


| Basic Information | |
|---|---|
| Family ID | F018108 |
| Family Type | Metagenome |
| Number of Sequences | 237 |
| Average Sequence Length | 46 residues |
| Representative Sequence | EIREMVARAAAGSDDPTQVSLPAPIAIAHHICRRWSSGLDSL |
| Number of Associated Samples | 193 |
| Number of Associated Scaffolds | 237 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.49 % |
| % of genes near scaffold ends (potentially truncated) | 94.09 % |
| % of genes from short scaffolds (< 2000 bps) | 90.72 % |
| Associated GOLD sequencing projects | 183 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.873 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.190 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.097 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.616 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.29% β-sheet: 0.00% Coil/Unstructured: 65.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 237 Family Scaffolds |
|---|---|---|
| PF13531 | SBP_bac_11 | 16.46 |
| PF02668 | TauD | 15.61 |
| PF00106 | adh_short | 8.02 |
| PF01425 | Amidase | 7.17 |
| PF01546 | Peptidase_M20 | 4.64 |
| PF09754 | PAC2 | 2.53 |
| PF00296 | Bac_luciferase | 2.53 |
| PF00561 | Abhydrolase_1 | 2.53 |
| PF01878 | EVE | 1.69 |
| PF11794 | HpaB_N | 1.27 |
| PF00753 | Lactamase_B | 1.27 |
| PF02627 | CMD | 0.84 |
| PF13561 | adh_short_C2 | 0.84 |
| PF04392 | ABC_sub_bind | 0.84 |
| PF04072 | LCM | 0.84 |
| PF00005 | ABC_tran | 0.84 |
| PF09297 | zf-NADH-PPase | 0.84 |
| PF07883 | Cupin_2 | 0.84 |
| PF12867 | DinB_2 | 0.84 |
| PF00072 | Response_reg | 0.42 |
| PF00496 | SBP_bac_5 | 0.42 |
| PF00293 | NUDIX | 0.42 |
| PF00793 | DAHP_synth_1 | 0.42 |
| PF04879 | Molybdop_Fe4S4 | 0.42 |
| PF00440 | TetR_N | 0.42 |
| PF01220 | DHquinase_II | 0.42 |
| PF06267 | DUF1028 | 0.42 |
| PF01738 | DLH | 0.42 |
| PF00378 | ECH_1 | 0.42 |
| PF13414 | TPR_11 | 0.42 |
| PF01764 | Lipase_3 | 0.42 |
| PF04909 | Amidohydro_2 | 0.42 |
| PF13424 | TPR_12 | 0.42 |
| PF00291 | PALP | 0.42 |
| PF12697 | Abhydrolase_6 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 237 Family Scaffolds |
|---|---|---|---|
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 15.61 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 7.17 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.53 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 1.69 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 1.69 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.84 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.84 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.84 |
| COG2816 | NADH pyrophosphatase NudC, Nudix superfamily | Nucleotide transport and metabolism [F] | 0.84 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.84 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
| COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.42 |
| COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.87 % |
| Unclassified | root | N/A | 10.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_102253341 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300000559|F14TC_102374234 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300001356|JGI12269J14319_10371034 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300001661|JGI12053J15887_10259769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 860 | Open in IMG/M |
| 3300004020|Ga0055440_10209165 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300004080|Ga0062385_10705435 | Not Available | 651 | Open in IMG/M |
| 3300004635|Ga0062388_101775941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300005177|Ga0066690_10368940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 974 | Open in IMG/M |
| 3300005187|Ga0066675_10045205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2679 | Open in IMG/M |
| 3300005187|Ga0066675_10911220 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005330|Ga0070690_100654218 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300005332|Ga0066388_100836696 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300005332|Ga0066388_101786232 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300005332|Ga0066388_104067276 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 746 | Open in IMG/M |
| 3300005332|Ga0066388_105846831 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005339|Ga0070660_101852611 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005447|Ga0066689_10430987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 826 | Open in IMG/M |
| 3300005451|Ga0066681_10362766 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005454|Ga0066687_10695098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 605 | Open in IMG/M |
| 3300005459|Ga0068867_100620676 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 945 | Open in IMG/M |
| 3300005467|Ga0070706_101754933 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005471|Ga0070698_100231829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1779 | Open in IMG/M |
| 3300005471|Ga0070698_100594025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1047 | Open in IMG/M |
| 3300005534|Ga0070735_10111651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1714 | Open in IMG/M |
| 3300005538|Ga0070731_10201549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1321 | Open in IMG/M |
| 3300005540|Ga0066697_10242059 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300005547|Ga0070693_100850247 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005549|Ga0070704_100927090 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005552|Ga0066701_10421415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 827 | Open in IMG/M |
| 3300005553|Ga0066695_10237475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1149 | Open in IMG/M |
| 3300005576|Ga0066708_10011042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4259 | Open in IMG/M |
| 3300005598|Ga0066706_10817376 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005610|Ga0070763_10972366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300005713|Ga0066905_100441545 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300005764|Ga0066903_104276414 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005764|Ga0066903_106541677 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006057|Ga0075026_101047410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300006755|Ga0079222_10729772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
| 3300006797|Ga0066659_11145959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300006806|Ga0079220_11049028 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300006854|Ga0075425_100091993 | All Organisms → cellular organisms → Bacteria | 3440 | Open in IMG/M |
| 3300006854|Ga0075425_100428482 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300006854|Ga0075425_102049564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 639 | Open in IMG/M |
| 3300006871|Ga0075434_100560735 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300006904|Ga0075424_100174269 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2282 | Open in IMG/M |
| 3300006969|Ga0075419_10002017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13166 | Open in IMG/M |
| 3300006969|Ga0075419_11253796 | Not Available | 549 | Open in IMG/M |
| 3300007076|Ga0075435_100977863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 739 | Open in IMG/M |
| 3300007255|Ga0099791_10051372 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300007265|Ga0099794_10794459 | Not Available | 506 | Open in IMG/M |
| 3300009012|Ga0066710_103032489 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300009012|Ga0066710_104260224 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300009088|Ga0099830_11356602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300009089|Ga0099828_10809452 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300009089|Ga0099828_11817119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300009089|Ga0099828_11886462 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009090|Ga0099827_10401437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1172 | Open in IMG/M |
| 3300009090|Ga0099827_10670455 | Not Available | 896 | Open in IMG/M |
| 3300009090|Ga0099827_10774278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300009094|Ga0111539_11345347 | Not Available | 829 | Open in IMG/M |
| 3300009094|Ga0111539_13054028 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300009137|Ga0066709_100184956 | All Organisms → cellular organisms → Bacteria | 2717 | Open in IMG/M |
| 3300009137|Ga0066709_102972561 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300009143|Ga0099792_10367525 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300009156|Ga0111538_10031586 | All Organisms → cellular organisms → Bacteria | 6862 | Open in IMG/M |
| 3300009156|Ga0111538_12008142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 727 | Open in IMG/M |
| 3300009553|Ga0105249_10184886 | Not Available | 2030 | Open in IMG/M |
| 3300009789|Ga0126307_10363099 | Not Available | 1166 | Open in IMG/M |
| 3300009807|Ga0105061_1070263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300009837|Ga0105058_1100462 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010029|Ga0105074_1119031 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010046|Ga0126384_11303549 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010047|Ga0126382_10887319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 770 | Open in IMG/M |
| 3300010047|Ga0126382_11328532 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010048|Ga0126373_10729142 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300010048|Ga0126373_12173306 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300010304|Ga0134088_10002225 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 7754 | Open in IMG/M |
| 3300010304|Ga0134088_10154623 | Not Available | 1092 | Open in IMG/M |
| 3300010304|Ga0134088_10267223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 824 | Open in IMG/M |
| 3300010326|Ga0134065_10261791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300010336|Ga0134071_10480498 | Not Available | 640 | Open in IMG/M |
| 3300010337|Ga0134062_10640593 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010358|Ga0126370_12029205 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 563 | Open in IMG/M |
| 3300010359|Ga0126376_11011765 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 832 | Open in IMG/M |
| 3300010359|Ga0126376_12400649 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010360|Ga0126372_10569014 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300010360|Ga0126372_12392156 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010361|Ga0126378_12303899 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010362|Ga0126377_10984002 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 909 | Open in IMG/M |
| 3300010366|Ga0126379_12735257 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300010366|Ga0126379_12906995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
| 3300010376|Ga0126381_103971213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300010379|Ga0136449_102182846 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300010391|Ga0136847_13188172 | Not Available | 699 | Open in IMG/M |
| 3300010399|Ga0134127_12854537 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300011271|Ga0137393_10171288 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300011414|Ga0137442_1145585 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012096|Ga0137389_11002361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300012181|Ga0153922_1165509 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012189|Ga0137388_10474835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
| 3300012199|Ga0137383_10118874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1926 | Open in IMG/M |
| 3300012202|Ga0137363_11073766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300012209|Ga0137379_11175495 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012212|Ga0150985_104860623 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012212|Ga0150985_113105872 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300012349|Ga0137387_10854844 | Not Available | 658 | Open in IMG/M |
| 3300012351|Ga0137386_11273991 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012353|Ga0137367_11119627 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012361|Ga0137360_11087359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300012361|Ga0137360_11764808 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300012362|Ga0137361_10496209 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300012363|Ga0137390_11909463 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012469|Ga0150984_106144775 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012469|Ga0150984_117772542 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300012685|Ga0137397_10098563 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300012685|Ga0137397_10662717 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012685|Ga0137397_10690839 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 758 | Open in IMG/M |
| 3300012944|Ga0137410_10807056 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 788 | Open in IMG/M |
| 3300012948|Ga0126375_10693335 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300012957|Ga0164303_10598790 | Not Available | 725 | Open in IMG/M |
| 3300012971|Ga0126369_10399043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1412 | Open in IMG/M |
| 3300012971|Ga0126369_11977880 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 671 | Open in IMG/M |
| 3300012987|Ga0164307_10392759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
| 3300013096|Ga0157307_1129327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300013102|Ga0157371_10862223 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300013764|Ga0120111_1146578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300013770|Ga0120123_1027934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1161 | Open in IMG/M |
| 3300014169|Ga0181531_10766243 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300014501|Ga0182024_11507519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
| 3300014745|Ga0157377_11145531 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300015245|Ga0137409_10660958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 878 | Open in IMG/M |
| 3300015373|Ga0132257_100165485 | All Organisms → cellular organisms → Bacteria | 2600 | Open in IMG/M |
| 3300016270|Ga0182036_10427291 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300016294|Ga0182041_11584000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300016341|Ga0182035_11922286 | Not Available | 537 | Open in IMG/M |
| 3300017656|Ga0134112_10000763 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 9094 | Open in IMG/M |
| 3300017659|Ga0134083_10022905 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300017659|Ga0134083_10087633 | Not Available | 1215 | Open in IMG/M |
| 3300017955|Ga0187817_10585685 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300017970|Ga0187783_10853030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300018012|Ga0187810_10308722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 655 | Open in IMG/M |
| 3300018027|Ga0184605_10015461 | All Organisms → cellular organisms → Bacteria | 2991 | Open in IMG/M |
| 3300018029|Ga0187787_10366235 | Not Available | 559 | Open in IMG/M |
| 3300018031|Ga0184634_10272181 | Not Available | 777 | Open in IMG/M |
| 3300018054|Ga0184621_10127978 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 910 | Open in IMG/M |
| 3300018061|Ga0184619_10080077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1450 | Open in IMG/M |
| 3300018089|Ga0187774_11379456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
| 3300018468|Ga0066662_12026803 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300019888|Ga0193751_1079183 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300020020|Ga0193738_1147249 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300020170|Ga0179594_10099928 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300020170|Ga0179594_10113853 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300020199|Ga0179592_10312580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
| 3300020581|Ga0210399_10145929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927 | 1956 | Open in IMG/M |
| 3300021051|Ga0206224_1038409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300021432|Ga0210384_10450794 | Not Available | 1159 | Open in IMG/M |
| 3300021445|Ga0182009_10241033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 894 | Open in IMG/M |
| 3300021560|Ga0126371_10288451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1765 | Open in IMG/M |
| 3300021560|Ga0126371_10294939 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300022756|Ga0222622_11102451 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300024317|Ga0247660_1048404 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300025915|Ga0207693_10501859 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300025928|Ga0207700_10306831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1372 | Open in IMG/M |
| 3300025945|Ga0207679_12044254 | Not Available | 521 | Open in IMG/M |
| 3300025949|Ga0207667_11802750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300025960|Ga0207651_10905429 | Not Available | 786 | Open in IMG/M |
| 3300025960|Ga0207651_11213688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300026089|Ga0207648_10647277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 977 | Open in IMG/M |
| 3300026297|Ga0209237_1201673 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
| 3300026328|Ga0209802_1004275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9353 | Open in IMG/M |
| 3300026331|Ga0209267_1102096 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300026343|Ga0209159_1182258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300026358|Ga0257166_1047314 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 610 | Open in IMG/M |
| 3300027324|Ga0209845_1025852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
| 3300027383|Ga0209213_1031769 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300027527|Ga0209684_1041839 | Not Available | 703 | Open in IMG/M |
| 3300027722|Ga0209819_10352691 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027869|Ga0209579_10631524 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300027882|Ga0209590_10847806 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300027903|Ga0209488_10467425 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300027905|Ga0209415_10656304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
| 3300028715|Ga0307313_10189003 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
| 3300028807|Ga0307305_10155687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1055 | Open in IMG/M |
| 3300028812|Ga0247825_10763108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300028819|Ga0307296_10343896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 814 | Open in IMG/M |
| 3300030053|Ga0302177_10578894 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031543|Ga0318516_10002500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7641 | Open in IMG/M |
| 3300031543|Ga0318516_10182315 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300031640|Ga0318555_10064517 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300031679|Ga0318561_10002975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6453 | Open in IMG/M |
| 3300031681|Ga0318572_10451019 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031682|Ga0318560_10476111 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031713|Ga0318496_10095022 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300031720|Ga0307469_11026077 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031720|Ga0307469_11641188 | Not Available | 618 | Open in IMG/M |
| 3300031740|Ga0307468_100102039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1708 | Open in IMG/M |
| 3300031740|Ga0307468_102074539 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031747|Ga0318502_10534482 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300031763|Ga0318537_10299446 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031768|Ga0318509_10315948 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 874 | Open in IMG/M |
| 3300031778|Ga0318498_10120555 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300031797|Ga0318550_10220523 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 919 | Open in IMG/M |
| 3300031847|Ga0310907_10309913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300031890|Ga0306925_10024348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6100 | Open in IMG/M |
| 3300031890|Ga0306925_11843429 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031893|Ga0318536_10328229 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300031896|Ga0318551_10055377 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300031896|Ga0318551_10345753 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 841 | Open in IMG/M |
| 3300031897|Ga0318520_10174279 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300031941|Ga0310912_10727733 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 768 | Open in IMG/M |
| 3300031942|Ga0310916_11574595 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031946|Ga0310910_10743527 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300031954|Ga0306926_12679947 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031962|Ga0307479_10498091 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300031981|Ga0318531_10508059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300032001|Ga0306922_10175691 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
| 3300032008|Ga0318562_10871749 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300032025|Ga0318507_10245224 | Not Available | 777 | Open in IMG/M |
| 3300032035|Ga0310911_10510312 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300032064|Ga0318510_10531747 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
| 3300032066|Ga0318514_10061652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1837 | Open in IMG/M |
| 3300032067|Ga0318524_10365160 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300032091|Ga0318577_10061271 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300032091|Ga0318577_10649519 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300032094|Ga0318540_10011976 | All Organisms → cellular organisms → Bacteria | 3420 | Open in IMG/M |
| 3300032180|Ga0307471_102995575 | Not Available | 599 | Open in IMG/M |
| 3300032180|Ga0307471_103927111 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300032261|Ga0306920_100165535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3296 | Open in IMG/M |
| 3300032261|Ga0306920_100962245 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1245 | Open in IMG/M |
| 3300032770|Ga0335085_10674313 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300032897|Ga0335071_10597711 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300032955|Ga0335076_10667034 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300033289|Ga0310914_10344686 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300033290|Ga0318519_10308455 | Not Available | 928 | Open in IMG/M |
| 3300033290|Ga0318519_10598210 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300034354|Ga0364943_0176086 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300034819|Ga0373958_0111514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1 | 652 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.19% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.69% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.27% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.42% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.42% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.42% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.42% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.42% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.42% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.42% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.42% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1022533411 | 3300000559 | Soil | ARAAAGADDPTRASLPAPVAIAHHICRRWSNGLDSL* |
| F14TC_1023742341 | 3300000559 | Soil | ARAAAGAEDPTRASLPAPVAIAHHICRRWSNGLDGL* |
| JGI12269J14319_103710342 | 3300001356 | Peatlands Soil | EELAEARWFEREEIRAMVARAAAGPDDPTQISVPGPVAIAHQICRRWSYGLDSL* |
| JGI12053J15887_102597692 | 3300001661 | Forest Soil | ELAEARWFHRDEIRAMVARAASGPDDPTQLSLPGPVAIAHHICRRWSNRLDSL* |
| Ga0055440_102091651 | 3300004020 | Natural And Restored Wetlands | EELAEARWFGREEIAAMVARAATGPDDPSQLSLPPPLAIAHQICRRWASGHDAL* |
| Ga0062385_107054351 | 3300004080 | Bog Forest Soil | FDRDEIRDMVARAAAGDPDPAATLPSLPGPVAIAHQICRRWATGIDSV* |
| Ga0062388_1017759411 | 3300004635 | Bog Forest Soil | EIRAMVARAATGPDDPTQVSVPGPVAIAHQLCRRWSYGLDSL* |
| Ga0066690_103689401 | 3300005177 | Soil | EIRAMVARAASGPDDPTQVSVPGPIAIAHHICRRWSYGLDQL* |
| Ga0066675_100452055 | 3300005187 | Soil | AEARWFHRDEIRAMVVHAANGLDDPTQVSVPGPVAIAHHICRRWSNGLDSL* |
| Ga0066675_109112201 | 3300005187 | Soil | RGALFSRDEIREMVARAAAGPDDPKQVSLPSPIAIAHHMCRRWASGLDSV* |
| Ga0070690_1006542181 | 3300005330 | Switchgrass Rhizosphere | RAMVERAATGPDDPTQVSLPGPVAIAHHLCRRWSHGLDDI* |
| Ga0066388_1008366962 | 3300005332 | Tropical Forest Soil | EARWFTRDEIREMVARAATGPDDPTRVSLPAPVAIAHHICRRWSHDLDGL* |
| Ga0066388_1017862322 | 3300005332 | Tropical Forest Soil | VEARWFARDEIRDMVARAAAGDPDPGTTVPSLPGPVAIAHHICRRWANALDSV* |
| Ga0066388_1040672761 | 3300005332 | Tropical Forest Soil | DEIREMVARAAAGPDDPSRVSLPAPIAIAHHICKRWSSGQDSI* |
| Ga0066388_1058468311 | 3300005332 | Tropical Forest Soil | VRTMVTRAASGPDDPTQVSLPQPIAIAHHICRRWSHGLEGV* |
| Ga0070660_1018526112 | 3300005339 | Corn Rhizosphere | AMVERAATGPDDPTQLSIPGPVAIAHHLCRRWSFGLDSL* |
| Ga0066689_104309871 | 3300005447 | Soil | RDEIREMVARAAAGSDDAAQVSLPPPIAIAHHICRRWSSGLDSV* |
| Ga0066681_103627661 | 3300005451 | Soil | EIRAMVAGAATGADDPTQVSLPGPVAIAHHICRRWSNGLDSL* |
| Ga0066687_106950981 | 3300005454 | Soil | HRDEIREMVARAAAGADDPAQVSLPAPIAIAHHICRRWSSGLDSL* |
| Ga0068867_1006206762 | 3300005459 | Miscanthus Rhizosphere | EIREMVARAAAGTDDPAQVSLPAPVAIAHHICRRWSSGLDSL* |
| Ga0070706_1017549331 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | EARWFSRDEIREMVRRAADGPDDPARVSLPVPIAIAHHICRRWSHGLDSI* |
| Ga0070698_1002318293 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LVEARWFDRDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWAHGLDSV* |
| Ga0070698_1005940252 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | WFHRDEIRAMVARAISGPDDPTQVSVPGPIAIAHHICRRWSYGLDQL* |
| Ga0070735_101116511 | 3300005534 | Surface Soil | IRKMVARAANGPDDPTQVSLPQPLAIAHHICRRWSNGLDEI* |
| Ga0070731_102015491 | 3300005538 | Surface Soil | IREMVARAASGEDDPSKVSIPQPLAIAHHICRRWSNRLDDI* |
| Ga0066697_102420593 | 3300005540 | Soil | MVARAAAGPDDPKQVSLPSPIAIAHHMCRRWASGLDSV* |
| Ga0070693_1008502472 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DIRAMVERAATGPDDPTQLSIPGPVAIAHHLCRRWSFGLDSL* |
| Ga0070704_1009270901 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AEARWFSRDEIREMVARAAAGSDDPARPSLPAPIAIAHHICRRWSSGLDGV* |
| Ga0066701_104214151 | 3300005552 | Soil | EELAEARWFEREEIRAMVARAATGPDDLTQVSVPGPVAIAHQLCRRWSYRLDSL* |
| Ga0066695_102374753 | 3300005553 | Soil | EELAEARWFHRDEIRAMVVHAANGLDDPTQVSVPGPVAIAHHICRRWSNGLDSL* |
| Ga0066708_100110421 | 3300005576 | Soil | WFHRDEIREMVARAATSADDPAQASLPAPIAIAHHICRRWASGLDSL* |
| Ga0066706_108173761 | 3300005598 | Soil | AEARWFHRDEIRAMVVHAANGLDDPTQVSVPGPVAIAHHICRRWSNALDSL* |
| Ga0070763_109723662 | 3300005610 | Soil | TMVARAATGPDDPTQVSLPGPLAIAHHLCRRWSHGLDDLD* |
| Ga0066905_1004415451 | 3300005713 | Tropical Forest Soil | RAAAGADDPTRASLPAPVAIAHHICRRWSNGLDSL* |
| Ga0066903_1042764141 | 3300005764 | Tropical Forest Soil | AEARWFTRDEIREMVARAAAGPDDPTRVSLPGPVAIAHHICRRWSHDLDGL* |
| Ga0066903_1065416772 | 3300005764 | Tropical Forest Soil | RAANGADDINQLSLPQPIAIAHHLCRRWSNGLDEI* |
| Ga0075026_1010474102 | 3300006057 | Watersheds | PEELVEARWFARDEILNMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWANGIDSI* |
| Ga0079222_107297721 | 3300006755 | Agricultural Soil | MVARAASGPDDPTQVSLPGPVAIAHHICRRWSNGLHSL* |
| Ga0066659_111459591 | 3300006797 | Soil | TVDPEELVEARWFDRDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWAHGLDSF |
| Ga0079220_110490283 | 3300006806 | Agricultural Soil | REEIRLMVARAAAGPDDPIQVTLPAPIAIAHHICRRWSNGLDEI* |
| Ga0075425_1000919934 | 3300006854 | Populus Rhizosphere | PREEIREMVARAAAGVDDPSRVSLPAPVAIAHHICRRWSNGLDSL* |
| Ga0075425_1004284821 | 3300006854 | Populus Rhizosphere | RAAAGVDDPSRVSLPAPVAIAHHICRRWSNGLDSL* |
| Ga0075425_1020495641 | 3300006854 | Populus Rhizosphere | EIREMVARAAAGSDDPTQVSLPAPIAIAHHICRRWSSGLDSL* |
| Ga0075434_1005607351 | 3300006871 | Populus Rhizosphere | RWFSRDEIRAMVARAATGPDDPAQVSLPSPIAIAHHICRRWSSGLDSV* |
| Ga0075424_1001742693 | 3300006904 | Populus Rhizosphere | EIREMVARAVAGPDDATQVSLPAPIAIAHHICRRWSNGQDTI* |
| Ga0075419_100020171 | 3300006969 | Populus Rhizosphere | SRDEVREMVARAAAGVDDASQASLPAPIAIAHHICRRWSSGLDSL* |
| Ga0075419_112537961 | 3300006969 | Populus Rhizosphere | SRDEVREMVARAAAGVDDASQASLPAPIAIAHHICRRWSSGHDSL* |
| Ga0075435_1009778631 | 3300007076 | Populus Rhizosphere | PEELAEARWFHRDEIREMVARAASGVDDPAQASLPAPIAIAHHICRRWSNGLDSL* |
| Ga0099791_100513721 | 3300007255 | Vadose Zone Soil | TVDPEELVEARWFERDEIRDMVTRAAAGDPDPATTVPSLPGPVAIAHQICRRWANGLDSV |
| Ga0099794_107944591 | 3300007265 | Vadose Zone Soil | PEELVEARWFDREEIRDMVGRAAAGDPDPATTVPSLPGPVAIAHQICRRWATGLDSV* |
| Ga0066710_1030324891 | 3300009012 | Grasslands Soil | RDEIRGMVARAASGPDDATQLSLPGPVAVAHHICRRWSNGLDSL |
| Ga0066710_1042602242 | 3300009012 | Grasslands Soil | MVARAAAGPDDPKQVSLPSPIAIAHHMCRRWASGLDSV |
| Ga0099830_113566022 | 3300009088 | Vadose Zone Soil | WFSRDEIREMVARAAAGPDDPAQVSLPSPIAIAHHICRRWSSGLDSV* |
| Ga0099828_108094523 | 3300009089 | Vadose Zone Soil | DPEELAEARWFERGEIRAMVERAARGAEDLTQVSVPGPVAIAHQLCRRWSYGLDSL* |
| Ga0099828_118171191 | 3300009089 | Vadose Zone Soil | RAAAGPDDPAQVSLPSPIAIAHHICRRWSSGLDSV* |
| Ga0099828_118864622 | 3300009089 | Vadose Zone Soil | MEEIREMVARAAVGPDDPTRVSLPPLAIAHQGCRRWSNGLDSV* |
| Ga0099827_104014371 | 3300009090 | Vadose Zone Soil | IREMVTRAAAGSDDPTRPSLPAPIAIAHHICRRWSQGLDSV* |
| Ga0099827_106704552 | 3300009090 | Vadose Zone Soil | SRDEIREMVARAAAGPDDPAQVSLPSPIAIAHHICRRWSSGLDSL* |
| Ga0099827_107742781 | 3300009090 | Vadose Zone Soil | EEIRVMVARAATGPDDPTQVSVPGPVAIAHQICRRWSNRLDSL* |
| Ga0111539_113453471 | 3300009094 | Populus Rhizosphere | IREMVARAAAGPDDPTKVSLPAPVAIAHHICRRWSSGLDRV* |
| Ga0111539_130540282 | 3300009094 | Populus Rhizosphere | RDEVREMVARAAAGPDDPTRVSLPSPIAIAHHICRRWSSGRAGVS* |
| Ga0066709_1001849565 | 3300009137 | Grasslands Soil | HRDEIRAMVVHAANGLDDPTQVSVPGPVAIAHHICRRWSNGLDSL* |
| Ga0066709_1029725612 | 3300009137 | Grasslands Soil | AMVARAATGPDDLTQVSVPGPVAIAHQLCRRWSYGLDSL* |
| Ga0099792_103675253 | 3300009143 | Vadose Zone Soil | VARAATGPDDLTQVSVPGPVAIAHQICRRWSYGLDSL* |
| Ga0111538_100315868 | 3300009156 | Populus Rhizosphere | AEARWFHRDEIREMVARAAAGADDPTRASLPAPVAIAHHICRRWSNGLDSL* |
| Ga0111538_120081421 | 3300009156 | Populus Rhizosphere | FSRDEVREMVARAAAGPDDPTRVSLPSPIAIAHHICRRWSSGRAGVS* |
| Ga0105249_101848861 | 3300009553 | Switchgrass Rhizosphere | MVARAATGPDDPTKVSLPAPIAIAHHICRRWATGLDDI* |
| Ga0126307_103630991 | 3300009789 | Serpentine Soil | RAATGPDDPTQLSIPGPVAIAHHLCRRWSNRVDEV* |
| Ga0105061_10702632 | 3300009807 | Groundwater Sand | AEARWFHRDEIREMVARAAAGSDDPAQVSLPSPIAIAHHICRRWSSGLDSV* |
| Ga0105058_11004622 | 3300009837 | Groundwater Sand | EMVARAAAGSDDPAQVSLPAPIAIAHHICRRWSSGLDSM* |
| Ga0105074_11190311 | 3300010029 | Groundwater Sand | EIAEARWFRRDEIREMVARAAAGADDPSQVSLPAPIAIAHHICRRWSSGLDSL* |
| Ga0126384_113035491 | 3300010046 | Tropical Forest Soil | EELAEARWFHRDEIREMVARAATGIDDATRASLPAPLAIAHHICRRWSNGLDGL* |
| Ga0126382_108873191 | 3300010047 | Tropical Forest Soil | DPEELAEARWFHREEIRAMVARAASGPDDPTQVSVPGPVAIAHHICRRWSNGLDTLATP* |
| Ga0126382_113285321 | 3300010047 | Tropical Forest Soil | RWFHRDEIREMVARAAAGADDPGRASLPAPIAIAHHICRRWSSGLDSV* |
| Ga0126373_107291422 | 3300010048 | Tropical Forest Soil | AEARWFERAEIREMVARAANGEDDPSKISIPQPLAIAHHLCRRWSHGLDEI* |
| Ga0126373_121733062 | 3300010048 | Tropical Forest Soil | AAAGEDDISQLSLPQPIAIAHHLCRRWSNGLDEI* |
| Ga0134088_100022251 | 3300010304 | Grasslands Soil | ARAAAGTDDQGQASLPAPIAIAHHICRRWSNGLDRL* |
| Ga0134088_101546231 | 3300010304 | Grasslands Soil | EIREMVARAAAGADDPAKVSLPAPIAIAHHICRRWSSGQDSL* |
| Ga0134088_102672231 | 3300010304 | Grasslands Soil | MVARAAAGSDDPAQASLPQPIAIAHHICRRWSSGLDSM* |
| Ga0134065_102617912 | 3300010326 | Grasslands Soil | AMVVHAANGLDDPTQVSVPGPVAIAHHICRRWSNGLDSL* |
| Ga0134071_104804981 | 3300010336 | Grasslands Soil | PEELAEARWFPRHEIREMVARAAAGAGADDPAQVSLPQPIAIAHHICRRWSSGLDSV* |
| Ga0134062_106405932 | 3300010337 | Grasslands Soil | DEIREMVARAATGLDDPTQVSLPQPLAIAHHICRRWSNGLDEI* |
| Ga0126370_120292051 | 3300010358 | Tropical Forest Soil | RWFHRDEIREMVKRAATGPDDPTQVSVPAPIAIAHQICRRWSHGLDQV* |
| Ga0126376_110117652 | 3300010359 | Tropical Forest Soil | ARAAAGVDDPTRVSLPAPIAIAHHICRRWSNRLDSL* |
| Ga0126376_124006492 | 3300010359 | Tropical Forest Soil | LMMGFLAEARWFRRDEIREMVARAAAGVDDPTRVSLPAPIAIAHHICRRWSNGLDSL* |
| Ga0126372_105690142 | 3300010360 | Tropical Forest Soil | MVARAAAGADDPTRASLPAPVAISHHICRRWSNGLDGL* |
| Ga0126372_123921562 | 3300010360 | Tropical Forest Soil | RWFTRDEIREMVVRAATGPDDPARVSLPAPVAIAHHICRRWSHDLDGL* |
| Ga0126378_123038992 | 3300010361 | Tropical Forest Soil | VARAASGDDDPARVSLPQPLAIAHQICRRWSNRLDEI* |
| Ga0126377_109840021 | 3300010362 | Tropical Forest Soil | ELAEARWFPRDEIREMVARAAAGTDDPDRASLPAPIAIAHHICRRWSNGLDSL* |
| Ga0126379_127352572 | 3300010366 | Tropical Forest Soil | AEARWFHRDEIREMVARAANGPDDPTQLSLPQPLAIAHQICRRWSNHLDSL* |
| Ga0126379_129069952 | 3300010366 | Tropical Forest Soil | FHRDEIREMAARAAAGTDHPDRASLPAPIAIAHHICRRWSNGLDSL* |
| Ga0126381_1039712132 | 3300010376 | Tropical Forest Soil | VDPEELVEARWFARDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWANAVDSV* |
| Ga0136449_1021828462 | 3300010379 | Peatlands Soil | MVARAATGPDDPTQVSVPGPVAIAHQICRRWSYGLDAI* |
| Ga0136847_131881721 | 3300010391 | Freshwater Sediment | MREMVARAATGPDDPTRVSLPAPIAIAHHICRRWATGLDNI* |
| Ga0134127_128545372 | 3300010399 | Terrestrial Soil | REEIRRMVARAAAGPDDPTQVSLPAPIAIAHHICRRWSSGLDEI* |
| Ga0137393_101712882 | 3300011271 | Vadose Zone Soil | MAARAAAGSDDPAQVSLPSPIAIAHHICRRWSSGLDSV* |
| Ga0137442_11455852 | 3300011414 | Soil | WFEREQIRAMVERAATGPDDPTQVSVPGPVAIAHQICRRWSNRLDGL* |
| Ga0137389_110023612 | 3300012096 | Vadose Zone Soil | EARWFSRQEIRDMVARAAAGADDPAQVSLPAPIAIAHHICRRWSSGLDSV* |
| Ga0153922_11655092 | 3300012181 | Attine Ant Fungus Gardens | LAEARWFSREEIRTMVARAATGPDDPTQVSLPGPVAIAHHLCRRWSHGLDDLD* |
| Ga0137388_104748351 | 3300012189 | Vadose Zone Soil | RAATGPDDLTQVSVPGPVAIAHQLCRRWSYGLDSL* |
| Ga0137383_101188744 | 3300012199 | Vadose Zone Soil | EARWFHRDDIRAMVVHAANGLDDPTQVSVPGPVAIAHHICRRWSNGLDSL* |
| Ga0137363_110737661 | 3300012202 | Vadose Zone Soil | MVARAISGPDDPARVSVPGPIAIAHHICRRWSYGLDRLDP* |
| Ga0137379_111754953 | 3300012209 | Vadose Zone Soil | RAMVVHAANGLDDPTQVSVPGPAAIAHHICRRWSNALDSL* |
| Ga0150985_1048606232 | 3300012212 | Avena Fatua Rhizosphere | RAMVERAATGPDDPMRVSVPGPVAIAHQLCRRWSNRLDSI* |
| Ga0150985_1131058721 | 3300012212 | Avena Fatua Rhizosphere | EIRAMVARAATGPDDPTQLSLPGPVAIAHHLCRRWSHGLDDI* |
| Ga0137387_108548441 | 3300012349 | Vadose Zone Soil | RRDEIREMVARAAAGSDDPAKVSLPAPIAIAHHICRRWSSGQDSL* |
| Ga0137386_112739912 | 3300012351 | Vadose Zone Soil | REEIRAMVARAATGPDDLTQVSVPGPVAIAHQLCRRWSYRLDSL* |
| Ga0137367_111196271 | 3300012353 | Vadose Zone Soil | VARAASGPEDPTQVSVPGPIAIAHHICRRWSYGLDKLDP* |
| Ga0137360_110873591 | 3300012361 | Vadose Zone Soil | LAEARWFHRDEIRAMVARAASGPDDPTQISVPGPVAIAHHICRRWSYGLDRLDP* |
| Ga0137360_117648081 | 3300012361 | Vadose Zone Soil | RDEIREMVARAAAGIDDPAQASLPAPIAIAHHICRRWSNGLDSL* |
| Ga0137361_104962091 | 3300012362 | Vadose Zone Soil | AAAGSDDPAQVSLPSPIAIAHHICRRWSSGLDSV* |
| Ga0137390_119094632 | 3300012363 | Vadose Zone Soil | IRAMVARAATGPDDLTQVSVPGPVAIAHQLCRRWSYGLDSL* |
| Ga0150984_1061447751 | 3300012469 | Avena Fatua Rhizosphere | ARWFARDEIRAMVARAATGPDDPTQLSLPGPVAIAHHICRRWSNGLDDP* |
| Ga0150984_1177725423 | 3300012469 | Avena Fatua Rhizosphere | EIRAMVERAAPGPDAPTQVSLPGPVAIAHHLCRRWSHGLDDI* |
| Ga0137397_100985632 | 3300012685 | Vadose Zone Soil | MVARAAAGPDDPTKVSLPAPIAIAHHICRRWSSGLDSV* |
| Ga0137397_106627171 | 3300012685 | Vadose Zone Soil | EIREMVARAAAGPDDPTKVSLPAPIAIAHHICRRWSSGLDSV* |
| Ga0137397_106908391 | 3300012685 | Vadose Zone Soil | KEIAEARWFRRDEIQEMVARAAAGSDDPAKVSLPAPIAIAHHICRRWSSGLDSL* |
| Ga0137410_108070561 | 3300012944 | Vadose Zone Soil | RWFPRAEIREMVARAAAGTDDPAQAALPAPVAIAHHICRRWSSGLDSL* |
| Ga0126375_106933351 | 3300012948 | Tropical Forest Soil | EEIREMVKRAADGPDDPTQVSLPQPIAIAHQICRRWSHGLDSL* |
| Ga0164303_105987901 | 3300012957 | Soil | RAEIREMVARAAAGTEDPTQVSLPAPVAIAHHICRRWSSGLDSL* |
| Ga0126369_103990433 | 3300012971 | Tropical Forest Soil | ARWFARDEIREMVARAAAGVDDPARVSLPAPIAIAHHICRRWSSGLDSV* |
| Ga0126369_119778801 | 3300012971 | Tropical Forest Soil | RAATGPDDPTQVSVPAPIAIAHQICRRWSHGLDQV* |
| Ga0164307_103927593 | 3300012987 | Soil | RAMVARAASGPDDPTQVSLPGPVAIAHHICRRWSNGLDGL* |
| Ga0157307_11293272 | 3300013096 | Soil | ARAAAGPDDPTKVSLPSPIAIAHHICRRWSSGLDSV* |
| Ga0157371_108622232 | 3300013102 | Corn Rhizosphere | ARWFHRDEIREMVARAAAGADDPTRASLPAPVAIAHHICRRWSNGLDSL* |
| Ga0120111_11465782 | 3300013764 | Permafrost | LAEARWFEREELRAMVARAATGPDDPTQVSVPGPVAIAHQICRRWSYGLDAL* |
| Ga0120123_10279344 | 3300013770 | Permafrost | LGGPAATGPDDPTQVSVPGPVAIAHQICRRWSNGLDSL* |
| Ga0181531_107662431 | 3300014169 | Bog | IRDMVARAASGEDDPTQISLPQPLAIAHHLCRRWANGLDEI* |
| Ga0182024_115075191 | 3300014501 | Permafrost | EIRAMVARAASGPDDPTQVSIPPPLAIAHQICRRWSNGLDEI* |
| Ga0157377_111455311 | 3300014745 | Miscanthus Rhizosphere | RDEIRAMVERAATGPDDPTQVSLPGPVAIAHHLCRRWSHGLDDI* |
| Ga0137409_106609583 | 3300015245 | Vadose Zone Soil | AAAGVDDPTQLSLPQPLAIAHQICRRWSNRLDSI* |
| Ga0132257_1001654851 | 3300015373 | Arabidopsis Rhizosphere | REEIREMVARAAAGVDDPTRMSLPAPVAIAHHICRRWSNGLDSL* |
| Ga0182036_104272911 | 3300016270 | Soil | RWFARDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWGNGVDSV |
| Ga0182041_115840002 | 3300016294 | Soil | VTCEANGTDDPTKVSLPQPLAIAYHICRRWSNRLDDI |
| Ga0182035_119222861 | 3300016341 | Soil | PEELVEARWFERDEIRDMVARAAAGDPDPATQVPSLPGPVAIAHQICRRWATGIDRV |
| Ga0134112_1000076317 | 3300017656 | Grasslands Soil | EMVARAAAGTDDQGQASLPAPIAIAHHICRRWSNGLDSL |
| Ga0134083_100229055 | 3300017659 | Grasslands Soil | EARWFSRADIREMVARAATGPDDPAQVSLPSPIAIAHHICRRWSSGLDSV |
| Ga0134083_100876333 | 3300017659 | Grasslands Soil | EARWFSRDEIREMVARAAAGSDDPAQVSLPAPIAIAHHICRRWSSGLDSL |
| Ga0187817_105856852 | 3300017955 | Freshwater Sediment | VARAASGEDDPSKISLPQPLAIAHHLCRRWSNRLDEI |
| Ga0187783_108530302 | 3300017970 | Tropical Peatland | DEIRAMVERAASGPDDPTQLSVPGPVAIAHHLCRRWSFGLDDL |
| Ga0187810_103087222 | 3300018012 | Freshwater Sediment | MVARAATGPDDPTQVSVPGPVAIAHQICRRWSYGLDSL |
| Ga0184605_100154614 | 3300018027 | Groundwater Sediment | MVARAATGPDDPTMVLLPAPIAIAHHICRRWSSGLERV |
| Ga0187787_103662352 | 3300018029 | Tropical Peatland | VRAAAGIDDPTKVSLPAPVAIAHHICRRWSNGLDSL |
| Ga0184634_102721811 | 3300018031 | Groundwater Sediment | EMVARAAAGSDDPAQVSLPSPIAIAHHICRRWSSGLDSV |
| Ga0184621_101279782 | 3300018054 | Groundwater Sediment | MVARAATGPDEPTMVLLPARIAIAHHICRRWSSGLDRV |
| Ga0184619_100800771 | 3300018061 | Groundwater Sediment | MVARAATGPDEPTMVLLPAPIAIAHHICRRWSSGLERV |
| Ga0187774_113794562 | 3300018089 | Tropical Peatland | EELAEARWFARDEVREMVARAAAGLDDPTKVSLPAPVAIAHHVCRRWSNGLDSL |
| Ga0066662_120268031 | 3300018468 | Grasslands Soil | EARWFHRDEIRAMVARAASGPDDPTQVSVPGPIAIAHHICRRWSNGLDSL |
| Ga0193751_10791831 | 3300019888 | Soil | WFEREEIRAMVERAATGPDDPTQVSVPGPVAIAHQICRRWSNRLDSI |
| Ga0193738_11472491 | 3300020020 | Soil | EELAEARWFEREEIRAMVERAATGPDDPTQVSVPGPVAIAHQICRRWSNRLDDL |
| Ga0179594_100999281 | 3300020170 | Vadose Zone Soil | REMVARAAAGTDDPTRASLPAPVAIAHHICRRWSSGLDSV |
| Ga0179594_101138531 | 3300020170 | Vadose Zone Soil | AEARWFSRDEIREMVARAAAGPDDPTKVSLPSPIAIAHHICRRWSSGLDSV |
| Ga0179592_103125802 | 3300020199 | Vadose Zone Soil | AMVARAASGPDDPTQLSLPGPVAIAHHICRRWSNRLDSL |
| Ga0210399_101459291 | 3300020581 | Soil | EARWFHRDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWATGLDSV |
| Ga0206224_10384091 | 3300021051 | Deep Subsurface Sediment | WFSRDEVREMVARAAAGADDPPRPSLPAPIAIAHHICRRWSSGLDDLTGTRR |
| Ga0210384_104507942 | 3300021432 | Soil | EELVEARWFDRDEVRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWAHGLDSV |
| Ga0182009_102410331 | 3300021445 | Soil | AMVARAASGPDDPTQVSLPGPVAIAHHICRRWSNGLDGL |
| Ga0126371_102884514 | 3300021560 | Tropical Forest Soil | AASGPDDATQVSVPGPVAIAHHICRRWSNGLDTLATP |
| Ga0126371_102949393 | 3300021560 | Tropical Forest Soil | DPEELVEARWFERHEIRDMVARSAAGDPDPATTVPSLPGPVAIAHQICRRWANGIDSL |
| Ga0222622_111024512 | 3300022756 | Groundwater Sediment | MVARAATGPDDPTMVLLPARIAIAHHICRRWSSGLDRV |
| Ga0247660_10484042 | 3300024317 | Soil | EARWFEREEIRAMVARAATGPDDPTQVSVPGPVAIAHQICRRWSNRLDSL |
| Ga0207693_105018591 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RWFERDEIRAMVARAATGPDDPTQVSVPGPIAIAHQICRRWSYGLDSL |
| Ga0207700_103068311 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RDEIRAMVARAASGPDDPTQLSLPGPVAIAHHICRRWSNGLDSL |
| Ga0207679_120442541 | 3300025945 | Corn Rhizosphere | MVERAASGPDDPTQLSIPGPVAIAHHLCRRWSFGLDDI |
| Ga0207667_118027501 | 3300025949 | Corn Rhizosphere | SRDEIREMVARAAAGPDDPTKVSLPSPIAIAHHICRRWSSGLDSV |
| Ga0207651_109054291 | 3300025960 | Switchgrass Rhizosphere | EMREMVARAATGPDDPTKVSLPAPIAIAHHICRRWATGLDDI |
| Ga0207651_112136881 | 3300025960 | Switchgrass Rhizosphere | AMVDRAATGPDDPTQLSIPGRVAIAHHLCRRWSFGLDSI |
| Ga0207648_106472772 | 3300026089 | Miscanthus Rhizosphere | EMVARAATGPDDPTKVSLPAPIAIAHHICRRWATGLDDI |
| Ga0209237_12016731 | 3300026297 | Grasslands Soil | DEIREMAARAAAGSDDPAQVSLPSPIAIAHHICRRWSSGLDSV |
| Ga0209802_100427511 | 3300026328 | Soil | DEIREMVARAASGADDPSRVSLPAPIAIAHHICRRWSNGLDRL |
| Ga0209267_11020961 | 3300026331 | Soil | REMVARAATGPDDPAQVSLPSPIAIAHHICRRWSSGLDSV |
| Ga0209159_11822582 | 3300026343 | Soil | EELAEARWFHRDEIRAMVVHAANGLDDPTQVSVPGPVAIAHHICRRWSNGLDSL |
| Ga0257166_10473142 | 3300026358 | Soil | IREMAARAAAGFDDPAQVSLPSPIAIAHHICRRWSSGLDSV |
| Ga0209845_10258521 | 3300027324 | Groundwater Sand | EMAARAASGSDDPAQVSLPSPIAIAHHICRRWSSGLDSV |
| Ga0209213_10317691 | 3300027383 | Forest Soil | RAAAGSDDPATASLPAPIAIAHHICRRWSSGLDSV |
| Ga0209684_10418392 | 3300027527 | Tropical Forest Soil | MVARAAAGTDDPDRASLPAPIAIAHHICRRWSNGLDSL |
| Ga0209819_103526911 | 3300027722 | Freshwater Sediment | FSRDEVREMVARAAAGADDPAQVSLPAPIAIAHHICRRWSSGLDSL |
| Ga0209579_106315241 | 3300027869 | Surface Soil | IREMVARAASGEDDPSKVSIPQPLAIAHHICRRWSNRLDDI |
| Ga0209590_108478062 | 3300027882 | Vadose Zone Soil | LAEARWFSRQEIRDMVARAATGADDPAQVSLPAPIAIAHHICRRWSSGLDSL |
| Ga0209488_104674253 | 3300027903 | Vadose Zone Soil | VDPEELAEARWFEREEIRAMVARAATGPDDLTQVSVPGPVAIAHQICRRWSYGLDSL |
| Ga0209415_106563042 | 3300027905 | Peatlands Soil | AMVARAASGEDDPTQISLPQPLAIAHHICRRWSNRLDEI |
| Ga0307313_101890032 | 3300028715 | Soil | MVARAATGPDDPTMLLPAPFAIAHHICRRWSSGLDRV |
| Ga0307305_101556872 | 3300028807 | Soil | MVARAATGPDDPTMVLLPARIAIAHHICRRWSSGLDSV |
| Ga0247825_107631082 | 3300028812 | Soil | WFSRDEVREMVARAVTGPDDPTQVSLPSPIAIAHHICRRWSSRQDDLT |
| Ga0307296_103438961 | 3300028819 | Soil | AEARWFSRDEIREMVARAAAGPDDPAQVSLPSPIAIAHHICRRWSSGLDSV |
| Ga0302177_105788941 | 3300030053 | Palsa | EELAEARWFERAEIGEMVERAATGEDDPSKISLPQPLAIAHHLCRRWSNGLDEI |
| Ga0318516_100025009 | 3300031543 | Soil | ARAAAGTDHPERASLPAPIAIAHHICRRWSNGLDSL |
| Ga0318516_101823151 | 3300031543 | Soil | RWFSRQEIRDMVARAANGDPDPATTVPSLPGPVAIAHQICRRWANGFDDI |
| Ga0318555_100645172 | 3300031640 | Soil | RWFTRDEILDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWANGFDSV |
| Ga0318561_100029751 | 3300031679 | Soil | DAITVDPEELVEARWFDRDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWANGVDSL |
| Ga0318572_104510191 | 3300031681 | Soil | EELVEARWFARDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWANGVDSV |
| Ga0318560_104761112 | 3300031682 | Soil | LVEARWFARHEIRDMVARAAVGDPDPATTVPSLPGPVAIAHQICRRWANGVDSV |
| Ga0318496_100950221 | 3300031713 | Soil | PEELVEARWFSREEIRDMVGRAANGDPDPATTVPSLPGPVAIAHQICRRWANGFDNV |
| Ga0307469_110260771 | 3300031720 | Hardwood Forest Soil | VARAAAGTDDPTRASLPAPVAIAHHICRRWSNGLDSL |
| Ga0307469_116411881 | 3300031720 | Hardwood Forest Soil | WFSRGEIGEMVSRAAAGPDDPARVSLPPPLAIAHQICRRWSSGLDHL |
| Ga0307468_1001020391 | 3300031740 | Hardwood Forest Soil | MVARAAAGADDPTRASLPAPVAIAHHICRRWSNGLDSL |
| Ga0307468_1020745392 | 3300031740 | Hardwood Forest Soil | DEIRAMVARAASGPDDPTLLSLPGPVAIAHHICRRWSNELDSL |
| Ga0318502_105344822 | 3300031747 | Soil | RWFACDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWANGVDSV |
| Ga0318537_102994461 | 3300031763 | Soil | FSREEIRDMVARAANGDPDPATTVPSLPGPVAIAHQICRRWANGFDNV |
| Ga0318509_103159482 | 3300031768 | Soil | FPRAEIREMAARAAAGTDHPERASLPAPIAIAHHICRRWSNGLDSL |
| Ga0318498_101205552 | 3300031778 | Soil | FARDEIRGMVARAAHGDPDPATTVPSLPGPVAIAHQICRRWANGLDNV |
| Ga0318550_102205232 | 3300031797 | Soil | LAEARWFTRDEIREMVARAAAGVDDPARASLPAPVAIAHHICRRWSNGLDSL |
| Ga0310907_103099132 | 3300031847 | Soil | REMVARAAAGPDDPTKVSLPSPIAIAHHICRRWSSGLDSV |
| Ga0306925_100243481 | 3300031890 | Soil | TVDPEELVEARWFARDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWGNGVDSV |
| Ga0306925_118434291 | 3300031890 | Soil | TVDPEELVEARWFDRDEIRDMVARAATGDPDPATTVPSLPGPVAIAHQICRRWANGLDNV |
| Ga0318536_103282291 | 3300031893 | Soil | VEARWFSREEIRDMVGRAANGDPDPATTVPSLPGPVAIAHQICRRWANGFDNV |
| Ga0318551_100553772 | 3300031896 | Soil | ARWFTRDEILDMVARAAASDPDPATTVPSLPGPVAIAHQICRRWANGFDSV |
| Ga0318551_103457532 | 3300031896 | Soil | VARAAAGVDDPARASLPAPVAIAHHICRRWSNGLDSL |
| Ga0318520_101742792 | 3300031897 | Soil | VEARWFTRDEILDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWANGFDSV |
| Ga0310912_107277332 | 3300031941 | Soil | LAEARWFHRDEIREMAARAAAGTDHPERASLPAPIAIAHHICRRWSNGLDSL |
| Ga0310916_115745951 | 3300031942 | Soil | DPEELVEARWFSREEIRDMVGRAANGDPDPATTVPSLPGPVAIAHQICRRWANGFDNV |
| Ga0310910_107435272 | 3300031946 | Soil | LVEARWFSREEIRDMVGRAANGDPDPATTEPSLPGPVAIAHQICRRWANGFDNV |
| Ga0306926_126799472 | 3300031954 | Soil | EELVEARWFARDEIRDMVARSALGDPDPATTVPSLPGPVAIAHQICRRWANGVDNV |
| Ga0307479_104980912 | 3300031962 | Hardwood Forest Soil | VEARWFARDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWANGVDSV |
| Ga0318531_105080591 | 3300031981 | Soil | ARWFHRDEIREMVTRAANGTDDPTKVSLPQPLAIAHHICRRWSNRLDDI |
| Ga0306922_101756911 | 3300032001 | Soil | WFSRQEIRDMVARAANGDPDPATTVPSLPGPVAIAHQICRRWANGFDDI |
| Ga0318562_108717491 | 3300032008 | Soil | EARWFHRDEIREMAARAAAGTDHPERASLPAPIAIAHHICRRWSNGLDSL |
| Ga0318507_102452242 | 3300032025 | Soil | TVDTEELVEARWFERDEIREMVARAAAGDPDPATQVPSLPGPVAIAHQICRRWATGIDRV |
| Ga0310911_105103122 | 3300032035 | Soil | ITVDPEELVEARWFARDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWANRLDN |
| Ga0318510_105317472 | 3300032064 | Soil | AEARWFHRDEIREMAARAAAGTDHPERASLPAPIAIAHHICRRWSNGLDSL |
| Ga0318514_100616521 | 3300032066 | Soil | DPEELVEARWFSRDEIRDMVARSASGDPDPATTVPSLPGPVAIAHQICRRWANGFDNV |
| Ga0318524_103651602 | 3300032067 | Soil | ITVDPEELVEARWFSREEIRDMVARSASGDPDPATTVPSLPGPVAIAHQICRRWANGFDN |
| Ga0318577_100612712 | 3300032091 | Soil | ITVDPEELVEARWFARDEIRGMVARAAHGDPDPATTVPSLPGPVAIAHQICRRWANGLDN |
| Ga0318577_106495192 | 3300032091 | Soil | REMVARAAAGPDDPSRVSLPAPIAIAHHICRRWSSGQAIQ |
| Ga0318540_100119761 | 3300032094 | Soil | FARDEIRDMVARAAAGDPDPATTVPSLPGPVAIAHQICRRWGNGVDSV |
| Ga0307471_1029955752 | 3300032180 | Hardwood Forest Soil | EMVARAAAGPDDPTRVSLPAPVAIAHQICRRWSSGLDHL |
| Ga0307471_1039271111 | 3300032180 | Hardwood Forest Soil | LAEARWFHRDAIREMVTRAAAGPDDPAQVSLPAPLAIAHQICRRWSTGLDGV |
| Ga0306920_1001655354 | 3300032261 | Soil | VDPEELVEARWFARDEIRDMVARSALGDPDPATTVPSLPGPVAIAHQICRRWANGVDSV |
| Ga0306920_1009622453 | 3300032261 | Soil | EIREMVARAAAGVDDPARASLPAPVAIAHHICRRWSNGLDSL |
| Ga0335085_106743131 | 3300032770 | Soil | WFERAEIREMVARAAAGEDDPERVSIPQPLAIAHHLCRRWSNGLDEI |
| Ga0335071_105977112 | 3300032897 | Soil | HRDEIREMVARAATGPDDPSQVSIPPPLAIAHQICRRWSNRLDDI |
| Ga0335076_106670342 | 3300032955 | Soil | LAEARWFEREEIREMVARAASGEDDPSKICLPQPLAIAHHLCRRWSNRLDEI |
| Ga0310914_103446861 | 3300033289 | Soil | EARWFSRQEIRDMVARAANGDPDPATTVPSLPGPVAIAHQICRRWANGFDDI |
| Ga0318519_103084551 | 3300033290 | Soil | VEARWFERDEIRDMVARAAVGDPDPATQVPSLPGPVAIAHQICRRWATGIDSV |
| Ga0318519_105982102 | 3300033290 | Soil | DPEELVEARWFARAEIRGMVARAAHGDPDPATTVPSLPGPVAIAHQICRRWANGLDNV |
| Ga0364943_0176086_643_777 | 3300034354 | Sediment | RDEIREMVARAAAGADDPTRASLPAPVAIAHHICRRWSNGLDSL |
| Ga0373958_0111514_33_149 | 3300034819 | Rhizosphere Soil | MVARAAAGVDDASQASLPAPIAIAHHICRRWSSGLDSL |
| ⦗Top⦘ |