | Not Available | 573 | Open in IMG/M |
| 3300034101|Ga0335027_0000061 | Not Available | 94529 | Open in IMG/M |
| 3300034101|Ga0335027_0027460 | Not Available | 4779 | Open in IMG/M |
| 3300034101|Ga0335027_0348636 | Not Available | 980 | Open in IMG/M |
| 3300034104|Ga0335031_0487324 | Not Available | 753 | Open in IMG/M |
| 3300034106|Ga0335036_0538639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300034106|Ga0335036_0816689 | Not Available | 538 | Open in IMG/M |
| 3300034109|Ga0335051_0330908 | Not Available | 733 | Open in IMG/M |
| 3300034116|Ga0335068_0352092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300034121|Ga0335058_0767968 | Not Available | 527 | Open in IMG/M |
| 3300034279|Ga0335052_0268910 | Not Available | 953 | Open in IMG/M |
| 3300034283|Ga0335007_0120564 | Not Available | 1914 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.66% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.22% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 13.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.62% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.90% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.17% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 3.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.45% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.02% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.16% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.16% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.29% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.29% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.86% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.86% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.86% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.86% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.43% |
| Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.43% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.43% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002395 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027224 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027259 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_14030910 | 2035265000 | Freshwater | LSNEEIAKLLDQESYRVWDTTRVIKNQDYHDGLVKGLKMAAK |
| ErSWdraft_9601130 | 2035265000 | Freshwater | MTNEEIAKLLDQESYRVWXTAKVIKNQDYHDGLVKGS |
| LV_Brine_h2_0102DRAFT_10148193 | 3300000405 | Hypersaline | MTNEELSKALNQESYRVWDMAKVIKNQDYHDGVVKGIKMAAKYVAKLDTNQ* |
| JGI12421J11937_100054657 | 3300000756 | Freshwater And Sediment | LSNEEISKLLDQESYRIWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| JGI12421J11937_100143381 | 3300000756 | Freshwater And Sediment | LSNEEISKLLDQESYRIWDTAKAIKNQDYHDGLVKGLKMAAQYVAKL* |
| JGI12421J11937_100204265 | 3300000756 | Freshwater And Sediment | MTNEEISELLSKESYRIWDTPRVIKNQDYHDGVVRGLKMASMLV |
| JGI12421J11937_100707861 | 3300000756 | Freshwater And Sediment | KESYRIWDTPRVIKNQDYHDGVVRGLKMASMLVAKL* |
| JGI12421J11937_100907332 | 3300000756 | Freshwater And Sediment | MTNQEIAELLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL* |
| B570J29621_1000424 | 3300002395 | Freshwater | MTNQEISDLLNQESYRIWDTTKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| B570J29032_1094915593 | 3300002408 | Freshwater | VLKKEIAELLDKESYRIWDSAKVIKNQDYHDGLVKGLKMASQFVAKLNDI* |
| B570J29032_1095436103 | 3300002408 | Freshwater | MMLKKEIAELLDKESYRIWDSAKVIKNQDYHDGLVKGLKMASQFVAKL* |
| B570J40625_10003284612 | 3300002835 | Freshwater | MTNEEISELLNKESYRVWDTTRVIKNQDYHDGLVKGLKMAAQYVAKL* |
| B570J40625_1007400221 | 3300002835 | Freshwater | MSLDDIMLKKEISELLAKESYRIWDSAKVIKNQDYHDGLVKGLKMASEFVAKL* |
| B570J40625_1007500913 | 3300002835 | Freshwater | IRYSCSMTNEEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| B570J40625_1008837803 | 3300002835 | Freshwater | MTNEEIVELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| JGI25908J49247_1000087314 | 3300003277 | Freshwater Lake | MTNEEIADLLNKASYKIWDTAKVMKNQDYHDGVVKGLKMASNIVSKL* |
| JGI25907J50239_11092291 | 3300003394 | Freshwater Lake | NEEIADLLNKASYKIWDTAKVMKNQDYHDGVVKGLKMASNIVSKL* |
| JGI25917J50250_11225513 | 3300003395 | Freshwater Lake | MTNKEIAELLDKESYRIWDTTKVIKNQEYHDGVVRGLKMASILVGRL* |
| JGI25922J50271_100007974 | 3300003413 | Freshwater Lake | MTNEEISELLNKESYRVWDTARVIKNQDYHDGLVKGLKMAAKFVAKL* |
| JGI25922J50271_100012194 | 3300003413 | Freshwater Lake | MNTEEIAKLLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL* |
| JGI25914J50564_100269502 | 3300003429 | Freshwater Lake | MTNEEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| JGI25914J50564_100653844 | 3300003429 | Freshwater Lake | IAKLLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL* |
| JGI25926J51410_10205691 | 3300003490 | Freshwater Lake | MTNEEISELLNKESYRIWDTTKVIKNQDYHDGLVKGLKMASKFVSQLK* |
| JGI25926J51410_10412422 | 3300003490 | Freshwater Lake | MTNQEISELLNKESYRVWDTARVIKNQDYHDGLVKGLKMAAQYVAKL* |
| JGI25925J51416_100476214 | 3300003497 | Freshwater Lake | MTNEEISELLNKESYRIWDTTXVIKNQDYHDGLVKGXKMASKFVSQLK* |
| Ga0063233_101670622 | 3300003986 | Freshwater Lake | MTNEEISELLNKESYRIWDTTRVIKNQDYHDGLVKGLKMASKFVSQLK* |
| Ga0066177_102580693 | 3300004096 | Freshwater Lake | MTNEEISELLSKESYRIWDTPKVIKNQDYHDGVVRGLKMASMLVAKL* |
| Ga0065166_101139164 | 3300004112 | Freshwater Lake | MTNEEISELLNKESYRIWDTAKVIKNQDYHDGLVKGLKMASKFVSQLK* |
| Ga0007760_100850503 | 3300004793 | Freshwater Lake | ISELLNKESYRIWDTTRVIKNQDYHDGLVKGLKMASKFVSQLK* |
| Ga0070374_102106662 | 3300005517 | Freshwater Lake | MFDHYRVYMTNEEIVELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| Ga0070374_102581033 | 3300005517 | Freshwater Lake | MTNKEIAELLDQESYRIWDTTKVIKNQDYHDGVVRGLKMASILVGKL* |
| Ga0070374_103313302 | 3300005517 | Freshwater Lake | MTNEEISELLNKESYRVWDTARVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0070374_106781962 | 3300005517 | Freshwater Lake | MGYLGMTNQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0049083_1000135018 | 3300005580 | Freshwater Lentic | LSNEEIAKLLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| Ga0049083_100692254 | 3300005580 | Freshwater Lentic | MTNQEIADLLNKASYKIWDTTKVMKNQDYHDGVVKGLKMASNIVSKL* |
| Ga0049081_100309567 | 3300005581 | Freshwater Lentic | LSNEEIAKLLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAARLVAKL* |
| Ga0049080_102209283 | 3300005582 | Freshwater Lentic | MTNEEISELLNKESYRIWDTPRVIKNQDYHDGVVRGLKMASMLVAKL* |
| Ga0049085_100058522 | 3300005583 | Freshwater Lentic | MTNKEISKLLDLMIESIWDTKKVIKNQDYQDGLVKGLKLASKLFGKL* |
| Ga0049085_101020402 | 3300005583 | Freshwater Lentic | MTNQEISDLLDKESYRIWDTTKVIKNQDYHDGLVRGLKMASILVGRL* |
| Ga0049085_102729881 | 3300005583 | Freshwater Lentic | ELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0049082_1000481715 | 3300005584 | Freshwater Lentic | MNNEEIAALLDKESYRVWDTAKVIKNQDYHDGLVKGLKMAAKYVAKL* |
| Ga0049082_100355445 | 3300005584 | Freshwater Lentic | MTNKEIAEILDKESYRIWDTTKVIKNQEYHDGVVRGLKMASILVGRL* |
| Ga0049082_101816481 | 3300005584 | Freshwater Lentic | MTNQEIAELLSKASYKIWDTTKIMKNQDYHDGVVKGLKMASNIVSKL* |
| Ga0049082_103283242 | 3300005584 | Freshwater Lentic | MTNQEIAELLSKASYKIWDTTKVMKNQDYHDGVVKGLKMASNIVSKL* |
| Ga0049084_101667862 | 3300005585 | Freshwater Lentic | MSLDDIMLKKEIAEILDKASYRIWDTTKVIKNQDYHDGVVKGLKMASNIVSKL* |
| Ga0078894_101865162 | 3300005662 | Freshwater Lake | MTNEEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0078894_105259241 | 3300005662 | Freshwater Lake | VPNMGYLGMTNQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0079957_100423825 | 3300005805 | Lake | MNTDDTVLKKEIANLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL* |
| Ga0079957_100721020 | 3300005805 | Lake | MTNQEISDLLNKESYKVWDTTKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0079957_11030032 | 3300005805 | Lake | MENKEIADLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMASNLVAKL* |
| Ga0070743_101127363 | 3300005941 | Estuarine | MVLKMQISDRLKQESYDVWDRVKVIKNQDYHDGVVKGLKMAADLVAKL* |
| Ga0070743_102111531 | 3300005941 | Estuarine | MTNEEISALLDKESYRVWDTARVIKNQDYHDGLVKGLKMAAKFVAKL* |
| Ga0070744_100006668 | 3300006484 | Estuarine | MTNQEIATLLDQESYRIWDTAKVIKNQDYHDGLVKGLKMASKLVAKL* |
| Ga0070744_100017255 | 3300006484 | Estuarine | MGYLGMTNEEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0070744_100107295 | 3300006484 | Estuarine | MMLKKEIAELLDKESYRIWDRAKVIKNQDYHDGLVKGLKMASQFVAKL* |
| Ga0070744_100139184 | 3300006484 | Estuarine | MDIDEMVLKMQISDRLKQESYDVWDRVKVIKNQDYHDGVVKGLKMAADLVAKL* |
| Ga0070744_100960032 | 3300006484 | Estuarine | LSNEEIAKLLDQESYRVWDTTKVIKNQDYHDGVVRGLKMASIFVGKL* |
| Ga0079301_10727513 | 3300006639 | Deep Subsurface | MTNQEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMASQYVAKL* |
| Ga0102874_10891442 | 3300007546 | Estuarine | MTNKEIAILLDQESYRIWDTTKVIKNQDYHDGVVRGLKMAAILVGKL* |
| Ga0102874_10912232 | 3300007546 | Estuarine | MTNQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0102874_11193862 | 3300007546 | Estuarine | MTNQEISALLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| Ga0102875_10717452 | 3300007547 | Estuarine | MTNQKISELINKESYRIWDTTKVIKNQDYHDGVVRGLKMAAILVGKL* |
| Ga0102881_12400011 | 3300007551 | Estuarine | MTKQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0102819_10545913 | 3300007553 | Estuarine | MTNEEISALLDKESYRVWDTARVIKNQDYHDGLVKGLKMAADLVAKL* |
| Ga0102917_11535904 | 3300007590 | Estuarine | LYNRSMTNKEIAILLDQESYRIWDTTKVIKNQDYHDGVVRGLKMASILVGKL* |
| Ga0102917_11942672 | 3300007590 | Estuarine | MTNQEIAKLLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL* |
| Ga0102918_12385991 | 3300007593 | Estuarine | MTNEEISELLNKESYRIWDTAKVIKNQDYHDGLVKGL |
| Ga0102869_11665751 | 3300007627 | Estuarine | EISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0102876_10579981 | 3300007642 | Estuarine | ISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0102902_11881751 | 3300007644 | Estuarine | QEISALLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| Ga0102866_10812933 | 3300007661 | Estuarine | MTNQEISELLNKESYRIWDSTKVIKNQDYHDGVVKGLKMASILVGKL* |
| Ga0102859_11642392 | 3300007708 | Estuarine | MTNEEISDLLNKESYKVWDTAKVIKNQDYHDGLVKGLKMAAKFVAKL* |
| Ga0105747_10786383 | 3300007974 | Estuary Water | LSNEEIVKLLDQESYRVWDTTKVIKNQDYHDGVVKGLKMAAKLVAKL* |
| Ga0105748_100651061 | 3300007992 | Estuary Water | SLDDMMLKKEIAELLDKESYRIWDTTKVIKNQDYHDGIVKGLKMASQLVSKL* |
| Ga0105748_102502332 | 3300007992 | Estuary Water | SNEEIAKLLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| Ga0102893_11892621 | 3300008052 | Estuarine | MEIDEMVLKMQISDRLKQESYDVWDRVKVIKNQDYHDGVVKGLKMAADLVAKL* |
| Ga0108970_108286184 | 3300008055 | Estuary | MTNQEISDLLNKESYRVWDTNKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0114340_10032522 | 3300008107 | Freshwater, Plankton | MTNQEISDLLNKESYKVWDTAKVIKNQDYHDGLVKGLKMAAQFVSKLD* |
| Ga0114340_10071574 | 3300008107 | Freshwater, Plankton | MTNEEISELLNKESYRVWDTTKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0114341_101010905 | 3300008108 | Freshwater, Plankton | YMTNQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQFVAKL* |
| Ga0114343_10254322 | 3300008110 | Freshwater, Plankton | MTNQEISELLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL* |
| Ga0114343_10714741 | 3300008110 | Freshwater, Plankton | MLKQEIAYLLDKESYRIWDSAKVIKNQDYHDGLVKGLKMASEFVAKL* |
| Ga0114350_100074360 | 3300008116 | Freshwater, Plankton | MTNQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQFVAKL* |
| Ga0114841_100102353 | 3300008259 | Freshwater, Plankton | MTNQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKG |
| Ga0102811_10757324 | 3300009024 | Estuarine | MDIDEMVLKMQISDRLKQESYDVWDRVKVIKKQDYHDGVVKGLKMAADLVAKL* |
| Ga0102829_12647872 | 3300009026 | Estuarine | MTNQEIATLLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVSKL* |
| Ga0102829_13269421 | 3300009026 | Estuarine | MTNKEISKLLDLMIESIWDTNKVIKNQDYQDGLVKGLKLA |
| Ga0102830_11074144 | 3300009059 | Estuarine | MTNEEIAALLDKESYRVWDTAKVIKNQDYHDGLVKGLKMAAKYVAKL* |
| Ga0114973_102869701 | 3300009068 | Freshwater Lake | DDMMLKKEIAEILDKASYRIWDTTKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| Ga0114973_105923944 | 3300009068 | Freshwater Lake | SYRIWDTAKVMKNQDYHDGVVKGLKMASNIVSKL* |
| Ga0102814_1002759417 | 3300009079 | Estuarine | VPNMGYLGMTNEEISELLNKESYRVWDTAKVIKNQEYHDGLVKGLKMAAKFVAKL* |
| Ga0114980_103516284 | 3300009152 | Freshwater Lake | MGYLGMTNEEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAARYVAKL* |
| Ga0114980_105805952 | 3300009152 | Freshwater Lake | MTNQEIATLLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL* |
| Ga0114977_105375893 | 3300009158 | Freshwater Lake | MTTQEISELLNKESYRIWDTTKVIKNQDYHDGVVRGLKMASILVGKL* |
| Ga0114978_101490483 | 3300009159 | Freshwater Lake | MTNEEISELLSKESYRIWDTPRVIKNQDYHDGVVRGLKMASMLVAKL* |
| Ga0114978_102947952 | 3300009159 | Freshwater Lake | MTNEEISNLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| Ga0114979_1001006717 | 3300009180 | Freshwater Lake | MTNEEISNLLDKESYKIWDTTKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| Ga0114974_102460742 | 3300009183 | Freshwater Lake | MTNKEIAELLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL* |
| Ga0114976_102637982 | 3300009184 | Freshwater Lake | MLKKEIAEILDKASYRIWDTTKVIKNQDYHDGLVKGLKMASNIVSKL* |
| Ga0114976_103051063 | 3300009184 | Freshwater Lake | YDGYMTNEEISNLLDKESYKIWDTTKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| Ga0114976_105789731 | 3300009184 | Freshwater Lake | LLNKESYRVWDTARVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0114971_101692056 | 3300009185 | Freshwater Lake | DMMLKKEIAEILDKASYRIWDTTKVIKNQDYHDGLVKGLKMASNIVSKL* |
| Ga0114982_100047212 | 3300009419 | Deep Subsurface | MTNQEIAQLLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL* |
| Ga0114982_10304826 | 3300009419 | Deep Subsurface | MSLDDITLKKEIADLLNKESYRIWDTTKVIKNQDYHDGVVKGLKMASELVSKL* |
| Ga0102883_12384551 | 3300010312 | Estuarine | LNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0114986_10277922 | 3300010374 | Deep Subsurface | MRYLGMTNEEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0133913_102032188 | 3300010885 | Freshwater Lake | MTNQEIADLLNKESYRIWDSAKVIKNQDYHDGLVKGLKMAAKFVAKL* |
| Ga0138308_1592463 | 3300010965 | Lake Chemocline | MTNEEISALLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0139557_10911321 | 3300011010 | Freshwater | MTNEEISELLNKESYRIWDTARVIKNQDYHDGLVKGLKMASK |
| Ga0151516_104824 | 3300011116 | Freshwater | MTNEEISKLLDQESYRIWDTTKVIKNQDYHDGLVKGLKLASKLVAKL* |
| Ga0119951_10874862 | 3300012000 | Freshwater | MTNEEISELLNKESYRIWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL* |
| Ga0157210_10366581 | 3300012665 | Freshwater | MSLDEMMLKIEIADRLDQESYDVWDRARIIKNQDYHDGVVKGLKMAADLVRKL* |
| Ga0164292_103592184 | 3300013005 | Freshwater | MTNQEISELLDKESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVGKL* |
| Ga0177922_100451013 | 3300013372 | Freshwater | LNNEEIAKLLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL* |
| Ga0177922_108003373 | 3300013372 | Freshwater | AELLDQESYRIWDTTKVIKNQDYHDGVVRGLKMASILVGKL* |
| Ga0181358_10221512 | 3300017774 | Freshwater Lake | MTNEEISELLNKESYRIWDTTKVIKNQDYHDGLVKGLKMASKFVSQLK |
| Ga0181359_10226249 | 3300019784 | Freshwater Lake | MTNKEIAELLDKESYRIWDTTKVIKNQEYHDGVVRGLKMASILVGRL |
| Ga0211732_10187076 | 3300020141 | Freshwater | MTNEEISKLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0211732_10850822 | 3300020141 | Freshwater | MNTEEIAKLLDRESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0211732_12130952 | 3300020141 | Freshwater | MTNEEIAKLLDQESYRVWDTAKVIKNQDYHDGLVKGLKMASKFVAKL |
| Ga0211732_15958504 | 3300020141 | Freshwater | MTNQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQFVSKL |
| Ga0211736_103613153 | 3300020151 | Freshwater | LSNEEIAKLLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL |
| Ga0211736_108226391 | 3300020151 | Freshwater | MKYHFDDMTKEEISNLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMAARLVAKL |
| Ga0211734_106710451 | 3300020159 | Freshwater | MTNEEISNLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMAAKLVAKL |
| Ga0211734_109097472 | 3300020159 | Freshwater | MNTEEIAKLLDRESYRIWDITKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0211734_111329217 | 3300020159 | Freshwater | MSLDEMMLKIEIADRLDQESYDVWDRARIIKNQDYHDGVVKGLKMAADLVRKL |
| Ga0211733_101763303 | 3300020160 | Freshwater | MTNEEISELLNKESYRIWDTAKVIKNQDYHDGLVKGLKMASKFVSQLK |
| Ga0211726_100720335 | 3300020161 | Freshwater | MVLKMQISDRLKQESYDVWDRAKVIKNQDYHDGVVKGLEMASKLVAKL |
| Ga0211726_101114797 | 3300020161 | Freshwater | MNIDEMVLKIEISDLLDKESYRIWDSAKVIKNQDYHDGLVRGLKMASQFVAKL |
| Ga0211726_1050011747 | 3300020161 | Freshwater | MSLDEMMLKIEIADRLDQESFDVWDRARVIKNQDYHDGVVKGLKMAADLVRKL |
| Ga0211735_113212541 | 3300020162 | Freshwater | EISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQFVSKL |
| Ga0211729_100796845 | 3300020172 | Freshwater | VNNQEIADLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0211729_112299293 | 3300020172 | Freshwater | MKYHFDDMTKEEISNLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMAAKLVAKL |
| Ga0211731_113725961 | 3300020205 | Freshwater | MTNQEIAELLTKASYKIWDTTKVMKNQDYHDGVVKGLKMASNIVSKL |
| Ga0211731_114679462 | 3300020205 | Freshwater | MTNQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0208223_10010326 | 3300020519 | Freshwater | MTNEEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0208235_10132471 | 3300020530 | Freshwater | MSLDDMMLKKEIADLLNKESYRIWDSAKVIKNQDYHDGLVKGLKMASEFVSKL |
| Ga0207939_100042413 | 3300020536 | Freshwater | MTNQEISDLLNQESYRIWDTTKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0214163_11015282 | 3300021141 | Freshwater | MSLDDITLKKEISELLAKESYRVWDSAKVIKNQEYHDGLVKGLKMASEFVAKL |
| Ga0194048_100009923 | 3300021519 | Anoxic Zone Freshwater | MTNEEISALLDKESYRVWDTAKVIKNQDYHDGLVKGLKMAAKFVAKL |
| Ga0194048_101966313 | 3300021519 | Anoxic Zone Freshwater | MVLKIEIADALDKESYRVWDMSKVMKNQDYHDGVVKGLKLAAKFVRDKA |
| Ga0222713_105979722 | 3300021962 | Estuarine Water | MTNQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQFVAKL |
| Ga0214921_100002133 | 3300023174 | Freshwater | MTNEEIAELLNKESYRIWDTARVIKNQDYHDGLVKGLKMASKFVAKL |
| Ga0214921_1000217120 | 3300023174 | Freshwater | MENKEIADLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0214921_1000374348 | 3300023174 | Freshwater | MNIEEMVLKIEIADLLNKESYRVWDSAKVVKNQDYHDGLVKGLKMASIFVSKL |
| Ga0214921_101177204 | 3300023174 | Freshwater | MVLKIEIADRLDQESYDVWDRAKVIKNQDYHDGVVKGLKMAADLVRKL |
| Ga0209414_10006575 | 3300023301 | Hypersaline | MQRSKWLNAMTNEELSKALNQESYRVWDMAKVIKNQDYHDGVVKGIKMAAKYVAKLDTNQ |
| Ga0244777_101155862 | 3300024343 | Estuarine | MTNQKISELINKESYRIWDTTKVIKNQDYHDGVVRGLKMAAILVGKL |
| Ga0244777_101549623 | 3300024343 | Estuarine | MVLKMQISDRLKQESYDVWDRVKVIKNQDYHDGVVKGLKMAADLVAKL |
| Ga0244775_1000183219 | 3300024346 | Estuarine | MTNPEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0244775_1001280016 | 3300024346 | Estuarine | MTNQEIATLLDQESYRIWDTAKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0244775_100306047 | 3300024346 | Estuarine | MGYLGMTNEEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0244775_101188073 | 3300024346 | Estuarine | MMLKKEIAELLDKESYRIWDRAKVIKNQDYHDGLVKGLKMASQFVAKL |
| Ga0244775_112125312 | 3300024346 | Estuarine | MTNEEISALLDKESYRVWDTARVIKNQDYHDGLVKGLKMAAKFVAKL |
| Ga0244776_103436762 | 3300024348 | Estuarine | MTNEEISDLLNKESYKVWDTAKVIKNQDYHDGLVKGLKMAAKFVAKL |
| Ga0244776_109230751 | 3300024348 | Estuarine | MTNEEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0208443_10563532 | 3300027084 | Estuarine | MDIDEMVLKMQISDRLKQESYDVWDRVKVIKNQDYHDGVVKGLKMAADLVAKL |
| Ga0208800_10285073 | 3300027193 | Estuarine | MTNQEIATLLDQESYRIWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0208164_10731471 | 3300027224 | Estuarine | LSNEEIAKLLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLV |
| Ga0208173_10346882 | 3300027244 | Estuarine | MTNQKISELINKESYRIWDTTKVIKNQDYHDGVVRGLKMASILVGKL |
| Ga0208178_10901191 | 3300027259 | Estuarine | MVLKMQISDRLKQESYDVWDRVKVIKNQDYHDGVVKGLKMAADLVAK |
| Ga0208022_10882971 | 3300027418 | Estuarine | WRMTNEEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0255077_10065861 | 3300027529 | Freshwater | SNEEIAKLLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL |
| Ga0209552_10615582 | 3300027563 | Freshwater Lake | MTNQEISELLNKESYRVWDTARVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0209552_11765492 | 3300027563 | Freshwater Lake | MTNEEIADLLDKASYRIWDTTKVMKNQDYHDGVVKGLKMASNIVSKL |
| Ga0255075_10894522 | 3300027578 | Freshwater | MTNEEISELLNKESYRIWDTAKVIKNQDYHDGLVKGLKMAS |
| Ga0209651_100111017 | 3300027581 | Freshwater Lake | MTNEEISELLNKESYRIWDTTRVIKNQDYHDGLVKGLKMASKFVSQLK |
| Ga0208966_100009260 | 3300027586 | Freshwater Lentic | MNNEEIAALLDKESYRVWDTAKVIKNQDYHDGLVKGLKMAAKYVAKL |
| Ga0208966_10367823 | 3300027586 | Freshwater Lentic | VYGIGYNKNMTNKEIAEILDKESYRIWDTTKVIKNQEYHDGVVRGLKMASILVGRL |
| Ga0208966_10389104 | 3300027586 | Freshwater Lentic | MTNEEISELLSKESYRIWDTPKVIKNQDYHDGVVRGLKMASMLVAKL |
| Ga0208951_10497124 | 3300027621 | Freshwater Lentic | MTNQEIADLLNKASYKIWDTTKVMKNQDYHDGVVKGLKMASNIVSKL |
| Ga0209135_12086622 | 3300027642 | Freshwater Lake | MTNEEISELLNKESYRVWDTARVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0209135_12606912 | 3300027642 | Freshwater Lake | MTNEEIADLLNKASYKIWDTAKVMKNQDYHDGVVKGLKMASNIVSKL |
| Ga0209356_12206972 | 3300027644 | Freshwater Lake | NEEIADLLDKASYRIWDTTKVMKNQDYHDGVVKGLKMASNIVSKL |
| Ga0209033_10338443 | 3300027697 | Freshwater Lake | MFDHYRVYMTNEEIVELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL |
| Ga0209443_13141352 | 3300027707 | Freshwater Lake | MTNEEIADLLNKASYRIWDTTKVMKNQDYHDGVVKGLKMASNIVSKL |
| Ga0209599_10000020161 | 3300027710 | Deep Subsurface | MTNQEIAQLLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0209617_100551023 | 3300027720 | Freshwater And Sediment | LSNEEISKLLDQESYRIWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| (restricted) Ga0247833_10710112 | 3300027730 | Freshwater | MTNQEIADLLNQASYKVWDTAKVMKNQDYHDGVVKGLKMASNIVSKL |
| Ga0209087_11554153 | 3300027734 | Freshwater Lake | MSLDDIMLKKEIAEILDKASYRIWDTTKVIKNQDYHDGLVKGLKMASNIVSKL |
| Ga0209190_10771916 | 3300027736 | Freshwater Lake | MSLDDMMLKKEIAEILDKASYRIWDTTKVIKNQDYHDGLVKGLKMASNIVSKL |
| Ga0209597_11245481 | 3300027746 | Freshwater Lake | MMLKKEIAEILDKASYRIWDTTKVIKNQDYHDGLVKGLKMASNIVSKL |
| Ga0209088_1001203613 | 3300027763 | Freshwater Lake | MTNEEISNLLDKESYKIWDTTKVIKNQDYHDGLVKGLKMAAKLVAKL |
| Ga0209088_100637506 | 3300027763 | Freshwater Lake | MTNEEISELLSKESYRIWDTPRVIKNQDYHDGVVRGLKMASMLVAKL |
| Ga0209770_100911302 | 3300027769 | Freshwater Lake | MTNEEIVELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL |
| Ga0209500_101511271 | 3300027782 | Freshwater Lake | MGYLGMTNEEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAARYVAKL |
| Ga0209107_100040607 | 3300027797 | Freshwater And Sediment | LRVKLTLSNEEISKLLDQESYRIWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0209107_100819302 | 3300027797 | Freshwater And Sediment | MMLKKEIAELLDKESYRIWDMAKVMKNQDYHDGVVKGLKMASKFVEKL |
| Ga0209107_100843225 | 3300027797 | Freshwater And Sediment | LSNEEIAQLLNQESYRIWDSAKVIKNQDYHDGLVKGLKMASQFVAKL |
| Ga0209107_103966022 | 3300027797 | Freshwater And Sediment | MTNQEISELLDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0209229_100123489 | 3300027805 | Freshwater And Sediment | MTNQEIANILDKESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0209230_101185674 | 3300027836 | Freshwater And Sediment | MSLDDIMLKKEIAEILDKASYRIWDTTKVIKNQDYHDGVVKGLKMASNIVSKL |
| Ga0209550_100620077 | 3300027892 | Freshwater Lake | MGYLGMTNQEISDLLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0209550_105693212 | 3300027892 | Freshwater Lake | MTNEEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVAKLXILSNVLSVRW |
| Ga0209702_101411481 | 3300027976 | Freshwater | MTNEELSKALNQESYRVWDMAKVIKNQDYHDGVVKGIKMAAKYVAKLDTNQ |
| Ga0247723_100001596 | 3300028025 | Deep Subsurface Sediment | MTNQEISDLLNKESYKVWDTAKVIKNQDYHDGLVKGLKMAAQFVSKLD |
| Ga0247723_100296111 | 3300028025 | Deep Subsurface Sediment | MTNEEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMASKFVSQLK |
| Ga0247723_10079176 | 3300028025 | Deep Subsurface Sediment | MSLDDITLKKEIADLLNKESYRIWDTTKVIKNQDYHDGVVKGLKMASELVSKL |
| Ga0247723_10129845 | 3300028025 | Deep Subsurface Sediment | MSLDDTTLKKQISELLNKESYRVWDSAKVIKNQDYHDGLVKGLKMASEFVAKL |
| Ga0247723_10170333 | 3300028025 | Deep Subsurface Sediment | MSLDDIMLKKEISDLLNKESYRIWDSAKVIKNQDYHDGLVKGLKMASEFVAKL |
| Ga0247723_11005132 | 3300028025 | Deep Subsurface Sediment | MTNEEISALLDQESYRVWDSAKVIKNQDYHDGLVKGLKMAAKFVAKL |
| Ga0247723_11163781 | 3300028025 | Deep Subsurface Sediment | SDLLNKESYKVWDTTKVIKNQDYHDGLVKGLKMAAKLVAKL |
| (restricted) Ga0247832_12405891 | 3300028557 | Freshwater | ESYRVWDMAKVMKNQDYHDGVVKGLKMAAQFVAKL |
| Ga0315900_110038052 | 3300031787 | Freshwater | MSLDDMMLKKEIADLLNKESYRIWDSAKVIKNQDYHDGLVKGLKMASEFVAKLXL |
| Ga0315903_108995151 | 3300032116 | Freshwater | IPAQIRYSCSMTNEEISELLNKESYRVWDTTKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0334992_0285267_298_441 | 3300033992 | Freshwater | MTNQEISELLNKESYRIWDTTKVIKNQDYHDGLVRGLKMASILVGKL |
| Ga0334992_0538389_64_225 | 3300033992 | Freshwater | MSLDDMMLKKEIADLLNKESYRIWDSAKVIKNQDYHDGLVKGLKMAAKFVAKL |
| Ga0334979_0023640_536_697 | 3300033996 | Freshwater | MNTDDTVLKKEIANLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0334985_0004747_8552_8695 | 3300034018 | Freshwater | MTNEEISELLNKESYRVWDTTRVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0334995_0076311_713_874 | 3300034062 | Freshwater | MSLDDMMLKKEIAELLDKESYRIWDSAKVIKNQDYHDGLVKGLKMASQFVAKL |
| Ga0334995_0107414_1134_1295 | 3300034062 | Freshwater | MSLDDMMLKKEIADLLDKESYRIWDSAKVIKNQDYHDGLVKGLKMASIFVSKL |
| Ga0334995_0466053_578_739 | 3300034062 | Freshwater | MSLDDMMLKKEIADLLDKESYRIWDSAKVIKNQDYHDGLVKGLKMASEFVSKL |
| Ga0334995_0632150_359_520 | 3300034062 | Freshwater | MNIEEMVLKIEIADLLNKESYRVWDSAKVIKNQDYHDGLVKGLKMASQFVAKL |
| Ga0335019_0139622_1080_1223 | 3300034066 | Freshwater | MTSQEISELLNKESYRIWDTTKVIKNQDYHDGLVRGLKMAAILVGKL |
| Ga0334990_0044179_681_824 | 3300034068 | Freshwater | MSNEEIAKLLDQESYRVWDTAKVIKNQDYHDGLVKGLKMAAKLVAKL |
| Ga0335020_0056218_1885_2046 | 3300034082 | Freshwater | MNTDDTVLKKEIANLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVSKL |
| Ga0335020_0116893_473_634 | 3300034082 | Freshwater | MSLDDMMLKKEIAELLEKESYRIWDTAKVIKNQDYHDGVVKGLKMAAQFVSKL |
| Ga0335020_0307236_1_138 | 3300034082 | Freshwater | KKEIANLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0335012_0269618_360_506 | 3300034093 | Freshwater | MTNEEIASLLDKESYRIWDTTKVIKNQDYHDGLVKGLKMAAKFVRNQG |
| Ga0335012_0271778_690_833 | 3300034093 | Freshwater | MTNQEISELLNKESYRIWDTTKVIKNQDYHDGVVRGLKMASILVGKL |
| Ga0335012_0505259_232_375 | 3300034093 | Freshwater | MTNQEISDLLNKESYKVWDTTKVIKNQDYHDGVVKGLKMAAKLVAKL |
| Ga0335027_0000061_90010_90156 | 3300034101 | Freshwater | MSNEEIAALLDKESYRIWDTTKVIKNQDYHDGLVKGLKMAAKFVRNQI |
| Ga0335027_0027460_4261_4422 | 3300034101 | Freshwater | MSLDDMMLKKEIADLLDKESYRIWDSAKVIKNQDYHDGLVKGLKMASEFVAKL |
| Ga0335027_0348636_248_391 | 3300034101 | Freshwater | MTNEEISELLNKESYRIWDTTKVIKNQDYHDGLVKGLKMAAQYVAKL |
| Ga0335031_0487324_26_187 | 3300034104 | Freshwater | MSLDDMMLKKEIAELLDKESYRIWDSAKVIKNQDYHDGLVKGLKMASEFVAKL |
| Ga0335036_0538639_2_118 | 3300034106 | Freshwater | LNQESYRIWDSAKVIKNQDYHDGLVKGLKMASQFVAKL |
| Ga0335036_0816689_2_130 | 3300034106 | Freshwater | MSVDDMMLKKEIAELLNQESYRIWDSAKVIKNQDYHDGIVKGL |
| Ga0335051_0330908_599_733 | 3300034109 | Freshwater | MTNEEISELLNKESYRVWDTAKVIKNQDYHDGLVKGLKMAAQYVA |
| Ga0335068_0352092_470_631 | 3300034116 | Freshwater | MNTDNTVLKKEIADILDQESYRIWDTTKVIKNQDYHDGLVKGLKMASKLVAKL |
| Ga0335058_0767968_187_348 | 3300034121 | Freshwater | MKVRLTLSNEEISKLLDQESYRIWDTAKVIKNQDYHDGLVKGLKMAAKFVAKL |
| Ga0335052_0268910_3_164 | 3300034279 | Freshwater | MSLDDMMLKKEISELLDKESYRIWDSAKVIKNQDYHDGLVKGLKMASQFVAKL |
| Ga0335007_0120564_1454_1597 | 3300034283 | Freshwater | MLKKEISELLAKESYRIWDSAKVIKNQDYHDGLVKGLKMASEFVAKL |
| ⦗Top⦘ |