


| Basic Information | |
|---|---|
| Family ID | F018775 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 233 |
| Average Sequence Length | 41 residues |
| Representative Sequence | EYVGTSADNPYALEKQIPVFICRGAKFGTLAQLWPKVKRWR |
| Number of Associated Samples | 197 |
| Number of Associated Scaffolds | 233 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.71 % |
| % of genes from short scaffolds (< 2000 bps) | 92.70 % |
| Associated GOLD sequencing projects | 181 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.845 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.313 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.043 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.206 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.59% β-sheet: 10.14% Coil/Unstructured: 78.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 233 Family Scaffolds |
|---|---|---|
| PF09900 | DUF2127 | 15.45 |
| PF00171 | Aldedh | 4.72 |
| PF00009 | GTP_EFTU | 4.29 |
| PF04134 | DCC1-like | 3.43 |
| PF01764 | Lipase_3 | 3.43 |
| PF02353 | CMAS | 3.43 |
| PF06778 | Chlor_dismutase | 3.43 |
| PF00290 | Trp_syntA | 2.15 |
| PF00704 | Glyco_hydro_18 | 1.29 |
| PF16338 | AGL_N | 1.29 |
| PF13581 | HATPase_c_2 | 1.29 |
| PF03061 | 4HBT | 1.29 |
| PF03144 | GTP_EFTU_D2 | 1.29 |
| PF13802 | Gal_mutarotas_2 | 0.86 |
| PF02566 | OsmC | 0.86 |
| PF07238 | PilZ | 0.86 |
| PF05649 | Peptidase_M13_N | 0.86 |
| PF07883 | Cupin_2 | 0.86 |
| PF01432 | Peptidase_M3 | 0.86 |
| PF02604 | PhdYeFM_antitox | 0.43 |
| PF00581 | Rhodanese | 0.43 |
| PF01661 | Macro | 0.43 |
| PF00400 | WD40 | 0.43 |
| PF01641 | SelR | 0.43 |
| PF11611 | DUF4352 | 0.43 |
| PF04542 | Sigma70_r2 | 0.43 |
| PF11138 | DUF2911 | 0.43 |
| PF05015 | HigB-like_toxin | 0.43 |
| PF13186 | SPASM | 0.43 |
| PF09107 | SelB-wing_3 | 0.43 |
| PF04226 | Transgly_assoc | 0.43 |
| PF01609 | DDE_Tnp_1 | 0.43 |
| PF04191 | PEMT | 0.43 |
| PF02586 | SRAP | 0.43 |
| PF03235 | DUF262 | 0.43 |
| PF03486 | HI0933_like | 0.43 |
| PF13414 | TPR_11 | 0.43 |
| PF01895 | PhoU | 0.43 |
| PF01261 | AP_endonuc_2 | 0.43 |
| PF01053 | Cys_Met_Meta_PP | 0.43 |
| PF14534 | DUF4440 | 0.43 |
| PF08206 | OB_RNB | 0.43 |
| PF03644 | Glyco_hydro_85 | 0.43 |
| PF10387 | DUF2442 | 0.43 |
| PF02518 | HATPase_c | 0.43 |
| PF13676 | TIR_2 | 0.43 |
| PF12697 | Abhydrolase_6 | 0.43 |
| PF04116 | FA_hydroxylase | 0.43 |
| PF07690 | MFS_1 | 0.43 |
| PF14667 | Polysacc_synt_C | 0.43 |
| PF14310 | Fn3-like | 0.43 |
| PF15902 | Sortilin-Vps10 | 0.43 |
| PF00669 | Flagellin_N | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 233 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 4.72 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 4.72 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 4.72 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 3.43 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 3.43 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 3.43 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 3.43 |
| COG3253 | Coproheme decarboxylase/chlorite dismutase | Coenzyme transport and metabolism [H] | 3.43 |
| COG0159 | Tryptophan synthase alpha chain | Amino acid transport and metabolism [E] | 2.15 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 0.86 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.86 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.86 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.86 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.86 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 0.43 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.43 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.43 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.43 |
| COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 0.43 |
| COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.43 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.43 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.43 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.43 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.43 |
| COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 0.43 |
| COG1158 | Transcription termination factor Rho | Transcription [K] | 0.43 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.43 |
| COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 0.43 |
| COG1278 | Cold shock protein, CspA family | Transcription [K] | 0.43 |
| COG1344 | Flagellin and related hook-associated protein FlgL | Cell motility [N] | 0.43 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.43 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.43 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.43 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.43 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.43 |
| COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 0.43 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.43 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.43 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.43 |
| COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 0.43 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.43 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.43 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.43 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.43 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.43 |
| COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 0.43 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.43 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.43 |
| COG4724 | Endo-beta-N-acetylglucosaminidase D | Carbohydrate transport and metabolism [G] | 0.43 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.43 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.43 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.43 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.85 % |
| Unclassified | root | N/A | 8.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10460231 | Not Available | 756 | Open in IMG/M |
| 3300001686|C688J18823_10181862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300001867|JGI12627J18819_10280073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300002074|JGI24748J21848_1043680 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101025066 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300003321|soilH1_10112637 | All Organisms → cellular organisms → Bacteria | 3836 | Open in IMG/M |
| 3300004091|Ga0062387_100134176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1398 | Open in IMG/M |
| 3300004463|Ga0063356_100259969 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
| 3300004635|Ga0062388_102261941 | Not Available | 567 | Open in IMG/M |
| 3300004643|Ga0062591_101844518 | Not Available | 618 | Open in IMG/M |
| 3300005093|Ga0062594_103291178 | Not Available | 507 | Open in IMG/M |
| 3300005167|Ga0066672_10935698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300005438|Ga0070701_11304246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 519 | Open in IMG/M |
| 3300005439|Ga0070711_101488447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300005538|Ga0070731_10552645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300005542|Ga0070732_10331143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300005545|Ga0070695_100048872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2707 | Open in IMG/M |
| 3300005546|Ga0070696_101185876 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005556|Ga0066707_10727177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300005561|Ga0066699_11148394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300005563|Ga0068855_100125558 | All Organisms → cellular organisms → Bacteria | 2934 | Open in IMG/M |
| 3300005564|Ga0070664_100513179 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300005586|Ga0066691_10766254 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005598|Ga0066706_10621051 | Not Available | 858 | Open in IMG/M |
| 3300005614|Ga0068856_101960149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 596 | Open in IMG/M |
| 3300005618|Ga0068864_100844161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300005841|Ga0068863_101522264 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300006046|Ga0066652_100820654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300006046|Ga0066652_101010471 | Not Available | 789 | Open in IMG/M |
| 3300006102|Ga0075015_100174824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
| 3300006174|Ga0075014_100437973 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300006176|Ga0070765_100871901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 851 | Open in IMG/M |
| 3300006794|Ga0066658_10266343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300006796|Ga0066665_10946908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300006804|Ga0079221_10235761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1029 | Open in IMG/M |
| 3300006806|Ga0079220_11727449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300006893|Ga0073928_10340161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1114 | Open in IMG/M |
| 3300006914|Ga0075436_101375090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300007255|Ga0099791_10543910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300007258|Ga0099793_10051483 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300007265|Ga0099794_10782121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300009088|Ga0099830_11703627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009089|Ga0099828_11642825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300009111|Ga0115026_11170345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300009137|Ga0066709_101611462 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300009137|Ga0066709_102287903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300009137|Ga0066709_104194063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300009162|Ga0075423_10730675 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300009176|Ga0105242_10891868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300009545|Ga0105237_10566922 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300009635|Ga0116117_1045074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300009645|Ga0116106_1063832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
| 3300009764|Ga0116134_1318841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300010043|Ga0126380_10720377 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300010325|Ga0134064_10110043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300010335|Ga0134063_10268531 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300010343|Ga0074044_10436992 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300010343|Ga0074044_10807239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300010358|Ga0126370_10075494 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
| 3300010358|Ga0126370_10829654 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010360|Ga0126372_10440368 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300010360|Ga0126372_12400831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300010360|Ga0126372_12479830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300010376|Ga0126381_101589082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 945 | Open in IMG/M |
| 3300010376|Ga0126381_104460749 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010396|Ga0134126_10129258 | All Organisms → cellular organisms → Bacteria | 3080 | Open in IMG/M |
| 3300010397|Ga0134124_12640293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300010401|Ga0134121_10411289 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300011043|Ga0138528_146869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300011089|Ga0138573_1194424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300011120|Ga0150983_10733755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300011120|Ga0150983_16259614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300011269|Ga0137392_10155325 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
| 3300011269|Ga0137392_10183465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1705 | Open in IMG/M |
| 3300011269|Ga0137392_10355892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1213 | Open in IMG/M |
| 3300011269|Ga0137392_10528804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300011271|Ga0137393_10512232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300011271|Ga0137393_11195376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300011271|Ga0137393_11263682 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012040|Ga0137461_1044069 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300012096|Ga0137389_10536122 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300012189|Ga0137388_10260966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1579 | Open in IMG/M |
| 3300012189|Ga0137388_10486631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1146 | Open in IMG/M |
| 3300012199|Ga0137383_10475399 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300012201|Ga0137365_10957632 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012202|Ga0137363_10178947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1687 | Open in IMG/M |
| 3300012203|Ga0137399_11661078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300012205|Ga0137362_11391824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300012208|Ga0137376_11658206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300012209|Ga0137379_11531683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300012350|Ga0137372_10318051 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300012351|Ga0137386_10229718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1333 | Open in IMG/M |
| 3300012362|Ga0137361_10506160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300012582|Ga0137358_10100314 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300012582|Ga0137358_10353950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300012917|Ga0137395_10104971 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300012917|Ga0137395_10569719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300012917|Ga0137395_10742871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300012918|Ga0137396_10330143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300012924|Ga0137413_11008236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300012925|Ga0137419_10132079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1779 | Open in IMG/M |
| 3300012925|Ga0137419_11062981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300012927|Ga0137416_12139577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300012930|Ga0137407_10160867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1992 | Open in IMG/M |
| 3300012977|Ga0134087_10195579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300012986|Ga0164304_10049089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2288 | Open in IMG/M |
| 3300014494|Ga0182017_10447404 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300014501|Ga0182024_10818400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300014501|Ga0182024_12452029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300014745|Ga0157377_11065000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300014969|Ga0157376_10788078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 962 | Open in IMG/M |
| 3300015054|Ga0137420_1028859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300015242|Ga0137412_10908515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300015371|Ga0132258_13787887 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300017930|Ga0187825_10297937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300017932|Ga0187814_10285801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300017955|Ga0187817_10145354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1506 | Open in IMG/M |
| 3300017955|Ga0187817_11059704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300017973|Ga0187780_10540582 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300017995|Ga0187816_10040581 | Not Available | 1920 | Open in IMG/M |
| 3300018006|Ga0187804_10187574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
| 3300018012|Ga0187810_10177174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300018017|Ga0187872_10172803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300018030|Ga0187869_10306674 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300018046|Ga0187851_10153602 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300018047|Ga0187859_10251091 | Not Available | 950 | Open in IMG/M |
| 3300018047|Ga0187859_10580771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300018085|Ga0187772_10732835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300018086|Ga0187769_11528969 | Not Available | 505 | Open in IMG/M |
| 3300018088|Ga0187771_11810158 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300019786|Ga0182025_1150472 | Not Available | 1175 | Open in IMG/M |
| 3300020199|Ga0179592_10111545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1256 | Open in IMG/M |
| 3300020199|Ga0179592_10280289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300020579|Ga0210407_10621428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300021171|Ga0210405_10873773 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300021180|Ga0210396_10242941 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300021181|Ga0210388_11162832 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300021344|Ga0193719_10345551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300021405|Ga0210387_10367962 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300021407|Ga0210383_11598936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300021560|Ga0126371_11438526 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300021560|Ga0126371_11829713 | Not Available | 728 | Open in IMG/M |
| 3300024330|Ga0137417_1144251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300024330|Ga0137417_1495953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1972 | Open in IMG/M |
| 3300025812|Ga0208457_1036967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1093 | Open in IMG/M |
| 3300025885|Ga0207653_10350247 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300025906|Ga0207699_10773257 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300025913|Ga0207695_10062910 | All Organisms → cellular organisms → Bacteria | 3828 | Open in IMG/M |
| 3300025913|Ga0207695_10749485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300025914|Ga0207671_10290344 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300025914|Ga0207671_11199163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300025916|Ga0207663_10822309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300025927|Ga0207687_11827403 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300025949|Ga0207667_11117997 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter → Segetibacter koreensis | 771 | Open in IMG/M |
| 3300026088|Ga0207641_12272090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300026296|Ga0209235_1113567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1148 | Open in IMG/M |
| 3300026313|Ga0209761_1348536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300026318|Ga0209471_1303969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300026325|Ga0209152_10278762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300026332|Ga0209803_1220108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300026377|Ga0257171_1105795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300026523|Ga0209808_1242761 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300026528|Ga0209378_1134150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1032 | Open in IMG/M |
| 3300026538|Ga0209056_10604333 | Not Available | 553 | Open in IMG/M |
| 3300026548|Ga0209161_10253023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 913 | Open in IMG/M |
| 3300026550|Ga0209474_10017281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5642 | Open in IMG/M |
| 3300026557|Ga0179587_10380750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300027064|Ga0208724_1014759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300027439|Ga0209332_1094234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300027562|Ga0209735_1024203 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300027619|Ga0209330_1057420 | Not Available | 888 | Open in IMG/M |
| 3300027641|Ga0208827_1081127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
| 3300027648|Ga0209420_1111446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300027663|Ga0208990_1122270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300027671|Ga0209588_1035472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1603 | Open in IMG/M |
| 3300027678|Ga0209011_1121144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300027684|Ga0209626_1138448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300027729|Ga0209248_10155711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300027857|Ga0209166_10535784 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300027867|Ga0209167_10670030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300027884|Ga0209275_10005623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5211 | Open in IMG/M |
| 3300027889|Ga0209380_10017990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4006 | Open in IMG/M |
| 3300027905|Ga0209415_10213717 | Not Available | 1797 | Open in IMG/M |
| 3300028536|Ga0137415_10584314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300028552|Ga0302149_1189843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300028560|Ga0302144_10143663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300028574|Ga0302153_10315809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → Phenylobacterium zucineum | 534 | Open in IMG/M |
| 3300028731|Ga0302301_1085831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300028747|Ga0302219_10145182 | Not Available | 907 | Open in IMG/M |
| 3300028748|Ga0302156_10104162 | Not Available | 1433 | Open in IMG/M |
| 3300028906|Ga0308309_11392522 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300029903|Ga0247271_100354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12909 | Open in IMG/M |
| 3300029943|Ga0311340_10068986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4056 | Open in IMG/M |
| 3300029951|Ga0311371_10953974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300029999|Ga0311339_11123321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300030057|Ga0302176_10158179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300030399|Ga0311353_10007271 | All Organisms → cellular organisms → Bacteria | 13720 | Open in IMG/M |
| 3300030503|Ga0311370_10521703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1449 | Open in IMG/M |
| 3300030693|Ga0302313_10094762 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300030813|Ga0265750_1005279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1362 | Open in IMG/M |
| 3300030878|Ga0265770_1004313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1939 | Open in IMG/M |
| 3300031010|Ga0265771_1009043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300031234|Ga0302325_12307995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300031234|Ga0302325_12687076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300031247|Ga0265340_10124845 | Not Available | 1183 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1133100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300031525|Ga0302326_13530763 | Not Available | 519 | Open in IMG/M |
| 3300031708|Ga0310686_102874765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1671 | Open in IMG/M |
| 3300031708|Ga0310686_105953598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1213 | Open in IMG/M |
| 3300031708|Ga0310686_109802180 | All Organisms → cellular organisms → Bacteria | 3522 | Open in IMG/M |
| 3300031708|Ga0310686_114213427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300031712|Ga0265342_10100910 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300031753|Ga0307477_10122167 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300031754|Ga0307475_10086272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2428 | Open in IMG/M |
| 3300031820|Ga0307473_10466884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300031820|Ga0307473_11401704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300031823|Ga0307478_10720102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300031823|Ga0307478_11226890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300031912|Ga0306921_11534229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300031962|Ga0307479_11305064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300032043|Ga0318556_10219217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 991 | Open in IMG/M |
| 3300032126|Ga0307415_100348582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300032160|Ga0311301_12451348 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300032783|Ga0335079_12278222 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300032805|Ga0335078_10429980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1722 | Open in IMG/M |
| 3300032805|Ga0335078_11049509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300032805|Ga0335078_11187369 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300032895|Ga0335074_11007228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300032898|Ga0335072_11370304 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300032898|Ga0335072_11731486 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300033402|Ga0326728_10789883 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300034090|Ga0326723_0231918 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300034282|Ga0370492_0025695 | Not Available | 2420 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.15% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.15% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.29% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.29% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.86% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.86% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.43% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.43% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.43% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.43% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.43% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011043 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_104602311 | 3300001593 | Forest Soil | FDSVQFVGISPDNPYALETEIGVDICRGPKFGTLAQLWPALKKWR* |
| C688J18823_101818623 | 3300001686 | Soil | VQYVGTSADNPYALEKKLDVFICRGSKFGTLADLWPKLKKWR* |
| JGI12627J18819_102800731 | 3300001867 | Forest Soil | LWEHVQYVGTSADNPYALEKRIDVFLCKGAKFGTLSQLWPRLKKWG* |
| JGI24748J21848_10436801 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | KVEYAGRSADNPYALEKEIPFFIVHGPKFGSLQEAWPRLKKWR* |
| JGIcombinedJ26739_1010250661 | 3300002245 | Forest Soil | SAPNPYALEAEISVNICHGAKFGTMADLWPKIKHWR* |
| soilH1_101126371 | 3300003321 | Sugarcane Root And Bulk Soil | LRKLFNTVQYVGTSADNPYALEKEIPVYICRGSKFGTMEQLWPRLKHWR* |
| Ga0062387_1001341761 | 3300004091 | Bog Forest Soil | VGTSAPNPYALEQQIDVYICRGPKFGTLAQIWPKIKHWR* |
| Ga0063356_1002599691 | 3300004463 | Arabidopsis Thaliana Rhizosphere | EQKFDKVEYAGRSADNPYALEKEIPFFIVHGPKFGSLQEAWPRLKKWR* |
| Ga0062388_1022619411 | 3300004635 | Bog Forest Soil | LETYFDSVQFVGISADNPYALEKEIGVDICRGRKFGTLAQMWPELKKWR* |
| Ga0062591_1018445182 | 3300004643 | Soil | FEHVELVGTSDNPYALERNITVWICKGSKFGSLAQLWPKLKKWR* |
| Ga0062594_1032911781 | 3300005093 | Soil | EFVGTSDNPYALERNITVWLCKGAKFGSLQQLWPKLKKWR* |
| Ga0066672_109356981 | 3300005167 | Soil | EHIEYVGKSADNPYALEREIPIFICRGAKFGTLAELWPRLKKWR* |
| Ga0070701_113042462 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | EYVGTSEDNPYALEKNIDVFICKGAKFGTLAQLWPKLKHWR* |
| Ga0070711_1014884472 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VGTSADNPYALEKKIDVHICKGPKFGTLAQLWPKLKRWR* |
| Ga0070731_105526451 | 3300005538 | Surface Soil | GDSADNPYALEKDIPVFICRGAKFGTMAQLWPRIKRWR* |
| Ga0070732_103311431 | 3300005542 | Surface Soil | LFYDVQYVAESNSPYALENHIPVFLCRGKKFSSLAALWPRLKKWD* |
| Ga0070695_1000488721 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | FDHVEYVGSSDNPYALERHIPVFICKGAKFGSLAKLWPQLKKWR* |
| Ga0070696_1011858762 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | HVEYVGSSDSPYALERNIPVFICKGAKFGSLAQIWPQLKKWR* |
| Ga0066707_107271772 | 3300005556 | Soil | EYVGKSSDNPYAMEREIPVFICRGAKFGSLAGIWPRLKRWR* |
| Ga0066699_111483942 | 3300005561 | Soil | SYFEHVEYVGKSSDNPYAMEREIPVFICRGAKFGSLADIWPQLKKWR* |
| Ga0068855_1001255581 | 3300005563 | Corn Rhizosphere | SADNPYALEKDIPVFICHGSKFGTMQQLWPRLKKWR* |
| Ga0070664_1005131791 | 3300005564 | Corn Rhizosphere | DNPYALEKNIDVFICKGAKFGTLTQLWPKLKRWR* |
| Ga0066691_107662542 | 3300005586 | Soil | ADNPYALEKQIDVFICRGSKFGTLADLWPMLKHWR* |
| Ga0066706_106210512 | 3300005598 | Soil | TSADNPYALEKNIDVFICRGTKFGTMADLWPKADIKKWR* |
| Ga0068856_1019601492 | 3300005614 | Corn Rhizosphere | FVGTSDNPHALERNIPVFICKGSKFGSLTTLWPKLKHWR* |
| Ga0068864_1008441611 | 3300005618 | Switchgrass Rhizosphere | TSADNPYALEREVPFYIVHGPKFGSLQEVWPRLKKWR* |
| Ga0068863_1015222642 | 3300005841 | Switchgrass Rhizosphere | DQVEYAGTSADNPYALEREVPFFIVSGPKFGSLQEVWPRLKKWR* |
| Ga0066652_1008206541 | 3300006046 | Soil | LEGYFDHVEYVGKSTDNPYAMEREIPVFICRGARFGTLADIWPRLKKWR* |
| Ga0066652_1010104712 | 3300006046 | Soil | HVELVGTSADNPYALEKQLDVFICRGSKFGKLPELWPRLKKWR* |
| Ga0075015_1001748241 | 3300006102 | Watersheds | SEFEHVEYVGMSDNPYALEREIPVFICRGAKFGTLADIWPRLKKWR* |
| Ga0075014_1004379732 | 3300006174 | Watersheds | DNPYALERQIPVFICRGTKFGTLAQVWPRLKKWR* |
| Ga0070765_1008719012 | 3300006176 | Soil | VEYVGTSADNPYALEKLIPVYICRGAKFGSLEKLWPQVKRWR* |
| Ga0066658_102663432 | 3300006794 | Soil | GTSADNPYALEKQIDVFLCKGAKFGTLTQLWPKLKRWR* |
| Ga0066665_109469082 | 3300006796 | Soil | YVGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPKLKRWR* |
| Ga0079221_102357612 | 3300006804 | Agricultural Soil | VEYVGTSTDNPYALERRIPVYICRGAKFGTLEKVWPALKKWS* |
| Ga0079220_117274491 | 3300006806 | Agricultural Soil | GRSPDNPYALERKIPVFICHGAKFGSLTQLWPKLKKWA* |
| Ga0073928_103401611 | 3300006893 | Iron-Sulfur Acid Spring | LFEHVEFVGTSADNPYALERQIPVFICRGAKFGTLEKVWPQLKKWR* |
| Ga0075436_1013750902 | 3300006914 | Populus Rhizosphere | DNRYALERNIPVFLCHGAKFGSLAKLWPQLKKWD* |
| Ga0099791_105439101 | 3300007255 | Vadose Zone Soil | LFERVEFVGTSDNPYALERNIPVFLCKGAKFGSLEKVWPQLKKWR* |
| Ga0099793_100514833 | 3300007258 | Vadose Zone Soil | SPDNPYAMEREITVFICRGAKFGSLAEIWPRLKRWR* |
| Ga0099794_107821212 | 3300007265 | Vadose Zone Soil | VGTSADNPYALEREIDVFICKGSKFGTLSQLWPTVKRWR* |
| Ga0099830_117036272 | 3300009088 | Vadose Zone Soil | FEHVEYLGKSADNPYALEREIPVFICRGAKFGSLAAIWPRVKKWH* |
| Ga0099828_116428251 | 3300009089 | Vadose Zone Soil | ADNPYALEREISVFICHGAKFGSLADVWPQLKKWR* |
| Ga0115026_111703452 | 3300009111 | Wetland | SRFDHVEYLDTSAPNPYALESTVPVYICRGAKFGTPADLWPKVKHWR* |
| Ga0066709_1016114622 | 3300009137 | Grasslands Soil | VEYVGTSADNPYALEKQIDVFICRGPKFGTLADLWPKVKRWR* |
| Ga0066709_1022879031 | 3300009137 | Grasslands Soil | ERVEFVGKSANNPYALERQIPVFICRGAKFGSLAALWPRLKKWR* |
| Ga0066709_1041940631 | 3300009137 | Grasslands Soil | ESVGRSADNPYALEQEIPVFICKGAKFGSLTQLWPKVKRWR* |
| Ga0075423_107306751 | 3300009162 | Populus Rhizosphere | RNTLEQKFDKVEYVGRSADNPYALEKEIPFFIVHGPKFGSLQEAWPRLKKWR* |
| Ga0105242_108918683 | 3300009176 | Miscanthus Rhizosphere | FEQVEYVGASDNPYALERNIPVYLCRGAKFGSLQELWPQIKKWR* |
| Ga0105237_105669222 | 3300009545 | Corn Rhizosphere | KLFNTVQYVGTSADNPYALEKDIPVFICHGSKFGAMQQLWPRLKKWR* |
| Ga0116117_10450742 | 3300009635 | Peatland | ADNPYALEKQIAVYICRGPKFGTLDQLWPQLKRWR* |
| Ga0116106_10638321 | 3300009645 | Peatland | ADNPYALEKQIDVYICRGPKFGTLAQLWPELKRWR* |
| Ga0116134_13188411 | 3300009764 | Peatland | GQSADNPYALEKQIDVYICRGPKFGTLAQLWPELKRWR* |
| Ga0126380_107203772 | 3300010043 | Tropical Forest Soil | VEYVGTSADNPYALEKQIDVFICRGSKFGTMANLWSTKVKKWR* |
| Ga0134064_101100433 | 3300010325 | Grasslands Soil | YVGTSADNPYALEKQIDVFLCKDAKFGTLTQLWPKLKRWR* |
| Ga0134063_102685312 | 3300010335 | Grasslands Soil | QEMFEKVEYVGRSVDNPYALERRIPVFICKGAKFGTLTQLWPEFKKWR* |
| Ga0074044_104369922 | 3300010343 | Bog Forest Soil | DFVGTSRDNPYALESQLPVFICRGSKFGTLAQLWPSLKKWR* |
| Ga0074044_108072391 | 3300010343 | Bog Forest Soil | QLWNNVQYVGDSADNPWALEKDIPVFICRGAKFGKLTQLWPELKRWR* |
| Ga0126370_100754943 | 3300010358 | Tropical Forest Soil | LWEHVEYVGTSADNPYALEKQIDVFLCKGAKFGTLAQLWPKVKRWR* |
| Ga0126370_108296541 | 3300010358 | Tropical Forest Soil | NQLFENVKYVGTSANNPYALEKNISVFICTGPKFGTLQDLWPSIKRWR* |
| Ga0126372_104403684 | 3300010360 | Tropical Forest Soil | LFQRVELVGISDNPLALERHIPVFVCRGAKFGSLAQLWPRLKFWG* |
| Ga0126372_124008311 | 3300010360 | Tropical Forest Soil | TTPENPYALEKLLPVYLCRGAKFGTLAALWPQLKKWR* |
| Ga0126372_124798301 | 3300010360 | Tropical Forest Soil | ADNPYALEKQIDVFLCKGAKFGTLAQLWPKVKRWR* |
| Ga0126381_1015890823 | 3300010376 | Tropical Forest Soil | SDNPLALERHIPVFVCRGAKFGSLAQLWPRLKFWG* |
| Ga0126381_1044607492 | 3300010376 | Tropical Forest Soil | LNELFREVKYVGTSANNPYALERNIPVFICTGSKFGTLKELWPNTKRWR* |
| Ga0134126_101292581 | 3300010396 | Terrestrial Soil | LWKNVQYVGTSADNPYALEKQIDVFICRGSKFGSWAGLWPDLKRWR* |
| Ga0134124_126402932 | 3300010397 | Terrestrial Soil | TSADNPYALEKKIEVFICRGPKFGTLAQLWPKLKRWR* |
| Ga0134121_104112891 | 3300010401 | Terrestrial Soil | SEDNPYALEKNIDVFICKGAKFGTLTQLWPKLKRWR* |
| Ga0138528_1468692 | 3300011043 | Peatlands Soil | DNPYALEREIPVFICRGAKFGTLAKVWPQLKKWR* |
| Ga0138573_11944242 | 3300011089 | Peatlands Soil | VGDSADNPYALEREIPVFICRGAKFGTLAKVWPQLKKWR* |
| Ga0150983_107337551 | 3300011120 | Forest Soil | VEYVGMSADNPYALERQIAVYVCRGARFGTLEKVWPQLKKWR* |
| Ga0150983_162596142 | 3300011120 | Forest Soil | EREFERVEYVGKSSDSPYAMEREIPVFICRGAKFGSLAEMWPRLKKWR* |
| Ga0137392_101553251 | 3300011269 | Vadose Zone Soil | LFEDVEYVGKSGDNPYALEREIPVFICRGAKFGSLAELWPQLKKWR* |
| Ga0137392_101834654 | 3300011269 | Vadose Zone Soil | YVGKSSDNPYAMEREIPVFICRGAKFGSLAEMWPRLKKWR* |
| Ga0137392_103558923 | 3300011269 | Vadose Zone Soil | EHVEYVGKSSDNPYAMEREIPVFICRGAKFGSLAEIWPRLKRWR* |
| Ga0137392_105288041 | 3300011269 | Vadose Zone Soil | DNPYALEREIPVFICRGAKFGSLAELWPRLKKWR* |
| Ga0137393_105122323 | 3300011271 | Vadose Zone Soil | YEQVEYVGASDNPYALERNIPVFICRKAKFGSLAELWPQLKKWR* |
| Ga0137393_111953761 | 3300011271 | Vadose Zone Soil | GASDNPYALERNIPVFICRKAKFGSLAELWPQLKKWR* |
| Ga0137393_112636822 | 3300011271 | Vadose Zone Soil | VGSSRDNPYALERDLPVFICRGAKFGSLAKLWPSLKKWN* |
| Ga0137461_10440692 | 3300012040 | Soil | FEHVEYVGSSANNPYALEREVPVFLCRGPKFGSLAQLWPQLKKWR* |
| Ga0137389_105361221 | 3300012096 | Vadose Zone Soil | EYVGTSADNPYALEKQIPVFICRGAKFGTLAQLWPKVKRWR* |
| Ga0137388_102609664 | 3300012189 | Vadose Zone Soil | ADNPYALEKQIDVFFCKGAKFGTLAQLWPKVKRWR* |
| Ga0137388_104866311 | 3300012189 | Vadose Zone Soil | KDNPYALEREIPVFICKGSKFGSLTDLWPKLKKWR* |
| Ga0137383_104753993 | 3300012199 | Vadose Zone Soil | SADNIYAIEREIPVFSCRGAKFGSLTEVWPQLKKWR* |
| Ga0137365_109576321 | 3300012201 | Vadose Zone Soil | NNVEYVGTSADNPYALEKNIDVFICRGSRFGTMTDLWPKPAIKRWR* |
| Ga0137363_101789472 | 3300012202 | Vadose Zone Soil | EHVEYVGKSADNPYALEREIPVFLCRGAKFGSLAKIWPRLKKWS* |
| Ga0137399_116610782 | 3300012203 | Vadose Zone Soil | WDHVEYVGTSADNPYALEKQIDVFICHGAKFGTLAEFWPEVKKWR* |
| Ga0137362_113918242 | 3300012205 | Vadose Zone Soil | WEHVEYVGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPQLKRWR* |
| Ga0137376_116582062 | 3300012208 | Vadose Zone Soil | EHVEYAGKSDNPYALERNIPVFICKGAKFGSLTQLWPQLKKWQ* |
| Ga0137379_115316832 | 3300012209 | Vadose Zone Soil | YVGTSADNPYALEKQIDVYICRGPKFGTLADLWPRLKHWR* |
| Ga0137372_103180511 | 3300012350 | Vadose Zone Soil | ADNPYALEKEIPVFICKGSKFGTLAEVWPRVKHWR* |
| Ga0137386_102297183 | 3300012351 | Vadose Zone Soil | VGKSADNPYALERQIPVFICRGAKFGSLAAIWPRLKKWR* |
| Ga0137361_105061603 | 3300012362 | Vadose Zone Soil | YEQVEYVGASDNPYALERNIPVFICRKGKFGSLAELWPQLKKWR* |
| Ga0137358_101003141 | 3300012582 | Vadose Zone Soil | KSPDNPYAMEREIPVFICRGAKFGSLAEIWPRLKKWR* |
| Ga0137358_103539501 | 3300012582 | Vadose Zone Soil | HVEYVGKSPDNPYAMEREITVFICRGAKFGSLAEIWPRLKRWR* |
| Ga0137395_101049713 | 3300012917 | Vadose Zone Soil | VEYVGKSTDNPYAMEREIPVFICRGAKFGTLADIWPRLKKWR* |
| Ga0137395_105697191 | 3300012917 | Vadose Zone Soil | YVGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPQLKRWR* |
| Ga0137395_107428711 | 3300012917 | Vadose Zone Soil | SHVEYVGTSADNPYALEKQIDVFICRGAKFGTLAELWPQIKRWR* |
| Ga0137396_103301431 | 3300012918 | Vadose Zone Soil | FEHVEYVGMSDNPYALERNIPVFICRGAKFGSLADIWPHLKKWR* |
| Ga0137413_110082361 | 3300012924 | Vadose Zone Soil | SVEYIGNSANNPYALEREIPVFICKGAKFGSLEQLWPQVKLWR* |
| Ga0137419_101320794 | 3300012925 | Vadose Zone Soil | YFEHVEYVGKSSDNPYAMEREIPLFICRGAKFGSLAEFWPQLKKWR* |
| Ga0137419_110629811 | 3300012925 | Vadose Zone Soil | KSPDNPYAMEREIPVFICRGAKFGSLAGIWLRLKRWR* |
| Ga0137416_121395771 | 3300012927 | Vadose Zone Soil | EYVGISANPYALERNIPVYLCKGAKFGSLQKLWPKLKKWY* |
| Ga0137407_101608671 | 3300012930 | Vadose Zone Soil | DNPYALERNIPVFLCKGAKFGSLLALWPKLKKWR* |
| Ga0134087_101955793 | 3300012977 | Grasslands Soil | DNPYALEKQIDVFLCKGAKFGTLTQLWPKLKRWR* |
| Ga0164304_100490894 | 3300012986 | Soil | SSDNPYALERNIPVYICRGAKFGSLAQIWPQLKKWR* |
| Ga0182017_104474042 | 3300014494 | Fen | WKVDYAGTSAANPYALEQQLPVFICRGAKFGTLAQFWPTLKHWR* |
| Ga0182024_108184002 | 3300014501 | Permafrost | SADNPYALEKQIDVFICRGAKFGTLTQLWPALKRWR* |
| Ga0182024_124520292 | 3300014501 | Permafrost | GDSADNPYALEKEISVWICRNPKFGTLAQLWPSLKRWR* |
| Ga0157377_110650003 | 3300014745 | Miscanthus Rhizosphere | FQQVEYVGSADNPYALERHIPVFLCRGAKFGTLTQLWPNLKRWR* |
| Ga0157376_107880781 | 3300014969 | Miscanthus Rhizosphere | TSDNPYALERNIPVYLCKGAKFGSLVELWPELKKWQ* |
| Ga0137420_10288592 | 3300015054 | Vadose Zone Soil | SDNPYAMEREISVFICRGAKFGSLAEIWPRLKRWR* |
| Ga0137412_109085151 | 3300015242 | Vadose Zone Soil | VEYVGTSADNPYALEREIDVFICKGSKFGTLSQLWPTVKRWR* |
| Ga0132258_137878871 | 3300015371 | Arabidopsis Rhizosphere | LWDNVEYVGTSADNPYALEREVDVFICQGAKFGTLTQLWPKVKRWR* |
| Ga0187825_102979372 | 3300017930 | Freshwater Sediment | NHVEYVGASADNPYALEREVPIFICKGAKFGSLSQLWPKVKNWS |
| Ga0187814_102858011 | 3300017932 | Freshwater Sediment | HVEYVGTSADNPYASEKEIPVFICRGPKFATLAQIWPMLKRWR |
| Ga0187817_101453541 | 3300017955 | Freshwater Sediment | SADNPYALEKEIGVFICRGPKFGTLAQLWPQLKRWH |
| Ga0187817_110597041 | 3300017955 | Freshwater Sediment | FEHVEYVGTSADNPYALEREIPVFICRGAKFGTLAKVWPQLKKWR |
| Ga0187780_105405822 | 3300017973 | Tropical Peatland | EFVGTSEDNPYALEREIPVFICRGAKFGTLEKVWPQLKKWR |
| Ga0187816_100405811 | 3300017995 | Freshwater Sediment | ADNPWALESQIEVYICHKPKFGRLSEIWPKVKRWR |
| Ga0187804_101875742 | 3300018006 | Freshwater Sediment | SADNRYASEKEIPVFICRGPKFASLGQIWPMVKRWR |
| Ga0187810_101771741 | 3300018012 | Freshwater Sediment | ADNSYALEKQIDVFLCKGAKFGTLAQFWPKVKRWR |
| Ga0187872_101728032 | 3300018017 | Peatland | EYVGTSADNPYALEKEIDVYICRGAKFGALAQLWPQLKRWR |
| Ga0187869_103066742 | 3300018030 | Peatland | EYLGNSPPNSYALETEISVNICRGSKFGTLADLWPKLKHWR |
| Ga0187851_101536022 | 3300018046 | Peatland | LEQLFDHVEYLGRSAPNPYALENELPIFICRGSKFGSLKELWPRLKKWR |
| Ga0187859_102510911 | 3300018047 | Peatland | EYLGESADNPYALEKQIDVYICRGSKFGTLTQLWPQLKRWR |
| Ga0187859_105807711 | 3300018047 | Peatland | KLFNQVEYVGTSAASPYALEQQIDVYICRGAKFGTLTQIWTRLKHWR |
| Ga0187772_107328351 | 3300018085 | Tropical Peatland | EYVGNSTPNPYALESKLPIFICRGPKFGTLADVWPKMKRWR |
| Ga0187769_115289691 | 3300018086 | Tropical Peatland | ADNPWALEKKIGFYICRKPKFGSLADLWPKVKHWR |
| Ga0187771_118101582 | 3300018088 | Tropical Peatland | GTSADNPYALETGIAVWICRGPKLGTLAQLWPRIKKWR |
| Ga0182025_11504721 | 3300019786 | Permafrost | QIPNIGTSAANPYALEQRIDVYICRGAKFGTLTQLWPHLKRWR |
| Ga0179592_101115451 | 3300020199 | Vadose Zone Soil | FEHVEYVGTSDANPYALEQQIPVFICRGAKFGTLEKVWPQLKRWR |
| Ga0179592_102802891 | 3300020199 | Vadose Zone Soil | LFERVEYIGKSADNPYGLEREIPVFICRGAKFGSLAELWPRLKKWG |
| Ga0210407_106214281 | 3300020579 | Soil | DRVEYVGTSADNPYALEKQIDVFICRGAKFGTLDQLWPQIKRWR |
| Ga0210405_108737731 | 3300021171 | Soil | YVGTSAASPYALEQQIDVYICRGAKFGTLTQLWPQLKRWR |
| Ga0210396_102429411 | 3300021180 | Soil | FEHVEYVGTSADNPYALERLIPVYICRGAKFGSLEKIWQQVKRWR |
| Ga0210388_111628321 | 3300021181 | Soil | NSAPNPYVLETEISVNICRGAKFGTMADLWPKIKHWR |
| Ga0193719_103455512 | 3300021344 | Soil | LWDNVEYVGTSADNPYALEKRIDVFICRGAKFGTLAQLWPKLKHWR |
| Ga0210387_103679621 | 3300021405 | Soil | VGLSADNPYALEREIPVFICRGAKFGTLGNIWPQLKKWR |
| Ga0210383_115989361 | 3300021407 | Soil | ADNPYALEKQIDLYICRGARFGSFTQLWPQIKRWR |
| Ga0126371_114385262 | 3300021560 | Tropical Forest Soil | SSDNPYALERNIPVFICKGAKFGTLADLWPKVKKWR |
| Ga0126371_118297131 | 3300021560 | Tropical Forest Soil | HVEYVGTSADNPWALERGIDVFLCKGKKFDTLAQLWPRVKRWR |
| Ga0137417_11442512 | 3300024330 | Vadose Zone Soil | KSPDNPYAMEREITVFICRGAKFGSLAEIWPRLKRWR |
| Ga0137417_14959531 | 3300024330 | Vadose Zone Soil | KSADNPYALEREIPVFICRGAKFGTLADLWPRLKKWR |
| Ga0208457_10369671 | 3300025812 | Peatland | VEYVGTSGDNPYALEKQIGVFICRGAKFGTLAQLWPQLKRWR |
| Ga0207653_103502472 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | SSDSPYALERNIPVFICKGAKFGSLAQIWPQLKKWR |
| Ga0207699_107732571 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VGTSTDNRYALEKNIDVFICRGSKFGTMADLWPKPNIKKWR |
| Ga0207695_100629101 | 3300025913 | Corn Rhizosphere | KLFNTVQYVGTSADNPYALEKDIPVFICHGSKFGAMQQLWPRLKKWR |
| Ga0207695_107494852 | 3300025913 | Corn Rhizosphere | ADNSYALEKQIDVFICRGSKFGSWAGLWPDLKRWR |
| Ga0207671_102903443 | 3300025914 | Corn Rhizosphere | FVGTSADNPYALEKKIEVFICRGPKFGTLAQLWPKLKRWR |
| Ga0207671_111991631 | 3300025914 | Corn Rhizosphere | QQVDYVGTSADNPWALEKNIDVFICHGPKFGTLAELWPKLKNWR |
| Ga0207663_108223091 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FVGTSADNPYALEKKIDVHICKGPKFGTLAQLWPKLKRWR |
| Ga0207687_118274031 | 3300025927 | Miscanthus Rhizosphere | SDSPYALERNIPVYICKGAKFGSLAQIWPELKKWR |
| Ga0207667_111179971 | 3300025949 | Corn Rhizosphere | VGTSADNPYALEKEIPVFICHRPKFGTLAELWTKLKKWR |
| Ga0207641_122720902 | 3300026088 | Switchgrass Rhizosphere | EYVGSSDSPYALERNIPVFICKGAKFGSLAQIWPQLKKWR |
| Ga0209235_11135672 | 3300026296 | Grasslands Soil | GKSADNPYALERQIPVFICRGAKFGSLAALWPRLKKWR |
| Ga0209761_13485361 | 3300026313 | Grasslands Soil | VDNPYALERQIPVFICKGAKFGTLTQLWPQFKKWR |
| Ga0209471_13039692 | 3300026318 | Soil | GLFERVEYVGKSTDNHYALERELSVFICRGAKFGTLADLWPRLKKWS |
| Ga0209152_102787622 | 3300026325 | Soil | VGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPKLKRWR |
| Ga0209803_12201081 | 3300026332 | Soil | VEYIGTSDNPYALERHIPVFLCRGSKFGSLANLWPGLKKWD |
| Ga0257171_11057951 | 3300026377 | Soil | GTSADNPYALEREIPVFICKGAKFGSLAQLWPKLKKWS |
| Ga0209808_12427611 | 3300026523 | Soil | NSVEYVGTSADNPYALEKNIDVFICRGAKFGTMADLWPKPGVKRWR |
| Ga0209378_11341501 | 3300026528 | Soil | YVGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPKLKRWR |
| Ga0209056_106043331 | 3300026538 | Soil | GTSADNPYALEKQIDVFLCKGAKFGTLDRLWPKVKHWR |
| Ga0209161_102530231 | 3300026548 | Soil | KVEYVGTSDNRYALERNIPVFLCHGAKFGSLAKLWSRLKKWD |
| Ga0209474_100172817 | 3300026550 | Soil | LWEHVEYVGTSADNPYALEKQIDVFLCKDAKFGTLTQLWPKLKRWR |
| Ga0179587_103807501 | 3300026557 | Vadose Zone Soil | WQYVEYVGASADNPYALEKQIDVFICRGSKFGTLADIWPNLKRWR |
| Ga0208724_10147592 | 3300027064 | Forest Soil | SSDNPYALETEISVNICRGPRFGTLTDLWPQVKHWR |
| Ga0209332_10942341 | 3300027439 | Forest Soil | QLWQHVEYVGTSADNPYALEKQIDVFICRGPRFGSMAELWPEIKRWR |
| Ga0209735_10242031 | 3300027562 | Forest Soil | TSRGNPYALEQELPVYICRGAKFGTLAQLWPRLKKWR |
| Ga0209330_10574201 | 3300027619 | Forest Soil | LWDHVEYVGTSADNPYALEKQIDVYICRGSKFGSLTQLWPQIKRWR |
| Ga0208827_10811271 | 3300027641 | Peatlands Soil | FVGTSADNPWALESEIGVYICRGPKFGTLSQGWPMVKRWR |
| Ga0209420_11114461 | 3300027648 | Forest Soil | TSADNSYALEKEIDVYICRGAKFGTLAELWPQLKRWR |
| Ga0208990_11222702 | 3300027663 | Forest Soil | TSADNPYALEREIPIFICRGAKFGSLAAIWPQLKKWR |
| Ga0209588_10354723 | 3300027671 | Vadose Zone Soil | EHVEYAGQSADNPYALERKIPVFICRGAKFGSLAALWPKLKKWG |
| Ga0209011_11211442 | 3300027678 | Forest Soil | KSSDNPYAMEREIPVFICRGAKFGSLAEIWPRLKRWR |
| Ga0209626_11384481 | 3300027684 | Forest Soil | GTSADNPYALEKQIDVFLVRGPKFGTLAQLWPEVKRWR |
| Ga0209248_101557111 | 3300027729 | Bog Forest Soil | GEADNPYALEREISVYICRGAKFGSLAAIWPELKKWR |
| Ga0209166_105357841 | 3300027857 | Surface Soil | YVGTSADNRYALEKEIPVFVCKRAKFGSFAEFWPKLKKWR |
| Ga0209167_106700301 | 3300027867 | Surface Soil | YVGTSADNPYALEKEIDVFICKGAKFGTFAQLWPKLKRWR |
| Ga0209275_100056236 | 3300027884 | Soil | YVGTSADNPYALEKEIAVYICRGAKFGTLEKLWPQLKKWR |
| Ga0209380_100179901 | 3300027889 | Soil | WNHVEYVGTSADNPYALEKRIDVFICRGAKFGNLAELWPQVKHWR |
| Ga0209415_102137171 | 3300027905 | Peatlands Soil | LSRDNPYALERRVPVFICRGAKFGTLAQIWPKLKHWR |
| Ga0137415_105843142 | 3300028536 | Vadose Zone Soil | HVESVGRSADNPYALEREIPVFICKGAKFGSLTELWPKVKKWR |
| Ga0302149_11898431 | 3300028552 | Bog | YVGTSADNPYALEREIAVYICRGPKFGTLAELWPQVKKWR |
| Ga0302144_101436631 | 3300028560 | Bog | STDNPYALEREIAVYICRGPKFGTLAELWPQVKKWR |
| Ga0302153_103158092 | 3300028574 | Bog | LFEHVEYVGTSADNPYALEREIAVYICRGPKFGTLAELWPQVKKWR |
| Ga0302301_10858312 | 3300028731 | Palsa | GDSADNPYALEKEIAVYICRRPKFGTLDQLWPEVKRWR |
| Ga0302219_101451821 | 3300028747 | Palsa | SADNPYALEKQIDVYICHGSKFGTLTDLWPELKRWR |
| Ga0302156_101041621 | 3300028748 | Bog | SADNPYALEREIAVYICRGPKFGTLAELWPQVKKWR |
| Ga0308309_113925221 | 3300028906 | Soil | EQVDYRGNSAPNPYALETEISVNICHGPKFGTLADLWPKIKHWR |
| Ga0247271_1003543 | 3300029903 | Soil | XQVEFVGISADNPWALETGISVNICRGPKFGTLTQLWPQLKRWR |
| Ga0311340_100689861 | 3300029943 | Palsa | EYVGQSADNPYALEKQIDVYICRGPKFGTFAELWPQIKRWR |
| Ga0311371_109539742 | 3300029951 | Palsa | EYVGTSADNPYALEKQIDVFFCKGKKFGTLAQLWPELKRWR |
| Ga0311339_111233211 | 3300029999 | Palsa | TSADNPYALEKEIGVFICRGAKFGTLAQLWPQLKHWH |
| Ga0302176_101581792 | 3300030057 | Palsa | GQSADNPYALEKQIDVYICRGPKFGTFAELWPQIKRWR |
| Ga0311353_100072711 | 3300030399 | Palsa | SADNSYALEKGIGVDICRGPKFGTLAQLWPGFKKWR |
| Ga0311370_105217031 | 3300030503 | Palsa | IGTSADNPYALEKEIGVFICRGAKFGTLAQLWPQLKHWH |
| Ga0302313_100947624 | 3300030693 | Palsa | KLFDHVEYVGTSADNPYALEKQIDVFICRGAKFGTLAKIWPALKRWR |
| Ga0265750_10052792 | 3300030813 | Soil | GTSADNPYALEKEIAVYICRGAKFGTLEKIWPELKKWR |
| Ga0265770_10043133 | 3300030878 | Soil | ADNSYALEKEIAVYICRGAKFGTLEKIWPELKKWR |
| Ga0265771_10090431 | 3300031010 | Soil | GTSADNSYALEKEIAVYICRGAKFGTLEKIWPELKKWR |
| Ga0302325_123079952 | 3300031234 | Palsa | KLFEQVDFVGTSRDNPYALERELPVFICRRAKFGSLAELWPQLKKWR |
| Ga0302325_126870762 | 3300031234 | Palsa | QLWDHVEYVGTSADNPYALEKQIDVYICRGSKFGTLTQLWPQLKRWR |
| Ga0265340_101248451 | 3300031247 | Rhizosphere | YVGTSADNPWALESQIGVYICKGAKFGTLTQIWPQLKRWR |
| (restricted) Ga0255312_11331001 | 3300031248 | Sandy Soil | LWENVEYVGRSADNPYALEKQIDVFICRGSKFGALAQLWPEVKHWR |
| Ga0302326_135307631 | 3300031525 | Palsa | EYVGTSADNPYALEKQIDVYICRGSKFGTLTQLWPQLKRWR |
| Ga0310686_1028747652 | 3300031708 | Soil | VEYVGQSADNPYALEKQIDVYICRGAKFGTLAQLWPQLKRWR |
| Ga0310686_1059535983 | 3300031708 | Soil | VGTSADNPYALEKEIPVYICRGAKFSTMAGLWPQIKRWR |
| Ga0310686_1098021801 | 3300031708 | Soil | FDSVQFVGISADNPYALETEIGVDICRGPKFGTLAQLWPGLKKWR |
| Ga0310686_1142134271 | 3300031708 | Soil | EQLFNSVQYVGTSADNPYALETEISVYICRGPKFGTLAELWPQLKKWR |
| Ga0265342_101009101 | 3300031712 | Rhizosphere | VGTSADNPWALESQIGVYICKGAKFGTLTELWPQLKRWR |
| Ga0307477_101221671 | 3300031753 | Hardwood Forest Soil | YVGLSADNPWALESGISVNICHGAKFGSLSQLWPQLKRWR |
| Ga0307475_100862721 | 3300031754 | Hardwood Forest Soil | VFVGKSDNPYALERNIPVYICKGAKFGTLAQFWPQLKKWR |
| Ga0307473_104668842 | 3300031820 | Hardwood Forest Soil | YVGKSTDNPYAMEREIPVFICRGARFGTLADIWPRLKKWR |
| Ga0307473_114017041 | 3300031820 | Hardwood Forest Soil | GTSDNRYALERNISVFLCHGAKFGSLAKFWPQLKKWD |
| Ga0307478_107201021 | 3300031823 | Hardwood Forest Soil | SADNPYALEKNIDVFICRGAKFGTLADLWPKLKRWR |
| Ga0307478_112268902 | 3300031823 | Hardwood Forest Soil | WDHVEYVGTSADNPYALEKQIDVFICHGAKFGTLAQLWPELKRWR |
| Ga0306921_115342291 | 3300031912 | Soil | SDNPFALERNIRIFYCRGAKFGTLARIWPQLKRWR |
| Ga0307479_113050642 | 3300031962 | Hardwood Forest Soil | VEYVGTSADNPYALERDIDVFICKGAKFGTLAQLWPTVKRWR |
| Ga0318556_102192173 | 3300032043 | Soil | FQRVELVGISDNPLALERHIPVFVCRGAKFGSLAQLWPRLKFWG |
| Ga0307415_1003485822 | 3300032126 | Rhizosphere | EQLFEHIELVGTSDHPYALEREIPVWLCKGSKFGTLEQLWPKLKKWR |
| Ga0311301_124513481 | 3300032160 | Peatlands Soil | SDNPYALERHIPVFVCHGARFGALAELWPRLKVWD |
| Ga0335079_122782221 | 3300032783 | Soil | SVQYVGTSADNPYALETGIAVWICRGPKFGTLSELWPRIKKWR |
| Ga0335078_104299801 | 3300032805 | Soil | FDHVEMITTSAPNPYALEQQLPVYLCRGLKFGSLQQLWPQIKRWR |
| Ga0335078_110495091 | 3300032805 | Soil | PEILHQLFKSVAYIGRSNNSYALEGHIPVFLCRGAKFGSLAQIWPRLKKWD |
| Ga0335078_111873692 | 3300032805 | Soil | LFDSVQYVGTSADNPYALETGIAVWICRGPKFGTLSELWPRIKKWR |
| Ga0335074_110072282 | 3300032895 | Soil | SNVQYVGDSADNPYALEKEISVFICRGAKFGTLAQLWPELKRWR |
| Ga0335072_113703042 | 3300032898 | Soil | SNVQYVGTSADNPYALEKKIPVFICRGPKFGTMADLWPQVKKWR |
| Ga0335072_117314861 | 3300032898 | Soil | GTSEDNPYALEREIPVFICRGSKFGTLADLWPKLKKWR |
| Ga0326728_107898832 | 3300033402 | Peat Soil | RDNPYALEKELPVFICRGAKFGTLAQVWPKLKKWR |
| Ga0326723_0231918_685_813 | 3300034090 | Peat Soil | VEYVGTSADNPYALEKQIDVFLCKGAKFGTLAQLWPKVKRWR |
| Ga0370492_0025695_14_142 | 3300034282 | Untreated Peat Soil | VEYVGISADNEYAQETQIAVYICRRPKFGTLADLWPQIKRWR |
| ⦗Top⦘ |