


| Basic Information | |
|---|---|
| Family ID | F018760 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 233 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MNINMYVINAILILMVIRQIREHPLDLRSLAVPVLAVGCAAVLFL |
| Number of Associated Samples | 167 |
| Number of Associated Scaffolds | 233 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 72.96 % |
| % of genes near scaffold ends (potentially truncated) | 97.85 % |
| % of genes from short scaffolds (< 2000 bps) | 90.13 % |
| Associated GOLD sequencing projects | 159 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.090 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.906 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.202 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (36.481 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.42% β-sheet: 0.00% Coil/Unstructured: 46.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 233 Family Scaffolds |
|---|---|---|
| PF13302 | Acetyltransf_3 | 10.73 |
| PF00291 | PALP | 8.15 |
| PF02806 | Alpha-amylase_C | 1.29 |
| PF01903 | CbiX | 1.29 |
| PF07366 | SnoaL | 1.29 |
| PF02481 | DNA_processg_A | 0.86 |
| PF01906 | YbjQ_1 | 0.86 |
| PF14117 | DUF4287 | 0.86 |
| PF07690 | MFS_1 | 0.86 |
| PF13676 | TIR_2 | 0.86 |
| PF00920 | ILVD_EDD | 0.86 |
| PF02769 | AIRS_C | 0.86 |
| PF00561 | Abhydrolase_1 | 0.86 |
| PF00891 | Methyltransf_2 | 0.43 |
| PF06325 | PrmA | 0.43 |
| PF03551 | PadR | 0.43 |
| PF12802 | MarR_2 | 0.43 |
| PF00583 | Acetyltransf_1 | 0.43 |
| PF01734 | Patatin | 0.43 |
| PF02945 | Endonuclease_7 | 0.43 |
| PF00440 | TetR_N | 0.43 |
| PF00892 | EamA | 0.43 |
| PF00156 | Pribosyltran | 0.43 |
| PF03729 | DUF308 | 0.43 |
| PF13549 | ATP-grasp_5 | 0.43 |
| PF04655 | APH_6_hur | 0.43 |
| PF02371 | Transposase_20 | 0.43 |
| PF02073 | Peptidase_M29 | 0.43 |
| PF01435 | Peptidase_M48 | 0.43 |
| PF01361 | Tautomerase | 0.43 |
| PF03476 | MOSC_N | 0.43 |
| PF00589 | Phage_integrase | 0.43 |
| PF08031 | BBE | 0.43 |
| PF01638 | HxlR | 0.43 |
| PF00296 | Bac_luciferase | 0.43 |
| PF13560 | HTH_31 | 0.43 |
| PF01022 | HTH_5 | 0.43 |
| PF13380 | CoA_binding_2 | 0.43 |
| PF01872 | RibD_C | 0.43 |
| PF13487 | HD_5 | 0.43 |
| PF00931 | NB-ARC | 0.43 |
| PF12867 | DinB_2 | 0.43 |
| PF16864 | Dimerisation2 | 0.43 |
| PF01425 | Amidase | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 233 Family Scaffolds |
|---|---|---|---|
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.72 |
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.72 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 1.29 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 1.29 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 1.29 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.86 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.86 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.43 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.43 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.43 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.43 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.43 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.43 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.43 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.43 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 0.43 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.43 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.43 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.43 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.43 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.09 % |
| Unclassified | root | N/A | 36.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig09013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1075 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101187315 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300003368|JGI26340J50214_10087731 | Not Available | 808 | Open in IMG/M |
| 3300004152|Ga0062386_100041354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora pleiomorpha | 3455 | Open in IMG/M |
| 3300005187|Ga0066675_10066006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2285 | Open in IMG/M |
| 3300005332|Ga0066388_103395815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
| 3300005434|Ga0070709_11644789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 523 | Open in IMG/M |
| 3300005435|Ga0070714_101214427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300005436|Ga0070713_101570072 | Not Available | 639 | Open in IMG/M |
| 3300005441|Ga0070700_100568754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
| 3300005441|Ga0070700_102023061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces hokutonensis | 500 | Open in IMG/M |
| 3300005467|Ga0070706_100037326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4488 | Open in IMG/M |
| 3300005467|Ga0070706_101020788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300005467|Ga0070706_101897212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 541 | Open in IMG/M |
| 3300005471|Ga0070698_101482885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 629 | Open in IMG/M |
| 3300005536|Ga0070697_100070228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2871 | Open in IMG/M |
| 3300005543|Ga0070672_101735868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300005578|Ga0068854_100493762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300005610|Ga0070763_10925495 | Not Available | 520 | Open in IMG/M |
| 3300005713|Ga0066905_100441343 | Not Available | 1067 | Open in IMG/M |
| 3300005764|Ga0066903_100435625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2180 | Open in IMG/M |
| 3300005764|Ga0066903_107116954 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006028|Ga0070717_10100843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori | 2451 | Open in IMG/M |
| 3300006028|Ga0070717_10917197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
| 3300006176|Ga0070765_100424454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1244 | Open in IMG/M |
| 3300006176|Ga0070765_101589872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 615 | Open in IMG/M |
| 3300006237|Ga0097621_100519179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1081 | Open in IMG/M |
| 3300006358|Ga0068871_100766027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300006577|Ga0074050_11944991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
| 3300006796|Ga0066665_10910625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mobaraensis | 680 | Open in IMG/M |
| 3300006797|Ga0066659_10765171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 795 | Open in IMG/M |
| 3300006804|Ga0079221_11370872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 560 | Open in IMG/M |
| 3300009672|Ga0116215_1311911 | Not Available | 683 | Open in IMG/M |
| 3300009698|Ga0116216_10998567 | Not Available | 500 | Open in IMG/M |
| 3300009762|Ga0116130_1249630 | Not Available | 564 | Open in IMG/M |
| 3300009792|Ga0126374_10660269 | Not Available | 781 | Open in IMG/M |
| 3300010048|Ga0126373_10402376 | Not Available | 1394 | Open in IMG/M |
| 3300010048|Ga0126373_12867326 | Not Available | 538 | Open in IMG/M |
| 3300010339|Ga0074046_10801034 | Not Available | 551 | Open in IMG/M |
| 3300010371|Ga0134125_10071337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3863 | Open in IMG/M |
| 3300010376|Ga0126381_104290027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300010376|Ga0126381_104771548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300010379|Ga0136449_101355198 | Not Available | 1103 | Open in IMG/M |
| 3300010379|Ga0136449_101644590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300010379|Ga0136449_103421568 | Not Available | 607 | Open in IMG/M |
| 3300010401|Ga0134121_11405724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300010401|Ga0134121_11483620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 692 | Open in IMG/M |
| 3300010876|Ga0126361_11086633 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300011270|Ga0137391_11272295 | Not Available | 583 | Open in IMG/M |
| 3300012189|Ga0137388_10666516 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300012199|Ga0137383_10239328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. | 1330 | Open in IMG/M |
| 3300012200|Ga0137382_10582776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 798 | Open in IMG/M |
| 3300012209|Ga0137379_11368877 | Not Available | 612 | Open in IMG/M |
| 3300012210|Ga0137378_10223830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1752 | Open in IMG/M |
| 3300012211|Ga0137377_11853879 | Not Available | 521 | Open in IMG/M |
| 3300012349|Ga0137387_11234171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 526 | Open in IMG/M |
| 3300012350|Ga0137372_10018058 | All Organisms → cellular organisms → Bacteria | 6654 | Open in IMG/M |
| 3300012354|Ga0137366_10271460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1253 | Open in IMG/M |
| 3300012487|Ga0157321_1036646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 523 | Open in IMG/M |
| 3300013765|Ga0120172_1123249 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300014165|Ga0181523_10479983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
| 3300014166|Ga0134079_10734082 | Not Available | 508 | Open in IMG/M |
| 3300015374|Ga0132255_101017427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1243 | Open in IMG/M |
| 3300016270|Ga0182036_11170040 | Not Available | 639 | Open in IMG/M |
| 3300016357|Ga0182032_10888849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300016371|Ga0182034_11347074 | Not Available | 623 | Open in IMG/M |
| 3300016387|Ga0182040_11375615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300016422|Ga0182039_10447184 | Not Available | 1106 | Open in IMG/M |
| 3300016445|Ga0182038_10699034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 883 | Open in IMG/M |
| 3300016445|Ga0182038_10763912 | Not Available | 845 | Open in IMG/M |
| 3300016445|Ga0182038_11556730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis | 594 | Open in IMG/M |
| 3300017821|Ga0187812_1007361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 3812 | Open in IMG/M |
| 3300017822|Ga0187802_10202257 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300017926|Ga0187807_1075256 | Not Available | 1053 | Open in IMG/M |
| 3300017926|Ga0187807_1104503 | Not Available | 891 | Open in IMG/M |
| 3300017926|Ga0187807_1291115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300017932|Ga0187814_10109646 | Not Available | 1020 | Open in IMG/M |
| 3300017932|Ga0187814_10219760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Eremiobacterota → Candidatus Eremiobacteriia → Candidatus Eremiobacterales → Candidatus Eremiobacteraceae → Candidatus Eremiobacter → unclassified Candidatus Eremiobacter → Candidatus Eremiobacter sp. RRmetagenome_bin22 | 716 | Open in IMG/M |
| 3300017937|Ga0187809_10281224 | Not Available | 609 | Open in IMG/M |
| 3300017943|Ga0187819_10218829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
| 3300017943|Ga0187819_10485688 | Not Available | 705 | Open in IMG/M |
| 3300017955|Ga0187817_10171530 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300017955|Ga0187817_10265620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300017955|Ga0187817_10272114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CB01373 | 1079 | Open in IMG/M |
| 3300017955|Ga0187817_11067046 | Not Available | 518 | Open in IMG/M |
| 3300017966|Ga0187776_11348971 | Not Available | 541 | Open in IMG/M |
| 3300017974|Ga0187777_10319383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
| 3300017995|Ga0187816_10052264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1709 | Open in IMG/M |
| 3300018001|Ga0187815_10165295 | Not Available | 936 | Open in IMG/M |
| 3300018007|Ga0187805_10021547 | Not Available | 2813 | Open in IMG/M |
| 3300018007|Ga0187805_10648923 | Not Available | 500 | Open in IMG/M |
| 3300018086|Ga0187769_10521515 | Not Available | 897 | Open in IMG/M |
| 3300018088|Ga0187771_10163279 | Not Available | 1836 | Open in IMG/M |
| 3300018482|Ga0066669_10251578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1398 | Open in IMG/M |
| 3300021403|Ga0210397_10284929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1209 | Open in IMG/M |
| 3300021406|Ga0210386_11620597 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300021475|Ga0210392_11130799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 587 | Open in IMG/M |
| 3300021478|Ga0210402_10080983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2888 | Open in IMG/M |
| 3300021478|Ga0210402_11610302 | Not Available | 576 | Open in IMG/M |
| 3300021478|Ga0210402_11872054 | Not Available | 526 | Open in IMG/M |
| 3300021560|Ga0126371_10268309 | Not Available | 1826 | Open in IMG/M |
| 3300021560|Ga0126371_11709153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2568 | 753 | Open in IMG/M |
| 3300024283|Ga0247670_1040672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 837 | Open in IMG/M |
| 3300025898|Ga0207692_10762198 | Not Available | 631 | Open in IMG/M |
| 3300025905|Ga0207685_10608834 | Not Available | 587 | Open in IMG/M |
| 3300025906|Ga0207699_10002073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 9471 | Open in IMG/M |
| 3300025906|Ga0207699_10747268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 717 | Open in IMG/M |
| 3300025910|Ga0207684_10006546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10610 | Open in IMG/M |
| 3300025910|Ga0207684_10296941 | Not Available | 1393 | Open in IMG/M |
| 3300025910|Ga0207684_11294796 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300025910|Ga0207684_11462540 | Not Available | 557 | Open in IMG/M |
| 3300025915|Ga0207693_11150094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300025916|Ga0207663_10826514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 739 | Open in IMG/M |
| 3300025916|Ga0207663_11373418 | Not Available | 569 | Open in IMG/M |
| 3300025922|Ga0207646_11524399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 578 | Open in IMG/M |
| 3300025949|Ga0207667_10381470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1436 | Open in IMG/M |
| 3300026023|Ga0207677_12300381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 502 | Open in IMG/M |
| 3300026041|Ga0207639_12249301 | Not Available | 507 | Open in IMG/M |
| 3300026095|Ga0207676_10091880 | Not Available | 2495 | Open in IMG/M |
| 3300026309|Ga0209055_1104112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1124 | Open in IMG/M |
| 3300027090|Ga0208604_1001883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1977 | Open in IMG/M |
| 3300027680|Ga0207826_1092034 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300027765|Ga0209073_10403068 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027812|Ga0209656_10008379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6588 | Open in IMG/M |
| 3300027812|Ga0209656_10357374 | Not Available | 663 | Open in IMG/M |
| 3300027869|Ga0209579_10508468 | Not Available | 654 | Open in IMG/M |
| 3300027875|Ga0209283_10763706 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300027911|Ga0209698_11244524 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300028047|Ga0209526_10659670 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300028450|Ga0189898_1026858 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 600 | Open in IMG/M |
| 3300029954|Ga0311331_10460897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1259 | Open in IMG/M |
| 3300031545|Ga0318541_10504827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
| 3300031549|Ga0318571_10329933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300031564|Ga0318573_10202223 | Not Available | 1053 | Open in IMG/M |
| 3300031564|Ga0318573_10263452 | Not Available | 920 | Open in IMG/M |
| 3300031572|Ga0318515_10734739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. WB9 | 522 | Open in IMG/M |
| 3300031573|Ga0310915_10540039 | Not Available | 828 | Open in IMG/M |
| 3300031640|Ga0318555_10588360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300031680|Ga0318574_10358729 | Not Available | 850 | Open in IMG/M |
| 3300031681|Ga0318572_10403506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
| 3300031682|Ga0318560_10272086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium | 911 | Open in IMG/M |
| 3300031713|Ga0318496_10568688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300031713|Ga0318496_10683112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 566 | Open in IMG/M |
| 3300031718|Ga0307474_10331117 | Not Available | 1176 | Open in IMG/M |
| 3300031723|Ga0318493_10067101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1740 | Open in IMG/M |
| 3300031724|Ga0318500_10471910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300031744|Ga0306918_10517505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 934 | Open in IMG/M |
| 3300031747|Ga0318502_10072282 | Not Available | 1863 | Open in IMG/M |
| 3300031747|Ga0318502_10142361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1363 | Open in IMG/M |
| 3300031748|Ga0318492_10631153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300031751|Ga0318494_10033406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2643 | Open in IMG/M |
| 3300031751|Ga0318494_10076242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1815 | Open in IMG/M |
| 3300031751|Ga0318494_10460121 | Not Available | 740 | Open in IMG/M |
| 3300031751|Ga0318494_10812621 | Not Available | 548 | Open in IMG/M |
| 3300031753|Ga0307477_10290777 | Not Available | 1129 | Open in IMG/M |
| 3300031753|Ga0307477_10335998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1040 | Open in IMG/M |
| 3300031765|Ga0318554_10148687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1329 | Open in IMG/M |
| 3300031765|Ga0318554_10258524 | Not Available | 992 | Open in IMG/M |
| 3300031765|Ga0318554_10684186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 576 | Open in IMG/M |
| 3300031769|Ga0318526_10338614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300031770|Ga0318521_10628643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300031771|Ga0318546_10517557 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031771|Ga0318546_10823225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| 3300031778|Ga0318498_10285745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 741 | Open in IMG/M |
| 3300031778|Ga0318498_10352679 | Not Available | 657 | Open in IMG/M |
| 3300031779|Ga0318566_10005230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4939 | Open in IMG/M |
| 3300031781|Ga0318547_10690364 | Not Available | 634 | Open in IMG/M |
| 3300031782|Ga0318552_10378267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300031782|Ga0318552_10521918 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031794|Ga0318503_10128208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 814 | Open in IMG/M |
| 3300031794|Ga0318503_10179489 | Not Available | 685 | Open in IMG/M |
| 3300031795|Ga0318557_10290836 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300031798|Ga0318523_10136775 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300031798|Ga0318523_10214717 | Not Available | 961 | Open in IMG/M |
| 3300031798|Ga0318523_10638984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 3300031805|Ga0318497_10181133 | Not Available | 1160 | Open in IMG/M |
| 3300031805|Ga0318497_10765259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300031819|Ga0318568_10513771 | Not Available | 747 | Open in IMG/M |
| 3300031821|Ga0318567_10594626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Cj3 | 628 | Open in IMG/M |
| 3300031833|Ga0310917_10065113 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300031846|Ga0318512_10233883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 905 | Open in IMG/M |
| 3300031860|Ga0318495_10169668 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300031860|Ga0318495_10521579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300031890|Ga0306925_10256165 | Not Available | 1886 | Open in IMG/M |
| 3300031890|Ga0306925_12054085 | Not Available | 537 | Open in IMG/M |
| 3300031890|Ga0306925_12259864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300031893|Ga0318536_10432347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 664 | Open in IMG/M |
| 3300031894|Ga0318522_10068510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1281 | Open in IMG/M |
| 3300031897|Ga0318520_10267314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 1024 | Open in IMG/M |
| 3300031910|Ga0306923_11550865 | Not Available | 691 | Open in IMG/M |
| 3300031910|Ga0306923_12291944 | Not Available | 539 | Open in IMG/M |
| 3300031941|Ga0310912_11080405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300031941|Ga0310912_11271465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300031954|Ga0306926_10203929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2454 | Open in IMG/M |
| 3300032001|Ga0306922_12322694 | Not Available | 514 | Open in IMG/M |
| 3300032008|Ga0318562_10533272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
| 3300032009|Ga0318563_10177162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1147 | Open in IMG/M |
| 3300032009|Ga0318563_10389666 | Not Available | 754 | Open in IMG/M |
| 3300032009|Ga0318563_10449405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300032009|Ga0318563_10714277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mobaraensis | 538 | Open in IMG/M |
| 3300032010|Ga0318569_10338248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300032039|Ga0318559_10368525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300032041|Ga0318549_10250022 | Not Available | 798 | Open in IMG/M |
| 3300032052|Ga0318506_10185268 | Not Available | 917 | Open in IMG/M |
| 3300032052|Ga0318506_10253989 | Not Available | 779 | Open in IMG/M |
| 3300032054|Ga0318570_10074127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 1453 | Open in IMG/M |
| 3300032054|Ga0318570_10463354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300032055|Ga0318575_10192739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1022 | Open in IMG/M |
| 3300032055|Ga0318575_10316941 | Not Available | 789 | Open in IMG/M |
| 3300032060|Ga0318505_10306861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
| 3300032066|Ga0318514_10006691 | All Organisms → cellular organisms → Bacteria | 4735 | Open in IMG/M |
| 3300032076|Ga0306924_10574598 | Not Available | 1278 | Open in IMG/M |
| 3300032076|Ga0306924_11789326 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300032076|Ga0306924_12307852 | Not Available | 545 | Open in IMG/M |
| 3300032089|Ga0318525_10659653 | Not Available | 533 | Open in IMG/M |
| 3300032094|Ga0318540_10489390 | Not Available | 594 | Open in IMG/M |
| 3300032160|Ga0311301_11127121 | Not Available | 1017 | Open in IMG/M |
| 3300032174|Ga0307470_11342518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 587 | Open in IMG/M |
| 3300032205|Ga0307472_101284315 | Not Available | 704 | Open in IMG/M |
| 3300032205|Ga0307472_102098846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 568 | Open in IMG/M |
| 3300032261|Ga0306920_100150700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3465 | Open in IMG/M |
| 3300032261|Ga0306920_101546993 | Not Available | 945 | Open in IMG/M |
| 3300032261|Ga0306920_102312279 | Not Available | 744 | Open in IMG/M |
| 3300032261|Ga0306920_104078250 | Not Available | 529 | Open in IMG/M |
| 3300032261|Ga0306920_104338324 | Not Available | 509 | Open in IMG/M |
| 3300032770|Ga0335085_10847082 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300032770|Ga0335085_12212830 | Not Available | 552 | Open in IMG/M |
| 3300032782|Ga0335082_10182101 | Not Available | 2009 | Open in IMG/M |
| 3300032805|Ga0335078_10102555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4127 | Open in IMG/M |
| 3300032805|Ga0335078_11044823 | Not Available | 962 | Open in IMG/M |
| 3300032828|Ga0335080_11990254 | Not Available | 563 | Open in IMG/M |
| 3300033158|Ga0335077_12000537 | Not Available | 538 | Open in IMG/M |
| 3300033290|Ga0318519_10119093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1443 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.15% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.43% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.43% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.43% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.43% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.43% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028450 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00010610 | 2166559006 | Grass Soil | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVPVAATTPC |
| JGIcombinedJ26739_1011873151 | 3300002245 | Forest Soil | MNINMYVINAVLILMVIRQIREHPLDLRSLAVPVLAVGCAAVLFLHSV |
| JGI26340J50214_100877311 | 3300003368 | Bog Forest Soil | MNINMYVINAILVLMVVRQIREHSLDLRSLAVPVLAVGAAAVMFLHSVPG |
| Ga0062386_1000413541 | 3300004152 | Bog Forest Soil | MGAVRHAGGMNINMYVTNAILVLMVVRQIREHCLDLRSLAVPVLAVGAAAVMFLHSV |
| Ga0066675_100660061 | 3300005187 | Soil | MNINMYVINAILILMVIRQIREHPLDLRSLAVPVLAVGCAAVLFL |
| Ga0066388_1033958152 | 3300005332 | Tropical Forest Soil | MNNATMYVINAILVLMVIRQIREHPLDLRSLAGPVLAVGAAAVL |
| Ga0070709_116447891 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAA |
| Ga0070714_1012144272 | 3300005435 | Agricultural Soil | MNTTSAYIVNAILILLVVRQIREHPMDLRGLAGPVLAVGAAAVFFLRS |
| Ga0070713_1015700721 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMYLINALLVLLVVRQVREHQLDARALAVVLAVAAAAVMFLHAVPAGGSDITLDL |
| Ga0070700_1005687542 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNINMYVINAILILMVVRQVREHPLDLRSLAVPVLAVGCA |
| Ga0070700_1020230611 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNITTYLVSASLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLHSVP |
| Ga0070706_1000373261 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNINMYVINAILVLMVFRQIREHRLDLRALAVPVLAVGIAAVFFLHSVPAART* |
| Ga0070706_1010207881 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVPGGG |
| Ga0070706_1018972122 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFL |
| Ga0070698_1014828851 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNINMYVINAILILMVIRQIREHPLDLRSLAVPVLAVGCAAVLFLHSVP |
| Ga0070697_1000702286 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNTSMYVINAVLVLMVIRQIREHPLDLRSLAGPVLAVGAAAVLFLHSVP |
| Ga0070672_1017358682 | 3300005543 | Miscanthus Rhizosphere | MSNITTYLVSASLILLVIRQIREHPLDLRSLAIPVLAVGVAAFFFLHSVPF |
| Ga0068854_1004937621 | 3300005578 | Corn Rhizosphere | MSNITTYLVSASLILLVIRQIREHPLDARSLAVPVLAVGAAAVMFLHSVP |
| Ga0070763_109254951 | 3300005610 | Soil | MNNITMYLINASLILLVIRQIREHPLDARSLATPV |
| Ga0066905_1004413432 | 3300005713 | Tropical Forest Soil | MDTTSAYIVNGILVLLVVRQIREHRMDLRGLAGPVLAVGA |
| Ga0066903_1004356251 | 3300005764 | Tropical Forest Soil | MNNATMYVINAILVLMVIRQIREHPLDLRSLAGPVLAVGAAAVLFL |
| Ga0066903_1071169542 | 3300005764 | Tropical Forest Soil | MNTTSAYLVNAILVLLVVRQILWHRMDLRGLAGPVLAVGA |
| Ga0070717_101008431 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVINAILVLMVVRQIREHRLDLQALAVPVLAVGAAAVFFLHSVPGGGNDIALEL |
| Ga0070717_109171972 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRGTLNGMNNITMYLVNSALILMVLRQVREHPLDLRSLAGPVVAV |
| Ga0070765_1004244542 | 3300006176 | Soil | MNINMYVTNAVLVLMVIRQIREHPLDLRSLAVPVLA |
| Ga0070765_1015898721 | 3300006176 | Soil | MNINMYVINAVLILMVIRQIREHPLDLRSLAAPVLAVGCAAV |
| Ga0097621_1005191792 | 3300006237 | Miscanthus Rhizosphere | MNNISMYLVNVSLILLVIRQIREHPLDARSLATPVLAVGVAAVMFLHSVPVGG |
| Ga0068871_1007660271 | 3300006358 | Miscanthus Rhizosphere | MNTTSAYIVNAILILLVVRQIREHPMDLRGLAGPVLAVGAAAVFFL |
| Ga0074050_119449912 | 3300006577 | Soil | VVRQIREHSLDLRSLAVPVLAVAAAAVMFLHSVPGGGSDIALELLGVLDR* |
| Ga0066665_109106251 | 3300006796 | Soil | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAV |
| Ga0066659_107651713 | 3300006797 | Soil | MNIYLINALLILLVVRQIREHQLDLRALAVPVLAVGAATV |
| Ga0079221_113708721 | 3300006804 | Agricultural Soil | MSNTNVYVINALLVLLVIRQIREHPLDLRSLAVPVLAVGVA |
| Ga0116215_13119111 | 3300009672 | Peatlands Soil | MNINMYVINAILVLMVVRQIREHSLDLRSLAVPVL |
| Ga0116216_109985672 | 3300009698 | Peatlands Soil | MNTTSAYIVNAILVLLVVRQIREHRMDLSSLAGPVLAVAAAA |
| Ga0116130_12496301 | 3300009762 | Peatland | MNNITMYLINASLILLVIRQIREHPLDARSLMAPVLAVGCAAVLFLHSVP |
| Ga0126374_106602691 | 3300009792 | Tropical Forest Soil | MSNITTYLISASLILLIIRQIREHPLDARSLATCKGSITG* |
| Ga0126373_104023762 | 3300010048 | Tropical Forest Soil | MDTTSAYIVNAILVLLVVRQIREHRMDLRGLAGPVLAVAAAAVFFLR |
| Ga0126373_128673261 | 3300010048 | Tropical Forest Soil | MTTTTAYLVNALLVLLVVRQVLWHRMDLRGLAGPV |
| Ga0074046_108010341 | 3300010339 | Bog Forest Soil | MGAVRHAGGMNINMYVINAILVMMVVRQIREHSLDLRALAVPVLAVGAAAVMF |
| Ga0134125_100713376 | 3300010371 | Terrestrial Soil | MNNTSMYVINAVLVLMVIRQIREHPLDLRSMAGPVLAVGAAAALFLHSV |
| Ga0126381_1042900273 | 3300010376 | Tropical Forest Soil | MSNINVYVVNALLVLMVIRQIREHPLDLRSLAIPVLAVGVAAALFLHSV |
| Ga0126381_1047715481 | 3300010376 | Tropical Forest Soil | MNNATMYVINAILVLMVIRQIREHPLDLRSLAGPVL |
| Ga0136449_1013551981 | 3300010379 | Peatlands Soil | MSSINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAV |
| Ga0136449_1016445901 | 3300010379 | Peatlands Soil | MSMNMYLINAILVLMVIRQIREHSLDLRALAVPVLAVA |
| Ga0136449_1034215681 | 3300010379 | Peatlands Soil | MNINVYVINAILILMVVRQIREHPLDLRSLAIPVLAVGVAAVLFLHSVPLGGSDAVLE |
| Ga0134121_114057242 | 3300010401 | Terrestrial Soil | MNTTTMYVINAVLVLMVIRQIREHPLDLRSLAGPVLAVGAAAVLFL |
| Ga0134121_114836201 | 3300010401 | Terrestrial Soil | MSNINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAVGVAAFF |
| Ga0126361_110866332 | 3300010876 | Boreal Forest Soil | MNINMFVINAVLILMVIRQIREHALDLRSLAAPVLAVGCAAVLFLHSVPGCGPEL* |
| Ga0137391_112722952 | 3300011270 | Vadose Zone Soil | MNNTTMYVINAILVFMVIRQIREHPLDLRSLAGPVLAVG |
| Ga0137388_106665161 | 3300012189 | Vadose Zone Soil | MNINMYLINVALILLVIRQIREHPLDLRSLAVPVLAVGCAA |
| Ga0137383_102393283 | 3300012199 | Vadose Zone Soil | MNIYLINALLVLFVLRQIREHQLDLRALAVPVVAAA |
| Ga0137382_105827762 | 3300012200 | Vadose Zone Soil | MNINMYVINAILILMVIRQIREHPLDLRSLAIPVLAV |
| Ga0137379_113688771 | 3300012209 | Vadose Zone Soil | MNNITTYLVSASLILLVIRQIREHPLDARSLATPVLAVA |
| Ga0137378_102238301 | 3300012210 | Vadose Zone Soil | MNIYLVNALLILLVVRQIREHQLHLRALAVPVLAVAAAAVMFLHA |
| Ga0137377_118538791 | 3300012211 | Vadose Zone Soil | MSINMYVINAILILMVIRQIREHPLDARSLAAPVLAVAAAA |
| Ga0137387_112341712 | 3300012349 | Vadose Zone Soil | MNNITTYLISASLILLVIRQIREHPLDARSLATPVLAVAAAAVMF |
| Ga0137372_100180585 | 3300012350 | Vadose Zone Soil | MNIYLINAVLILLVVRQIREHQLDARALAVPVLAVAAAAVMFLHSVPG |
| Ga0137366_102714602 | 3300012354 | Vadose Zone Soil | MSNITTYLVSASLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLHAVP |
| Ga0157321_10366462 | 3300012487 | Arabidopsis Rhizosphere | MNINMYVINAILILMVVRQVREHPLDLRSLAVPVLAVGC |
| Ga0120172_11232492 | 3300013765 | Permafrost | MLAFMNTTSMYVINAILVLLVVRQIRERRLDLRGLAGRFT |
| Ga0181523_104799831 | 3300014165 | Bog | MGAVRHADGMNINMYVINAILVLMVVRQIREHSLDLRALAVPVLAVGAAAVMFLHSVP |
| Ga0134079_107340821 | 3300014166 | Grasslands Soil | MNNFSMYLINASLILLVIRQIREHPLDARSLAVPALAVGCAAVMFLHSVPVG |
| Ga0132255_1010174272 | 3300015374 | Arabidopsis Rhizosphere | MNIYLINALLVLLVVRQIREHQLDLRVLAVPVLAVPVLAVPVLAV |
| Ga0182036_111700401 | 3300016270 | Soil | MSNINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAVGAAAVLFLRSVP |
| Ga0182032_108888491 | 3300016357 | Soil | MNTISMYVINAALVLMVIRQIREHPLDLRSLAVPVLAVGAAAALFLHSVPVS |
| Ga0182034_113470742 | 3300016371 | Soil | MNIYLINALLILLVVRQVREHQLDLWALAVPVLAVAAA |
| Ga0182040_113756151 | 3300016387 | Soil | MNINMYVINAILILMVIRQIREHPLDLRSLAVPVLAV |
| Ga0182039_104471842 | 3300016422 | Soil | MNIYLINALLILLVVRQVREHQLDLWALAVPVLAVA |
| Ga0182038_106990342 | 3300016445 | Soil | MNINMYVVNAVLILLVVRQVREHPLDLRSLAVPVLAVGVAAVL |
| Ga0182038_107639122 | 3300016445 | Soil | MSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGA |
| Ga0182038_115567301 | 3300016445 | Soil | MNNITTYLISASLILLVIRQIREHPLDVRSLAVPVLAVGAAAVMFLHAVPAGGSD |
| Ga0187812_10073611 | 3300017821 | Freshwater Sediment | MNINMYVINAVLILMVIRQIREHPLDLRSLAAPVLAVSCAAVLFL |
| Ga0187802_102022571 | 3300017822 | Freshwater Sediment | MNINVYVINAILVLMVIRQIREHPLDLRSLAVPVLAVGAA |
| Ga0187807_10752561 | 3300017926 | Freshwater Sediment | MNNITMYLVNAILILMVIRQIREHPLDARSLATPVLAVGCAAVLFLHSVP |
| Ga0187807_11045031 | 3300017926 | Freshwater Sediment | MSINMYVINAILVLMVIRQVREHPLDLRSLAASVLAVGAAAV |
| Ga0187807_12911152 | 3300017926 | Freshwater Sediment | MNIYLINALLVLLVVRQIREHQLDARALAVPVLAVAAAAVMF |
| Ga0187814_101096461 | 3300017932 | Freshwater Sediment | MNIYLINALLVLLVIRQVREHQLDLRALAVPVAAVAAAAVLFLHSVPS |
| Ga0187814_102197601 | 3300017932 | Freshwater Sediment | MNINMYVINAVLVLMVIRQIREHPLDLRSLAVPVLAV |
| Ga0187809_102812241 | 3300017937 | Freshwater Sediment | MNIYLINALLVLLVVRQIREHQLDLRALAVPVLAVGA |
| Ga0187819_102188291 | 3300017943 | Freshwater Sediment | MYVINAILVLMVIRQIREHPLDLRAVAVPVLAVGC |
| Ga0187819_104856881 | 3300017943 | Freshwater Sediment | MNNITMYLINAILILMVIRQIREHPLDARSLVAPVLAVGCAAVLFLHSVP |
| Ga0187817_101715304 | 3300017955 | Freshwater Sediment | MNIYLINALLVLLVICQVREHQLDLQALAVPVAAV |
| Ga0187817_102656201 | 3300017955 | Freshwater Sediment | MGAVRHADGMNINMYVINAILVLMVVRQIREHSLDLRSLAVPVLAVGAAAVMFLHSV |
| Ga0187817_102721141 | 3300017955 | Freshwater Sediment | MNINMYVINAILVLMVVRQIRERSLDLRSLAVPVLAVAAAAVMFLHSVPGGGNDLALEL |
| Ga0187817_110670461 | 3300017955 | Freshwater Sediment | MYVINAILVLMVVRQIREHPLDLRSLAAPVFAVGCAAVLFLHSVPAG |
| Ga0187776_113489711 | 3300017966 | Tropical Peatland | MNIYLINALLVLLVVRQIREHQLDLRALAVPVLAV |
| Ga0187777_103193833 | 3300017974 | Tropical Peatland | MSNINVYVINALLILMVIRQIREHPLDLRSLAGPVLAVGVAAILFLHSVPLGG |
| Ga0187816_100522641 | 3300017995 | Freshwater Sediment | MNINVYVINAILVLMVIRQIREHPLDLRFLAVPLLAVGAAAALFLHSVPL |
| Ga0187815_101652953 | 3300018001 | Freshwater Sediment | MNINVYVINAVLVLMVIRQIREHALDLRSLAVPVLAVGVA |
| Ga0187805_100215471 | 3300018007 | Freshwater Sediment | MNINVYVINAILILMVVRQIREHPLDLRSLAIPVLAVGVAAVLFLHSVP |
| Ga0187805_106489231 | 3300018007 | Freshwater Sediment | MNNITMYLINAILILMVIRQIREHPLDARSPVAPVLAVGCAA |
| Ga0187769_105215152 | 3300018086 | Tropical Peatland | MSNITTYLISASLILLVIRQIREHSLDARSLAVPVLAVGAAAV |
| Ga0187771_101632794 | 3300018088 | Tropical Peatland | MARHCSGMNINVYVVNAVLILLVIRQVREHPLDLRSMGVPVLAVGVAAVLFLHSVPL |
| Ga0066669_102515783 | 3300018482 | Grasslands Soil | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVG |
| Ga0210397_102849292 | 3300021403 | Soil | MNNTTMYVINAVLVLMVVRQIREHPLDLRSLAGPVLAVGAAAVLFLHSVPGGGTD |
| Ga0210386_116205972 | 3300021406 | Soil | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSL |
| Ga0210392_111307991 | 3300021475 | Soil | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVL |
| Ga0210402_100809834 | 3300021478 | Soil | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLF |
| Ga0210402_116103022 | 3300021478 | Soil | MNINVYVINAILILMVVRQIREHPLDLRSLAIPVLAVGVAAVLFLHSVPLGG |
| Ga0210402_118720541 | 3300021478 | Soil | MNTISAYIVNAILVLLVVRQIREHRMDLRGLAGPVLAVGAAAV |
| Ga0126371_102683092 | 3300021560 | Tropical Forest Soil | MSNINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAVG |
| Ga0126371_117091531 | 3300021560 | Tropical Forest Soil | MNNITMYLVNASLILLGIRQIREHPLDARSLMAPVLAVGCAAVLFLHSVPA |
| Ga0247670_10406721 | 3300024283 | Soil | MNINMYVINAILILMVVRQVREHPLDLRSLAVPVLAVAAP |
| Ga0207692_107621982 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MNINMYVINAILILMVIRQIREHPLDLRSLAVPVL |
| Ga0207685_106088341 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNITMYLVSASLILLVIRQIREHPLDARSLATPVLAVGAAAV |
| Ga0207699_100020739 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNTSMYVINAVLVLMVIRQIREHPLDLRSLAGPVL |
| Ga0207699_107472681 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAALFLHSVPGG |
| Ga0207684_100065468 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNINMYVINAILVLMVFRQIREHRLDLRALAVPVLAVGIAAVFFLHSVPAART |
| Ga0207684_102969412 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDNITMYLVNASLILLVIRQIREHPLDARSLMAPVLAVGCAAVMFLHS |
| Ga0207684_112947961 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVNMYVINAILILMVIRQVREHPLDLRSLAVPVLAVG |
| Ga0207684_114625401 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNITTYLVSASLILLVIRQIREHPLDARSLATPVLAVGAAAV |
| Ga0207693_111500942 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNTSMYVINAVLVLMVVRQIREHPLDLRSLAGPVLAV |
| Ga0207663_108265142 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTTSAYIVNAFLILLVVRQIREHPMDLRGLAGPVLVVGTAAVFFLHSVPA |
| Ga0207663_113734181 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTATMYVINAILVLMVIRQIREHPLDLRSLAGPV |
| Ga0207646_115243991 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNINMYVINAILILMVVRQVREHPLDLRSLAVPVLAVGCAAVLFLH |
| Ga0207667_103814701 | 3300025949 | Corn Rhizosphere | MNINMYVINAILILMVVRQVREHPLDLRSLAVPVLAVGCAAVLFLHSV |
| Ga0207677_123003812 | 3300026023 | Miscanthus Rhizosphere | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVP |
| Ga0207639_122493011 | 3300026041 | Corn Rhizosphere | MSNINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAV |
| Ga0207676_100918801 | 3300026095 | Switchgrass Rhizosphere | MNTTSAYIVNAILILLVVRQIREHPMDLRGLAGPVLAVGAAAVFFLR |
| Ga0209055_11041121 | 3300026309 | Soil | MNIYLINALLILLVVRQIREHQLDLRALAVPVLAVAAAAVMFLHAVPA |
| Ga0208604_10018831 | 3300027090 | Forest Soil | MSSINVYVVNAILILMVVRQIREHPLDLRSMAIPVLAVGAAAFLFLHSVPLGGHDVALEA |
| Ga0207826_10920342 | 3300027680 | Tropical Forest Soil | MSSINVYVINALLVLMVIRQIREHPLDLRNLAIPVLAVGVTAALFLHSVPLGG |
| Ga0209073_104030681 | 3300027765 | Agricultural Soil | MNNISMYLVNVSLILLVIRQIREHPLDARSLATPVLAVGVAAVMFLH |
| Ga0209656_100083791 | 3300027812 | Bog Forest Soil | MNIYLINALLVLLVVRQIREHQLDLRALAVPVLAVGAAAV |
| Ga0209656_103573741 | 3300027812 | Bog Forest Soil | MNINMYVINAVLILMVIRQIREHPLDLRSLAVPVLAVGCAA |
| Ga0209579_105084681 | 3300027869 | Surface Soil | MNNISVYLVNASLILLVIRQIREHSLDARSLATPVLAVAAAAVLFL |
| Ga0209283_107637062 | 3300027875 | Vadose Zone Soil | MNNITMYVINSALILMVLRQVREHPLDLRSLAGPVVAVGVAAVLF |
| Ga0209698_112445241 | 3300027911 | Watersheds | MNINMYVINAVLILMVIRQIREHPLDLRSLAAPVLAVGCAAVLF |
| Ga0209526_106596702 | 3300028047 | Forest Soil | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVPGGGNDVQ |
| Ga0189898_10268581 | 3300028450 | Peatlands Soil | MNINVYVINALLILMVIRQIREHRLDLRSLSVPLLA |
| Ga0311331_104608971 | 3300029954 | Bog | MNNITMYLINASLILLVIRQIREHPLDARSLMAPVL |
| Ga0318541_105048271 | 3300031545 | Soil | MGMNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAV |
| Ga0318571_103299331 | 3300031549 | Soil | MNINVYVINAILVLLVVRQIREHPLDLRSLAIPVLAVGAAAV |
| Ga0318573_102022232 | 3300031564 | Soil | MSNITTYLISAGLILLVIRQIREHPLDARSLATPVLAVAAAAVMFLH |
| Ga0318573_102634521 | 3300031564 | Soil | MSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGAAAVMF |
| Ga0318515_107347392 | 3300031572 | Soil | MNIYLINALLVLLVVRQIREHQLDLRALAIPVLAVVAAAVMFLH |
| Ga0310915_105400391 | 3300031573 | Soil | MSNINVYVINALLVLMVIRQIREHPLDLRNLAIPVLAVGAAAAL |
| Ga0318555_105883601 | 3300031640 | Soil | MNTISMYVINAALVLMVIRQIREHPLDLRSLAVPVLAVG |
| Ga0318574_103587293 | 3300031680 | Soil | MSNFNVYLINALLVLMVIRQIREHPLDLRNLAIPVLAVGAAAALFLL |
| Ga0318572_104035061 | 3300031681 | Soil | MTTATMYVINAILVLMVIRQIREHPLDVRSLAGPVLAVGAAAVLFLRS |
| Ga0318560_102720861 | 3300031682 | Soil | MNIYLINALLILLVVRQIREHQLDLRALAVPVLAVAAAAVMFLHAGQV |
| Ga0318496_105686881 | 3300031713 | Soil | MTTATMYVINAILVLMVIRQIREHPLDLRSLAGPVL |
| Ga0318496_106831121 | 3300031713 | Soil | MSNITTYLVSASLILLVIRQIREHPLDARSLATPVLA |
| Ga0307474_103311172 | 3300031718 | Hardwood Forest Soil | MNNITVYLINASLILLVIRQIREHPLDARSLMAPVLAVG |
| Ga0318493_100671011 | 3300031723 | Soil | MNINMYVINAILILMVVRQIREHPLDLRSMAAPVIAVGAAAVLFLRSVPL |
| Ga0318500_104719101 | 3300031724 | Soil | MNIYLINALLVLLVVRQVREHQLDARALAIPVLAVAA |
| Ga0306918_105175051 | 3300031744 | Soil | MNTATMYVINAILVLMVIRQIREHPLDFRSLAGPVLAVGAAAVL |
| Ga0318502_100722824 | 3300031747 | Soil | MNINVYVINAILVLMVIRQIREHSLDLRSLAIPVLAVGAAAVLF |
| Ga0318502_101423613 | 3300031747 | Soil | MKDINVYVINALLVLMVVRQIREHPLDLRNLAIPV |
| Ga0318492_106311531 | 3300031748 | Soil | MNNTTMYVINAILVLLVIRQVREHPLDLRSLAGPVLAVGAAAVLF |
| Ga0318494_100334061 | 3300031751 | Soil | MTTATMYVINAILVLMVIRQIREHPLDLRSLAGPV |
| Ga0318494_100762423 | 3300031751 | Soil | MNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAVLFLH |
| Ga0318494_104601211 | 3300031751 | Soil | MSNITTYLISAGLILLVIRQIREHPLDARSLATPVLA |
| Ga0318494_108126211 | 3300031751 | Soil | MSNINVYVINALLVLMVIRQIREHPLDLRSLAIPVLAVGVAAAL |
| Ga0307477_102907771 | 3300031753 | Hardwood Forest Soil | MNNISVYLINASLILLVIRQIREHPLDARSLATPVL |
| Ga0307477_103359981 | 3300031753 | Hardwood Forest Soil | MTNITMYLINASLILLVIRQIREHPLDARSLATPVLAVGC |
| Ga0318554_101486873 | 3300031765 | Soil | MNNTTMYVINAVLVLMVIRQIREHPLDLRSLAGPVLAVGAAAVLFLH |
| Ga0318554_102585241 | 3300031765 | Soil | MNNITTYLVSASLILLVIRQIREHPLDARSLAVPVLA |
| Ga0318554_106841861 | 3300031765 | Soil | MNNITTYLISASLILLVIRQIREHPLDTRSLAVPVLAVGAAAVMFLH |
| Ga0318526_103386141 | 3300031769 | Soil | MTTATMYVINAILVLMVIRQIREHPLDLRSLAGPVLA |
| Ga0318521_106286431 | 3300031770 | Soil | MGMNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAVLFLH |
| Ga0318546_105175571 | 3300031771 | Soil | MNIYLINALLVLLVVRQIREHQLDARALAIPVLAVAAA |
| Ga0318546_108232251 | 3300031771 | Soil | VHADGMNNTTMYVINAILVLLVIRQIREHPLDLRSLAGPVLAVGAAAVLFL |
| Ga0318498_102857452 | 3300031778 | Soil | MSNITTYLVSASLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLHSVPAD |
| Ga0318498_103526791 | 3300031778 | Soil | MNIYLINALLVLLVIRQIREHQLDARALAIPVLAVAAAAVMFLHA |
| Ga0318566_100052301 | 3300031779 | Soil | MNNTTMYVINAVLVLMVIRQIREHPLDLRSLAVPVLAVGAAAALF |
| Ga0318547_106903641 | 3300031781 | Soil | MNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAVLFLHSVPLGGN |
| Ga0318552_103782672 | 3300031782 | Soil | MNIYLINALLVLVVIRQIREHQLDTRALAVPVLAVAAAAVMFLHAVPG |
| Ga0318552_105219182 | 3300031782 | Soil | MNINMYVINAILILMVVRQIREHPLDLRSMAAPVIAVGAAAVLFLHSVPLGGSDIALEAA |
| Ga0318503_101282082 | 3300031794 | Soil | MNINMYVVNAVLILLVVRQVREHPLDLRSLAVPVLAVGVAAVLFLH |
| Ga0318503_101794892 | 3300031794 | Soil | MNINVYVINAILVLMVIRQTREHPLDLRSLAIPVLAVGAAAVLFLHSVPLGGNDI |
| Ga0318557_102908361 | 3300031795 | Soil | MNIYLINALLVLLVVRQIREHQLDARALAIQDLAV |
| Ga0318523_101367753 | 3300031798 | Soil | MSNINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAVGAAAVLFLRSV |
| Ga0318523_102147171 | 3300031798 | Soil | MSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGAAAV |
| Ga0318523_106389842 | 3300031798 | Soil | MSNINVYVINALLVLMVIRQIREHPLDLRSLAIPVLAVGVAAVLFLRSVP |
| Ga0318497_101811332 | 3300031805 | Soil | MNIYLINALLVLLVVRQIREHQLDARALAVPVLAVAAAAVMFLHAVPGGGHG |
| Ga0318497_107652592 | 3300031805 | Soil | MNTATMYVINAVLVLMVIRQIREHPLDLRSLAVPVLA |
| Ga0318568_105137711 | 3300031819 | Soil | MNNITTYLISASLILLVIRQIREHPLDTRSLAVPVLAVGAAAVM |
| Ga0318567_105946262 | 3300031821 | Soil | MNNITTYLISASLILLVIRQIREHPLDTRSLAVPVLADLADDQE |
| Ga0310917_100651131 | 3300031833 | Soil | MNIYLINALLILLVVRQIREHQLDLRALAVPVLAVAAAAVMFLHTVP |
| Ga0318512_102338832 | 3300031846 | Soil | MNTITMYVINAILVLMVIRQIREHPLDLRSLAVPVLAVGAAAV |
| Ga0318495_101696682 | 3300031860 | Soil | MNINMYVINAILILMVVRQIREHPLDLRSMAAPVIAVGAAAVLFLRSVPIGGSDIALE |
| Ga0318495_105215792 | 3300031860 | Soil | VHADGMNNTTMYVINAILVLLVIRQIREHPLDLRSLAGPVLAVGAAAVLF |
| Ga0306925_102561652 | 3300031890 | Soil | MSNITTYLISAGLILLVIRQIREHPLDARSLATPVLAVAAAAVMFLHSVPAGGS |
| Ga0306925_120540851 | 3300031890 | Soil | MNNITTYLVSASLILLVIRQIREHPLDARSLAVPVLAVGAAAVMFLHSVPAGGS |
| Ga0306925_122598641 | 3300031890 | Soil | MNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAVLFLHSVPLGGNDV |
| Ga0318536_104323471 | 3300031893 | Soil | MNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAVLFLHSV |
| Ga0318522_100685103 | 3300031894 | Soil | MNINMYVINAILILMVIRQIREHPLDLRSLAVPVLAVG |
| Ga0318520_102673142 | 3300031897 | Soil | MSNITTYLISAGLILLVIRQIREHPLDARSLATPVLAV |
| Ga0306923_115508652 | 3300031910 | Soil | MAHGSGMKDINVYVINALLVLMVVRQIREHPLDLRNLAIPVLAVGAAA |
| Ga0306923_122919441 | 3300031910 | Soil | MSNINVYVINALLVLMVIRQIREHPLDLRSLGIPVLAVGAAAALFLHSVP |
| Ga0310912_110804051 | 3300031941 | Soil | MNTITMYVINAILVLMVIRQIREHPLDLRSLAVPVLAVGAAAALFLHSVPVSG |
| Ga0310912_112714652 | 3300031941 | Soil | MNTATMYVINAVLVLMVIRQIREHPLDLRSLAGPVLA |
| Ga0306926_102039296 | 3300031954 | Soil | MNNTTMYVINAVLVLMVIRQIREHPLDLRSLAGPV |
| Ga0306922_123226941 | 3300032001 | Soil | MNIYLINALLVLLVVRQVREHQLDARALAIPVLAVAAAAVMFLH |
| Ga0318562_105332722 | 3300032008 | Soil | MKDINVYVINALLVLMVIRQIREHPLDLRNLAIPVLAVGAAAALF |
| Ga0318563_101771622 | 3300032009 | Soil | MNINMYVVNAVLILLVVRQVREHPLDLRSLAVPVLAVGVAAVLF |
| Ga0318563_103896661 | 3300032009 | Soil | MSNITTYLISAGLILLVIRQIREHPLDARSLATPVLAVA |
| Ga0318563_104494052 | 3300032009 | Soil | MNTATMYVINAILVLMVIRQIREHPLDLRSLAVPVLAVGAAAALFL |
| Ga0318563_107142771 | 3300032009 | Soil | MKDINVYVINALLVLMVVRQIREHPLDLRNLAIPVLAVGAAAALFLRSVPLGGNDIA |
| Ga0318569_103382481 | 3300032010 | Soil | VHADGMNNTTMYVINAILVLLVIRQIREHPLDLRSLA |
| Ga0318559_103685251 | 3300032039 | Soil | MNIYLINALLVLLVIRQIREHQLDARALAVPVLAVAA |
| Ga0318549_102500223 | 3300032041 | Soil | MSNFNVYLINALLVLMVIRQIREHPLDLRNLAIPVLAVGAAAA |
| Ga0318506_101852682 | 3300032052 | Soil | MSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGAADG |
| Ga0318506_102539892 | 3300032052 | Soil | MNINVYVINAILVLMVIRQIREHPLDLRSLAIPVLAVGAAAVLF |
| Ga0318570_100741271 | 3300032054 | Soil | MSNITTYLISAGLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLHSVPAGGSDL |
| Ga0318570_104633541 | 3300032054 | Soil | MNNTTMYVINAVLVLMVIRQIREHPLDLRSLAGPVLAVGAAAVLFLHSVP |
| Ga0318575_101927393 | 3300032055 | Soil | MNNITTYLISASLILLVIRQIREHPLDVRSLAVPVLA |
| Ga0318575_103169412 | 3300032055 | Soil | MSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLHSVPVGGSD |
| Ga0318505_103068613 | 3300032060 | Soil | MKDINVYVINALLVLMVVRQIREHPLDLRNLAIPVLAVGAAA |
| Ga0318514_100066915 | 3300032066 | Soil | MNIYLINALLILLVVRQIREHQLDLRALAVPVLAVAAAAVMFLHAVPS |
| Ga0306924_105745983 | 3300032076 | Soil | MNINVYVINAILVLMVIRQTREHSLDLRSLAIPVLAVGAAAVLFLHSVPLGE |
| Ga0306924_117893261 | 3300032076 | Soil | MNINMYVINAILILMVIRQIREHPLDARSLAAPVLAV |
| Ga0306924_123078521 | 3300032076 | Soil | MNTTTAYLVNAILVLLVVRQVFWHRMDLRGLAGPVLAVGAAA |
| Ga0318525_106596531 | 3300032089 | Soil | MSNINVYVINALLVLMVIRQIREHPLDLRSLALPVLAVGVAAVLFLH |
| Ga0318540_104893901 | 3300032094 | Soil | MSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLH |
| Ga0311301_111271212 | 3300032160 | Peatlands Soil | MNMYLINAILVLMVIRQIREHSLDLRVLAVPVLAVAA |
| Ga0307470_113425181 | 3300032174 | Hardwood Forest Soil | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVPG |
| Ga0307472_1012843151 | 3300032205 | Hardwood Forest Soil | MSNINVYVINALLVLLVIRQIREHPLDLRSLAVPVLAVGVAAV |
| Ga0307472_1020988461 | 3300032205 | Hardwood Forest Soil | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVPAGGNDIVLEL |
| Ga0306920_1001507001 | 3300032261 | Soil | MNIYLINALPVLLVVRQIREHQLDARAMAVPVLAVAAA |
| Ga0306920_1015469931 | 3300032261 | Soil | MNINVYVINAILVLMVIRQIREHPLDLRSLAIPVLAVGAAAVL |
| Ga0306920_1023122792 | 3300032261 | Soil | MSSVSVYVINALLVLLVIRQIREHPLDLRSLAVPVLAV |
| Ga0306920_1040782501 | 3300032261 | Soil | MNINVYVINAILILMVVRQIREHPLDLRSLAIPVLAV |
| Ga0306920_1043383241 | 3300032261 | Soil | MSNITTYLISASLILLVIRQIREHPLDARSLAVPVLAVGAAAV |
| Ga0335085_108470821 | 3300032770 | Soil | MNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGC |
| Ga0335085_122128302 | 3300032770 | Soil | MGAGQHASGMHNITMYLTNAILILMVIRQIREHPLDARSLAGPVLAVSAAA |
| Ga0335082_101821011 | 3300032782 | Soil | MNINMYVINAILILMVVRQIREHPLDLRSMAAPVI |
| Ga0335078_101025551 | 3300032805 | Soil | MSNITTYLVSASLILLVIRQIREHPLDARSLAVPVLA |
| Ga0335078_110448232 | 3300032805 | Soil | MSNINVYVINALLVLLVIRQIREHPLDLRSLAIPV |
| Ga0335080_119902541 | 3300032828 | Soil | MNIYLINALLVLLVIRQIREHQLDLRALAVPVLAVGAAAMMFLHAVPG |
| Ga0335077_120005371 | 3300033158 | Soil | MSNITTYLISAGFILLVIRQIREHPLDARSLANPVLAVGAAAVMFLHSVPA |
| Ga0318519_101190931 | 3300033290 | Soil | VHADGMNNTTMYVINAILVLLVIRQIREHPLDLRSLAGPVLAVGAAAVLFLHSVP |
| ⦗Top⦘ |