


| Basic Information | |
|---|---|
| Family ID | F018020 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 237 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VSETLGEGTTEKVSMILSGYSSLILEIRRVPIPDPVPPPREWVI |
| Number of Associated Samples | 201 |
| Number of Associated Scaffolds | 237 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 22.46 % |
| % of genes near scaffold ends (potentially truncated) | 75.53 % |
| % of genes from short scaffolds (< 2000 bps) | 94.09 % |
| Associated GOLD sequencing projects | 192 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (86.498 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (14.346 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.958 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (40.928 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.56% β-sheet: 0.00% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 237 Family Scaffolds |
|---|---|---|
| PF00091 | Tubulin | 36.29 |
| PF03953 | Tubulin_C | 9.70 |
| PF12796 | Ank_2 | 0.84 |
| PF13242 | Hydrolase_like | 0.42 |
| PF13499 | EF-hand_7 | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.76 % |
| Unclassified | root | N/A | 12.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000234|TB_GS09_5DRAFT_10004762 | All Organisms → cellular organisms → Eukaryota | 13119 | Open in IMG/M |
| 3300000736|JGI12547J11936_1023596 | All Organisms → cellular organisms → Eukaryota | 1441 | Open in IMG/M |
| 3300001818|ACM19_100433 | All Organisms → cellular organisms → Eukaryota | 618 | Open in IMG/M |
| 3300003754|Ga0005853_1001629 | All Organisms → Viruses → Predicted Viral | 1381 | Open in IMG/M |
| 3300003860|Ga0031658_1061618 | All Organisms → cellular organisms → Eukaryota | 655 | Open in IMG/M |
| 3300003874|Ga0062457_1034209 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | 597 | Open in IMG/M |
| 3300004598|Ga0068975_1212113 | All Organisms → cellular organisms → Eukaryota | 511 | Open in IMG/M |
| 3300004764|Ga0007754_1465090 | All Organisms → cellular organisms → Eukaryota | 515 | Open in IMG/M |
| 3300004769|Ga0007748_10097575 | Not Available | 509 | Open in IMG/M |
| 3300004788|Ga0007742_11039580 | All Organisms → cellular organisms → Eukaryota | 531 | Open in IMG/M |
| 3300004788|Ga0007742_11135722 | All Organisms → cellular organisms → Eukaryota | 682 | Open in IMG/M |
| 3300004790|Ga0007758_11386664 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | 526 | Open in IMG/M |
| 3300004793|Ga0007760_10093955 | All Organisms → cellular organisms → Eukaryota | 528 | Open in IMG/M |
| 3300004793|Ga0007760_11261939 | Not Available | 507 | Open in IMG/M |
| 3300004836|Ga0007759_10210441 | Not Available | 704 | Open in IMG/M |
| 3300005986|Ga0075152_10063662 | All Organisms → cellular organisms → Eukaryota | 2182 | Open in IMG/M |
| 3300006117|Ga0007818_1070354 | All Organisms → cellular organisms → Eukaryota | 649 | Open in IMG/M |
| 3300006229|Ga0082389_123812 | All Organisms → cellular organisms → Eukaryota | 685 | Open in IMG/M |
| 3300006356|Ga0075487_1509163 | All Organisms → cellular organisms → Eukaryota | 557 | Open in IMG/M |
| 3300006392|Ga0075507_1533282 | Not Available | 653 | Open in IMG/M |
| 3300006396|Ga0075493_1017344 | Not Available | 893 | Open in IMG/M |
| 3300006400|Ga0075503_1696899 | All Organisms → cellular organisms → Eukaryota | 719 | Open in IMG/M |
| 3300006402|Ga0075511_1772425 | All Organisms → cellular organisms → Eukaryota | 561 | Open in IMG/M |
| 3300006948|Ga0099826_10066155 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium barbadense | 2320 | Open in IMG/M |
| 3300007244|Ga0075167_10965450 | All Organisms → cellular organisms → Eukaryota | 1286 | Open in IMG/M |
| 3300007323|Ga0099768_1331651 | All Organisms → cellular organisms → Eukaryota | 1451 | Open in IMG/M |
| 3300007513|Ga0105019_1192583 | Not Available | 1016 | Open in IMG/M |
| 3300007516|Ga0105050_10031799 | All Organisms → cellular organisms → Eukaryota | 4254 | Open in IMG/M |
| 3300007516|Ga0105050_10078154 | All Organisms → cellular organisms → Eukaryota | 2250 | Open in IMG/M |
| 3300007520|Ga0105054_10147236 | All Organisms → cellular organisms → Eukaryota | 2347 | Open in IMG/M |
| 3300007548|Ga0102877_1158279 | All Organisms → cellular organisms → Eukaryota | 640 | Open in IMG/M |
| 3300007629|Ga0102895_1174291 | All Organisms → cellular organisms → Eukaryota | 559 | Open in IMG/M |
| 3300007722|Ga0105051_10086239 | All Organisms → cellular organisms → Eukaryota | 2471 | Open in IMG/M |
| 3300008105|Ga0114338_1000399 | All Organisms → cellular organisms → Eukaryota | 48477 | Open in IMG/M |
| 3300008105|Ga0114338_1006160 | All Organisms → cellular organisms → Eukaryota | 14295 | Open in IMG/M |
| 3300008796|Ga0103763_1026268 | All Organisms → cellular organisms → Eukaryota | 548 | Open in IMG/M |
| 3300008966|Ga0114357_1044484 | All Organisms → cellular organisms → Eukaryota | 2500 | Open in IMG/M |
| 3300009083|Ga0105047_10873690 | All Organisms → cellular organisms → Eukaryota | 751 | Open in IMG/M |
| 3300009155|Ga0114968_10589900 | All Organisms → cellular organisms → Eukaryota | 589 | Open in IMG/M |
| 3300009155|Ga0114968_10726474 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
| 3300009196|Ga0103745_10053295 | All Organisms → cellular organisms → Eukaryota | 583 | Open in IMG/M |
| 3300009225|Ga0103851_1108618 | All Organisms → cellular organisms → Eukaryota | 509 | Open in IMG/M |
| 3300009338|Ga0103826_114439 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009346|Ga0103839_1004531 | All Organisms → cellular organisms → Eukaryota | 803 | Open in IMG/M |
| 3300009411|Ga0115017_1020856 | Not Available | 684 | Open in IMG/M |
| 3300009432|Ga0115005_10650376 | All Organisms → cellular organisms → Eukaryota | 845 | Open in IMG/M |
| 3300009436|Ga0115008_10161721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio vulnificus | 1623 | Open in IMG/M |
| 3300009441|Ga0115007_10424026 | All Organisms → cellular organisms → Eukaryota | 872 | Open in IMG/M |
| 3300009455|Ga0114939_10567882 | All Organisms → cellular organisms → Eukaryota | 501 | Open in IMG/M |
| 3300009543|Ga0115099_10319575 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 553 | Open in IMG/M |
| 3300009544|Ga0115006_10196979 | All Organisms → cellular organisms → Eukaryota | 1783 | Open in IMG/M |
| 3300009550|Ga0115013_11173531 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 557 | Open in IMG/M |
| 3300009599|Ga0115103_1360613 | All Organisms → cellular organisms → Eukaryota → Sar | 529 | Open in IMG/M |
| 3300009599|Ga0115103_1612801 | All Organisms → cellular organisms → Eukaryota | 527 | Open in IMG/M |
| 3300009599|Ga0115103_1749283 | All Organisms → cellular organisms → Eukaryota | 1320 | Open in IMG/M |
| 3300009606|Ga0115102_10481631 | All Organisms → cellular organisms → Eukaryota | 617 | Open in IMG/M |
| 3300009606|Ga0115102_10853793 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
| 3300009677|Ga0115104_10275826 | All Organisms → cellular organisms → Eukaryota | 531 | Open in IMG/M |
| 3300009677|Ga0115104_10626039 | All Organisms → cellular organisms → Eukaryota | 542 | Open in IMG/M |
| 3300009679|Ga0115105_10538315 | All Organisms → cellular organisms → Eukaryota | 531 | Open in IMG/M |
| 3300009679|Ga0115105_11434943 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 524 | Open in IMG/M |
| 3300009709|Ga0116227_11379522 | Not Available | 529 | Open in IMG/M |
| 3300009709|Ga0116227_11384490 | Not Available | 528 | Open in IMG/M |
| 3300009739|Ga0123362_1119603 | All Organisms → cellular organisms → Eukaryota | 516 | Open in IMG/M |
| 3300009787|Ga0116226_10284706 | Not Available | 1705 | Open in IMG/M |
| 3300009787|Ga0116226_10771044 | All Organisms → cellular organisms → Eukaryota | 946 | Open in IMG/M |
| 3300009787|Ga0116226_11467507 | Not Available | 635 | Open in IMG/M |
| 3300009787|Ga0116226_11923078 | All Organisms → cellular organisms → Eukaryota | 537 | Open in IMG/M |
| 3300010157|Ga0114964_10455794 | All Organisms → cellular organisms → Eukaryota | 602 | Open in IMG/M |
| 3300010305|Ga0129320_153094 | All Organisms → cellular organisms → Eukaryota | 508 | Open in IMG/M |
| 3300010315|Ga0136654_1215344 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 886 | Open in IMG/M |
| 3300010981|Ga0138316_10183488 | All Organisms → cellular organisms → Eukaryota | 563 | Open in IMG/M |
| 3300010985|Ga0138326_11299243 | All Organisms → cellular organisms → Eukaryota | 551 | Open in IMG/M |
| 3300010987|Ga0138324_10588711 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 556 | Open in IMG/M |
| 3300010987|Ga0138324_10617805 | All Organisms → cellular organisms → Eukaryota | 543 | Open in IMG/M |
| 3300010987|Ga0138324_10648795 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 530 | Open in IMG/M |
| 3300011009|Ga0129318_10229049 | Not Available | 605 | Open in IMG/M |
| 3300011120|Ga0150983_15013200 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | 545 | Open in IMG/M |
| 3300011295|Ga0138389_1096513 | All Organisms → cellular organisms → Eukaryota | 558 | Open in IMG/M |
| 3300011381|Ga0102688_1125769 | All Organisms → cellular organisms → Eukaryota | 531 | Open in IMG/M |
| 3300012212|Ga0150985_102109676 | All Organisms → cellular organisms → Eukaryota | 564 | Open in IMG/M |
| 3300012212|Ga0150985_105476091 | All Organisms → cellular organisms → Eukaryota | 972 | Open in IMG/M |
| 3300012212|Ga0150985_118358619 | All Organisms → cellular organisms → Eukaryota | 625 | Open in IMG/M |
| 3300012413|Ga0138258_1166032 | Not Available | 532 | Open in IMG/M |
| 3300012419|Ga0138260_10512345 | All Organisms → cellular organisms → Eukaryota | 586 | Open in IMG/M |
| 3300012470|Ga0129329_1025019 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 536 | Open in IMG/M |
| 3300012524|Ga0129331_1298207 | All Organisms → cellular organisms → Eukaryota | 544 | Open in IMG/M |
| 3300012709|Ga0157608_1084741 | All Organisms → cellular organisms → Eukaryota | 536 | Open in IMG/M |
| 3300012711|Ga0157607_1220932 | All Organisms → cellular organisms → Eukaryota | 547 | Open in IMG/M |
| 3300012715|Ga0157599_1252641 | All Organisms → cellular organisms → Eukaryota | 515 | Open in IMG/M |
| 3300012716|Ga0157605_1194744 | All Organisms → cellular organisms → Eukaryota | 515 | Open in IMG/M |
| 3300012722|Ga0157630_1284164 | All Organisms → cellular organisms → Eukaryota | 1036 | Open in IMG/M |
| 3300012728|Ga0157552_1220462 | All Organisms → cellular organisms → Eukaryota | 512 | Open in IMG/M |
| 3300012733|Ga0157606_1113785 | All Organisms → cellular organisms → Eukaryota | 569 | Open in IMG/M |
| 3300012734|Ga0157615_1387870 | All Organisms → cellular organisms → Eukaryota | 549 | Open in IMG/M |
| 3300012745|Ga0157532_180050 | All Organisms → cellular organisms → Eukaryota | 567 | Open in IMG/M |
| 3300012756|Ga0138272_1058893 | All Organisms → cellular organisms → Eukaryota | 513 | Open in IMG/M |
| 3300012763|Ga0138289_1007120 | All Organisms → cellular organisms → Eukaryota | 501 | Open in IMG/M |
| 3300012763|Ga0138289_1080550 | All Organisms → cellular organisms → Eukaryota | 613 | Open in IMG/M |
| 3300012768|Ga0138276_1084093 | All Organisms → cellular organisms → Eukaryota | 531 | Open in IMG/M |
| 3300012772|Ga0138287_1253525 | All Organisms → cellular organisms → Eukaryota | 549 | Open in IMG/M |
| 3300012935|Ga0138257_1679804 | All Organisms → cellular organisms → Eukaryota | 546 | Open in IMG/M |
| 3300012962|Ga0129335_1099495 | All Organisms → cellular organisms → Eukaryota | 674 | Open in IMG/M |
| 3300013006|Ga0164294_10763034 | All Organisms → cellular organisms → Eukaryota | 652 | Open in IMG/M |
| 3300013006|Ga0164294_11071167 | All Organisms → cellular organisms → Eukaryota | 541 | Open in IMG/M |
| 3300013295|Ga0170791_11293389 | All Organisms → cellular organisms → Eukaryota | 524 | Open in IMG/M |
| 3300013310|Ga0157622_1238051 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
| 3300015304|Ga0182112_1026818 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 753 | Open in IMG/M |
| 3300016736|Ga0182049_1166233 | All Organisms → cellular organisms → Eukaryota | 966 | Open in IMG/M |
| 3300018628|Ga0193355_1028335 | All Organisms → cellular organisms → Eukaryota | 535 | Open in IMG/M |
| 3300018632|Ga0188873_1015132 | All Organisms → cellular organisms → Eukaryota | 611 | Open in IMG/M |
| 3300018662|Ga0192848_1008118 | All Organisms → cellular organisms → Eukaryota | 1091 | Open in IMG/M |
| 3300018696|Ga0193110_1019784 | All Organisms → cellular organisms → Eukaryota | 726 | Open in IMG/M |
| 3300018744|Ga0193247_1058897 | All Organisms → cellular organisms → Eukaryota | 806 | Open in IMG/M |
| 3300018843|Ga0188883_10018272 | All Organisms → cellular organisms → Eukaryota | 552 | Open in IMG/M |
| 3300018883|Ga0193276_1122556 | Not Available | 521 | Open in IMG/M |
| 3300018912|Ga0193176_10145770 | All Organisms → cellular organisms → Eukaryota | 659 | Open in IMG/M |
| 3300018982|Ga0192947_10244203 | All Organisms → cellular organisms → Eukaryota | 578 | Open in IMG/M |
| 3300019022|Ga0192951_10027914 | All Organisms → cellular organisms → Eukaryota | 1382 | Open in IMG/M |
| 3300019043|Ga0192998_10126074 | All Organisms → cellular organisms → Eukaryota | 706 | Open in IMG/M |
| 3300019045|Ga0193336_10461694 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 604 | Open in IMG/M |
| 3300019054|Ga0192992_10018905 | All Organisms → cellular organisms → Eukaryota | 1384 | Open in IMG/M |
| 3300019118|Ga0193157_1009167 | All Organisms → cellular organisms → Eukaryota | 917 | Open in IMG/M |
| 3300019270|Ga0181512_1538387 | All Organisms → cellular organisms → Eukaryota | 1039 | Open in IMG/M |
| 3300019272|Ga0182059_1177962 | All Organisms → cellular organisms → Eukaryota | 527 | Open in IMG/M |
| 3300020014|Ga0182044_1020249 | Not Available | 525 | Open in IMG/M |
| 3300020070|Ga0206356_11408395 | All Organisms → cellular organisms → Eukaryota | 535 | Open in IMG/M |
| 3300020076|Ga0206355_1006667 | Not Available | 570 | Open in IMG/M |
| 3300020205|Ga0211731_10641468 | All Organisms → cellular organisms → Eukaryota | 660 | Open in IMG/M |
| 3300021169|Ga0206687_1304884 | All Organisms → cellular organisms → Eukaryota | 526 | Open in IMG/M |
| 3300021169|Ga0206687_1353429 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
| 3300021169|Ga0206687_1557055 | All Organisms → cellular organisms → Eukaryota | 538 | Open in IMG/M |
| 3300021273|Ga0210340_1099147 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | 674 | Open in IMG/M |
| 3300021291|Ga0206694_1131276 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Scuticociliatia → Philasterida → Philasteridae → Miamiensis → Miamiensis avidus | 525 | Open in IMG/M |
| 3300021296|Ga0210300_133450 | All Organisms → cellular organisms → Eukaryota | 548 | Open in IMG/M |
| 3300021299|Ga0210302_1002823 | All Organisms → cellular organisms → Eukaryota | 560 | Open in IMG/M |
| 3300021334|Ga0206696_1406267 | All Organisms → cellular organisms → Eukaryota | 1167 | Open in IMG/M |
| 3300021342|Ga0206691_1332640 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Scuticociliatia → Philasterida → Philasteridae → Miamiensis → Miamiensis avidus | 554 | Open in IMG/M |
| 3300021342|Ga0206691_1415496 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 582 | Open in IMG/M |
| 3300021342|Ga0206691_1570100 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Scuticociliatia → Philasterida → Philasteridae → Miamiensis → Miamiensis avidus | 502 | Open in IMG/M |
| 3300021345|Ga0206688_10588506 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
| 3300021348|Ga0206695_1437790 | Not Available | 522 | Open in IMG/M |
| 3300021348|Ga0206695_1485162 | All Organisms → cellular organisms → Eukaryota | 601 | Open in IMG/M |
| 3300021353|Ga0206693_1603082 | All Organisms → cellular organisms → Eukaryota | 534 | Open in IMG/M |
| 3300021353|Ga0206693_1826654 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Piroplasmida → Babesiidae → Babesia → Babesia bigemina | 507 | Open in IMG/M |
| 3300021355|Ga0206690_10361412 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 542 | Open in IMG/M |
| 3300021355|Ga0206690_10844109 | All Organisms → cellular organisms → Eukaryota | 500 | Open in IMG/M |
| 3300021359|Ga0206689_10195022 | All Organisms → cellular organisms → Eukaryota | 535 | Open in IMG/M |
| 3300021359|Ga0206689_10749777 | All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Kinetoplastea → Metakinetoplastina → Trypanosomatida → Trypanosomatidae → Leishmaniinae → Leishmania → Leishmania → Leishmania donovani species complex → Leishmania infantum | 1166 | Open in IMG/M |
| 3300021359|Ga0206689_10896985 | All Organisms → cellular organisms → Eukaryota | 542 | Open in IMG/M |
| 3300021852|Ga0210317_1125985 | All Organisms → cellular organisms → Eukaryota | 777 | Open in IMG/M |
| 3300021856|Ga0213850_1114439 | All Organisms → cellular organisms → Eukaryota | 552 | Open in IMG/M |
| 3300021856|Ga0213850_1270767 | All Organisms → cellular organisms → Eukaryota | 1435 | Open in IMG/M |
| 3300021898|Ga0063097_1020513 | Not Available | 842 | Open in IMG/M |
| 3300021910|Ga0063100_1022674 | All Organisms → cellular organisms → Eukaryota | 523 | Open in IMG/M |
| 3300021925|Ga0063096_1031696 | All Organisms → cellular organisms → Eukaryota | 535 | Open in IMG/M |
| 3300021934|Ga0063139_1024353 | All Organisms → cellular organisms → Eukaryota | 1087 | Open in IMG/M |
| 3300021941|Ga0063102_1074708 | All Organisms → cellular organisms → Eukaryota | 515 | Open in IMG/M |
| 3300022154|Ga0213929_1024887 | All Organisms → cellular organisms → Eukaryota | 586 | Open in IMG/M |
| 3300022156|Ga0213934_1059218 | All Organisms → cellular organisms → Eukaryota | 540 | Open in IMG/M |
| 3300022528|Ga0242669_1121548 | All Organisms → cellular organisms → Eukaryota | 525 | Open in IMG/M |
| 3300024228|Ga0228633_1003651 | All Organisms → cellular organisms → Eukaryota | 4690 | Open in IMG/M |
| 3300024231|Ga0233399_1005249 | All Organisms → cellular organisms → Eukaryota | 4495 | Open in IMG/M |
| 3300024296|Ga0228629_1002927 | All Organisms → cellular organisms → Eukaryota | 4416 | Open in IMG/M |
| 3300024343|Ga0244777_10926479 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | 508 | Open in IMG/M |
| 3300024543|Ga0256348_1085049 | All Organisms → cellular organisms → Eukaryota | 536 | Open in IMG/M |
| 3300024545|Ga0256347_1077649 | All Organisms → cellular organisms → Eukaryota | 717 | Open in IMG/M |
| 3300024547|Ga0255292_1107659 | All Organisms → cellular organisms → Eukaryota | 547 | Open in IMG/M |
| 3300024848|Ga0255229_1012986 | All Organisms → cellular organisms → Eukaryota | 1340 | Open in IMG/M |
| 3300024865|Ga0256340_1153598 | All Organisms → cellular organisms → Eukaryota | 551 | Open in IMG/M |
| 3300025391|Ga0208740_1039245 | All Organisms → cellular organisms → Eukaryota | 672 | Open in IMG/M |
| 3300026468|Ga0247603_1115826 | All Organisms → cellular organisms → Eukaryota | 553 | Open in IMG/M |
| 3300026573|Ga0255269_1201076 | All Organisms → cellular organisms → Eukaryota | 530 | Open in IMG/M |
| 3300027347|Ga0209366_1120254 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1164 | Open in IMG/M |
| 3300027507|Ga0255582_1224968 | Not Available | 540 | Open in IMG/M |
| 3300027720|Ga0209617_10059006 | All Organisms → cellular organisms → Eukaryota | 1598 | Open in IMG/M |
| 3300027833|Ga0209092_10344132 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | 795 | Open in IMG/M |
| 3300027876|Ga0209974_10360231 | Not Available | 565 | Open in IMG/M |
| 3300027898|Ga0209067_10844360 | All Organisms → cellular organisms → Eukaryota | 536 | Open in IMG/M |
| 3300028233|Ga0256417_1210508 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
| 3300028330|Ga0247601_1062033 | All Organisms → cellular organisms → Eukaryota | 506 | Open in IMG/M |
| 3300028575|Ga0304731_10726748 | All Organisms → cellular organisms → Eukaryota | 563 | Open in IMG/M |
| 3300028575|Ga0304731_10967879 | All Organisms → cellular organisms → Eukaryota | 526 | Open in IMG/M |
| 3300028588|Ga0265780_10584483 | Not Available | 921 | Open in IMG/M |
| 3300028647|Ga0272412_1089585 | All Organisms → cellular organisms → Eukaryota | 1311 | Open in IMG/M |
| 3300029697|Ga0256301_1031239 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 901 | Open in IMG/M |
| 3300030529|Ga0210284_1339558 | All Organisms → cellular organisms → Eukaryota | 536 | Open in IMG/M |
| 3300030542|Ga0210249_1222124 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 840 | Open in IMG/M |
| 3300030548|Ga0210252_11138495 | All Organisms → cellular organisms → Eukaryota | 503 | Open in IMG/M |
| 3300030572|Ga0210258_10705004 | All Organisms → cellular organisms → Eukaryota | 569 | Open in IMG/M |
| 3300030610|Ga0247613_10455316 | All Organisms → cellular organisms → Eukaryota | 516 | Open in IMG/M |
| 3300030628|Ga0247629_10415431 | All Organisms → cellular organisms → Eukaryota | 516 | Open in IMG/M |
| 3300030632|Ga0210250_11260018 | All Organisms → cellular organisms → Eukaryota | 534 | Open in IMG/M |
| 3300030635|Ga0247627_10336422 | All Organisms → cellular organisms → Eukaryota | 515 | Open in IMG/M |
| 3300030722|Ga0308137_1102897 | All Organisms → cellular organisms → Eukaryota | 506 | Open in IMG/M |
| 3300030729|Ga0308131_1059470 | All Organisms → cellular organisms → Eukaryota | 792 | Open in IMG/M |
| 3300030738|Ga0265462_11677595 | All Organisms → cellular organisms → Eukaryota | 602 | Open in IMG/M |
| 3300030741|Ga0265459_10765376 | All Organisms → cellular organisms → Eukaryota | 949 | Open in IMG/M |
| 3300030741|Ga0265459_14111804 | All Organisms → cellular organisms → Eukaryota | 510 | Open in IMG/M |
| 3300030780|Ga0073988_12364766 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 514 | Open in IMG/M |
| 3300030788|Ga0073964_10029196 | All Organisms → cellular organisms → Eukaryota | 539 | Open in IMG/M |
| 3300030865|Ga0073972_11382414 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Scuticociliatia → Philasterida → Philasteridae → Miamiensis → Miamiensis avidus | 536 | Open in IMG/M |
| 3300030938|Ga0138299_10011790 | All Organisms → cellular organisms → Eukaryota | 539 | Open in IMG/M |
| 3300030962|Ga0138297_1034216 | Not Available | 508 | Open in IMG/M |
| 3300030971|Ga0075375_12116670 | All Organisms → cellular organisms → Eukaryota | 505 | Open in IMG/M |
| 3300031032|Ga0073980_10007431 | Not Available | 539 | Open in IMG/M |
| 3300031231|Ga0170824_109057375 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
| 3300031231|Ga0170824_128099803 | All Organisms → cellular organisms → Eukaryota | 529 | Open in IMG/M |
| 3300031411|Ga0102761_10111818 | All Organisms → cellular organisms → Eukaryota | 620 | Open in IMG/M |
| 3300031469|Ga0170819_11966610 | Not Available | 601 | Open in IMG/M |
| 3300031472|Ga0272437_1462725 | All Organisms → cellular organisms → Eukaryota | 504 | Open in IMG/M |
| 3300031474|Ga0170818_114217599 | All Organisms → cellular organisms → Eukaryota | 503 | Open in IMG/M |
| 3300031505|Ga0308150_1035593 | All Organisms → cellular organisms → Eukaryota | 571 | Open in IMG/M |
| 3300031557|Ga0308148_1040221 | All Organisms → cellular organisms → Eukaryota | 530 | Open in IMG/M |
| 3300031558|Ga0308147_1044526 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 561 | Open in IMG/M |
| 3300031707|Ga0315291_11138970 | All Organisms → cellular organisms → Eukaryota | 643 | Open in IMG/M |
| 3300031725|Ga0307381_10151392 | All Organisms → cellular organisms → Eukaryota | 794 | Open in IMG/M |
| 3300031737|Ga0307387_10939393 | All Organisms → cellular organisms → Eukaryota | 550 | Open in IMG/M |
| 3300031742|Ga0307395_10250807 | All Organisms → cellular organisms → Eukaryota | 759 | Open in IMG/M |
| 3300031758|Ga0315907_11062012 | All Organisms → cellular organisms → Eukaryota | 579 | Open in IMG/M |
| 3300031784|Ga0315899_11623973 | All Organisms → cellular organisms → Eukaryota | 535 | Open in IMG/M |
| 3300032145|Ga0315304_1114513 | Not Available | 711 | Open in IMG/M |
| 3300032145|Ga0315304_1188923 | All Organisms → cellular organisms → Eukaryota | 540 | Open in IMG/M |
| 3300032360|Ga0315334_11626248 | All Organisms → cellular organisms → Eukaryota | 551 | Open in IMG/M |
| 3300032462|Ga0335396_10113577 | All Organisms → cellular organisms → Eukaryota | 1785 | Open in IMG/M |
| 3300032518|Ga0314689_10390638 | All Organisms → cellular organisms → Eukaryota | 731 | Open in IMG/M |
| 3300032519|Ga0314676_10683521 | All Organisms → cellular organisms → Eukaryota | 600 | Open in IMG/M |
| 3300032708|Ga0314669_10730774 | All Organisms → cellular organisms → Eukaryota | 542 | Open in IMG/M |
| 3300032713|Ga0314690_10504794 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 598 | Open in IMG/M |
| 3300032756|Ga0315742_13154857 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
| 3300032756|Ga0315742_13311146 | All Organisms → cellular organisms → Eukaryota | 520 | Open in IMG/M |
| 3300033992|Ga0334992_0094870 | All Organisms → cellular organisms → Eukaryota | 1605 | Open in IMG/M |
| 3300034021|Ga0335004_0505735 | All Organisms → cellular organisms → Eukaryota | 659 | Open in IMG/M |
| 3300034068|Ga0334990_0445614 | Not Available | 694 | Open in IMG/M |
| 3300034068|Ga0334990_0475727 | Not Available | 668 | Open in IMG/M |
| 3300034357|Ga0335064_0384323 | Not Available | 897 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 14.35% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.70% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 7.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.64% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.38% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.95% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.53% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.53% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.53% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.69% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.27% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.27% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.27% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.27% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.27% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 1.27% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.84% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.42% |
| Sediment And Microbial Mat | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Sediment And Microbial Mat | 0.42% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.42% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.42% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.42% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.42% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.42% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.42% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.42% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.42% |
| Root Nodules | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules | 0.42% |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 0.42% |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont | 0.42% |
| Marine Gutless Worms | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms | 0.42% |
| Coral | Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral | 0.42% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.42% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.42% |
| Eutrophic Pond | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Eutrophic Pond | 0.42% |
| Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000234 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS09_5 | Environmental | Open in IMG/M |
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300001818 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM19, ROCA_DNA029_2.0um_3a | Environmental | Open in IMG/M |
| 3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300003874 | Isolated Sinkhole microbial communities from Lake Huron, MI - Assembly 2014 | Environmental | Open in IMG/M |
| 3300004598 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004764 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004788 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005986 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA | Engineered | Open in IMG/M |
| 3300006117 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 | Environmental | Open in IMG/M |
| 3300006229 | Marine sediment microbial communities, 0.9 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC143 | Environmental | Open in IMG/M |
| 3300006356 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006392 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006396 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Host-Associated | Open in IMG/M |
| 3300007244 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007323 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_C2_LD (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007513 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007520 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008105 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, sample E2014-0046-100-LTR | Environmental | Open in IMG/M |
| 3300008796 | Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample KO-1 | Environmental | Open in IMG/M |
| 3300008966 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-53-LTR | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009196 | Microbial communities of wastewater sludge from Singapore - Sludge1_b2_February | Environmental | Open in IMG/M |
| 3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
| 3300009338 | Microbial communities of water from the North Atlantic ocean - ACM29 | Environmental | Open in IMG/M |
| 3300009346 | Microbial communities of water from the North Atlantic ocean - ACM14 | Environmental | Open in IMG/M |
| 3300009411 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009739 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_194_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009757 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_205_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010305 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010315 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG | Host-Associated | Open in IMG/M |
| 3300010981 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4) | Environmental | Open in IMG/M |
| 3300010985 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8) | Environmental | Open in IMG/M |
| 3300010987 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6) | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011295 | Marine microbial communities from the Southern Atlantic ocean - KN S17 O2min_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012413 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012470 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012728 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012745 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES017 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012756 | Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012935 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012962 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300016736 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018628 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885) | Environmental | Open in IMG/M |
| 3300018632 | Metatranscriptome of marine microbial communities from Baltic Sea - GS848_ls3 | Environmental | Open in IMG/M |
| 3300018662 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878) | Environmental | Open in IMG/M |
| 3300018696 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000864 (ERX1782143-ERR1711870) | Environmental | Open in IMG/M |
| 3300018744 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001503 (ERX1789402-ERR1719489) | Environmental | Open in IMG/M |
| 3300018843 | Metatranscriptome of marine microbial communities from Baltic Sea - LD3200M_ls1 | Environmental | Open in IMG/M |
| 3300018883 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492) | Environmental | Open in IMG/M |
| 3300018912 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782195-ERR1712243) | Environmental | Open in IMG/M |
| 3300018982 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935) | Environmental | Open in IMG/M |
| 3300019022 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194) | Environmental | Open in IMG/M |
| 3300019043 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098) | Environmental | Open in IMG/M |
| 3300019045 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224) | Environmental | Open in IMG/M |
| 3300019054 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964) | Environmental | Open in IMG/M |
| 3300019118 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019272 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021273 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021291 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021296 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R881 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021299 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021334 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021348 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021353 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021355 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021852 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.23 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021856 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021898 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021910 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021925 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021934 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021941 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022154 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024543 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024545 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024547 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024848 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026468 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027347 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027507 | APAL treatment+control metatranscriptome co-assembly | Host-Associated | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028330 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 76R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028575 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028588 | Plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T30 | Environmental | Open in IMG/M |
| 3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030529 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030542 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR003SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030572 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030610 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030628 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030632 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030635 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030722 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030729 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1108_32.2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030780 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030788 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030865 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030938 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030962 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030971 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031032 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031411 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031472 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstone | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031505 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031557 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031558 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031725 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031737 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031742 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300032145 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_1000m_313 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032518 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032519 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032708 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032713 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_GS09_5DRAFT_100047627 | 3300000234 | Groundwater | VSETFGDGTTENVYIILSGYYSLIFEIKRVPIPDPVPPPKE* |
| JGI12547J11936_10235963 | 3300000736 | Freshwater And Sediment | VSETFGEGITEKVTIYLSGYSSLIFEISKVPIPDPVPPPRECVT* |
| ACM19_1004331 | 3300001818 | Marine Plankton | GDGNTEKVSMILSGYSSLILEIRRVPIPDPVPPPREWVI* |
| Ga0005853_10016292 | 3300003754 | Freshwater And Sediment | VSETLGEGTTEKVSMILSGYSSLTLEIKRVPIPDPVPPPREWVI* |
| Ga0031658_10616181 | 3300003860 | Freshwater Lake Sediment | GSTTVSDTFGEGMTEKVAIILSGYSSRIFEIKRVPIPEPVPPPREWVT* |
| Ga0062457_10342092 | 3300003874 | Sediment And Microbial Mat | DTLGDGKTEKVSMILSGYSSLTLEMRSVPIPDPVPPPIE* |
| Ga0068975_12121131 | 3300004598 | Peatlands Soil | GDGTTEKVHMILSGYSSLTLEISRVPIPDPVPPPSECVI* |
| Ga0007754_14650901 | 3300004764 | Freshwater Lake | ETFGDGTTEKVSMILSGYSSLTLEINKVPIPEPVPPPNEWVI* |
| Ga0007748_100975752 | 3300004769 | Freshwater Lake | VSETLGEGTTEKVSMILSGYSSLILEIRRVPIPDPVPPPREWVI* |
| Ga0007742_110395802 | 3300004788 | Freshwater Lake | VSETFGDGTTEKVSMILSGYSSLTLEINKVPIPEPVPPPNEWVI* |
| Ga0007742_111357222 | 3300004788 | Freshwater Lake | VSDTLGEGTTEKVSIILSGYSSLTLEIKSVPIPDPVPPPKEWVI* |
| Ga0007758_113866641 | 3300004790 | Freshwater Lake | TLGDGMTEKVAMILSGYSSRILEMRRVPMPEPVPPPREWVIWKP* |
| Ga0007760_100939551 | 3300004793 | Freshwater Lake | TFGDGTIEKVSIILSGYSSLTFEINKVPIPDPVPPPNEWVI* |
| Ga0007760_112619392 | 3300004793 | Freshwater Lake | VSETLGEGKTEKVSMILSWYSSLTLLMRRVPIPDPVPPPREWVIWN |
| Ga0007759_102104412 | 3300004836 | Freshwater Lake | VSDTLGDGMTENEAMILSGYSSRILEIKRVPIPEPVPPPREWVI* |
| Ga0075152_100636624 | 3300005986 | Wastewater Effluent | MVQPVSETFGEGTTEKVYIILSGYYYLTFEIKRVPIPDPVPPPSE* |
| Ga0007818_10703541 | 3300006117 | Freshwater | GDGMTEKVTICLSGYSSLIFEIRSVPIPDPVPPPSEWVT* |
| Ga0082389_1238121 | 3300006229 | Marine | VSDTLGDGTTENVSIILSGYSSLTFEINNVPIPDPVPPPKEWVI* |
| Ga0075487_15091631 | 3300006356 | Aqueous | VSETLGEGTTEKVVMILSGYSSLILEIKRVPIPDPVPPPREWVI* |
| Ga0075507_15332822 | 3300006392 | Aqueous | VSETFGDGTIEKVSIILSGYSSLTFEINKVPIPDPVPPPNE* |
| Ga0075493_10173441 | 3300006396 | Aqueous | VSETFGDGTIEKVSIILSGYSSLTFEINKVPIPDPVPPPNEWVI* |
| Ga0075503_16968992 | 3300006400 | Aqueous | MTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWV |
| Ga0075511_17724251 | 3300006402 | Aqueous | DTFGDGTIEKVSIILSGYSSLTFEINKVPIPDPVPPPNEWVI* |
| Ga0099826_100661551 | 3300006948 | Root Nodules | TLGEGKTEKVSIILSGYSSLIFEIKRVPIPDPVPPPSEWHT* |
| Ga0075167_109654503 | 3300007244 | Wastewater Effluent | VSETLGEGTTEKVYMILSGYYSLTFEIKRVPIPDPVPPPKE* |
| Ga0099768_13316513 | 3300007323 | Activated Sludge | VSETFGDGTIEKLSMILSGYSSLTFEINKVPIPDPVPPPNEWVI* |
| Ga0105019_11925831 | 3300007513 | Marine | VSDTFGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVTWKP* |
| Ga0105050_100317992 | 3300007516 | Freshwater | VSETFGDGTTEKVYMILSGYSSLIFEIRRVPIPDPVPPPNEWVNWKP* |
| Ga0105050_100781542 | 3300007516 | Freshwater | VSDTLGEGTTEKVSIILSGYSSLTLEMRRVPIPDPVPPPKEWVI* |
| Ga0105054_101472362 | 3300007520 | Freshwater | VSDTLGEGTTEKVSMILSGYSSLTLEMRRVPIPDPVPPPKEWVI* |
| Ga0102877_11582792 | 3300007548 | Estuarine | GDGMTEKVAMILSGYSSLILEMRSVPIPDPVPPPREWVI* |
| Ga0102895_11742911 | 3300007629 | Estuarine | SETFGDGTTEKVSMILSGYSSRTLEIKRVPIPDPVPPPSEWVI* |
| Ga0105051_100862394 | 3300007722 | Freshwater | VSDTFGDGTTEKVYMILSGYSSLIFEMRRVPIPDPVPPPNEWVNWKP* |
| Ga0114338_100039912 | 3300008105 | Freshwater, Plankton | VSETFGEGTTENVSIILSGYYYLIFEIKRVPIPDPVPPPNEWVIWKP* |
| Ga0114338_10061608 | 3300008105 | Freshwater, Plankton | VSETFGDGTTEKVSIILSGYSYLSLEMRRVPIPDPVPPPKE* |
| Ga0103763_10262681 | 3300008796 | Eutrophic Pond | SDTLGDGTTEKVSMILSGYSSLTLEINKVPIPDPVPPPKEWVI* |
| Ga0114357_10444845 | 3300008966 | Freshwater, Plankton | VSDTFGDGTIEKVSIILSGYSSLTFEISRVPIPEPVPPPNE* |
| Ga0105047_108736901 | 3300009083 | Freshwater | VSETFGDGTTEKVYMILSGYSSLIFEIRRVPIPDPVPPPNEW |
| Ga0114968_105899002 | 3300009155 | Freshwater Lake | SDTLGEGTTEKVSMILSGYSSLILEIKRVPIPDPVPPPNEWVI* |
| Ga0114968_107264742 | 3300009155 | Freshwater Lake | VSETFGEGITEKVTIYLSGYSSLIFEISKVPIPDPVPPPRECVI* |
| Ga0103745_100532951 | 3300009196 | Wastewater Sludge | VSETFGDGTTEKVSMILSGYSSLTFEINKVPIPDPVPPPNEWQI* |
| Ga0103851_11086182 | 3300009225 | River Water | TVSDTFGEGTTEKVSMILSGYSSLTFEINNVPIPDPVPPPKEWVI* |
| Ga0103826_1144391 | 3300009338 | River Water | GEGTTENVSMILSGYSSLILEIKRVPIPDPVPPPREWVI* |
| Ga0103839_10045312 | 3300009346 | River Water | MTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT* |
| Ga0115017_10208561 | 3300009411 | Soil | TVSLTLGDGKIEKVSMILSGYSSRILEIKRVPIPEPVPPPRE* |
| Ga0115005_106503762 | 3300009432 | Marine | FGDGKTEKVAITYEGYSSLILPISSVPIPEPVPPPRECVI* |
| Ga0115008_101617212 | 3300009436 | Marine | VSDTFGDGKTEKVAITYEGYSSLILPISSVPIPEPVPPPRECVI* |
| Ga0115007_104240261 | 3300009441 | Marine | KTEKVAITYEGYSSLILPISSVPIPEPVPPPRECVI* |
| Ga0114939_105678821 | 3300009455 | Groundwater | TVSDTFGDGNTEKVSMILSGYSYLILLINKVPIPDPVPPPKE* |
| Ga0115099_103195752 | 3300009543 | Marine | TTVSDTFGDGTIEKVNMILSGYSSLILEIKRVPIPDPVPPPREWVI* |
| Ga0115006_101969791 | 3300009544 | Marine | VSDTFGDGKTEKVAITYEGYSSLILPISRVPIPEPVPPPRECVI* |
| Ga0115013_111735313 | 3300009550 | Marine | TVSDTFGDGTIEKVVMILSGYSSLILEIKRVPIPDPVPPPREWVI* |
| Ga0115103_13606133 | 3300009599 | Marine | VSDTLGEGTTEKVSMILSGYSSLILEIKRVPIPDPVPPPKE* |
| Ga0115103_16128012 | 3300009599 | Marine | TLGEGTTEKVSMILSGYSSLTLEINKVPIPDPVPPPKEWVI* |
| Ga0115103_17492834 | 3300009599 | Marine | VSDTFGDGTTEKVSIILSGYSSLILEIKRVPIPEPVPPPKE* |
| Ga0115102_104816312 | 3300009606 | Marine | VSDTFGDGTTEKVSIILSGYSSLIFEIKRVPIPEPVPPPKE* |
| Ga0115102_108537931 | 3300009606 | Marine | DGTIEKVSIILSGYSSLTFEINKVPIPDPVPPPNE* |
| Ga0115104_102758262 | 3300009677 | Marine | DTFGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT* |
| Ga0115104_106260391 | 3300009677 | Marine | TVSETLGDGTTEKVVMILSGYSSLTLEIKRVPIPDPVPPPRE* |
| Ga0115105_105383153 | 3300009679 | Marine | TVSDTFGDGKTENVCMILSGYSSLIFEIKRVPIPDPVPPPIE* |
| Ga0115105_114349431 | 3300009679 | Marine | TVSDTFGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT* |
| Ga0116227_113795222 | 3300009709 | Host-Associated | SDTFGEGNTEKVIIILSGYSSRILEINNVPMPDPVPPPKE* |
| Ga0116227_113844902 | 3300009709 | Host-Associated | SDTFGEGNTEKVIIILSGYSSRILEINNVPMPDPVPPPKEWHT* |
| Ga0123362_11196031 | 3300009739 | Marine | ETFGDGTIEKVSIILSGYSSLTFEINKVPIPDPVPPPNEWVI* |
| Ga0123367_11050722 | 3300009757 | Marine | ERVELYGSTTVSDTLGDGITEKVAIILSGYSSLTLVTKRVPIPDPVPPPSDWVT* |
| Ga0116226_102847063 | 3300009787 | Host-Associated | GDGNTEKDAIFLSGYSSRIFDTNRVPKPEPGPPPNE* |
| Ga0116226_107710442 | 3300009787 | Host-Associated | GSTTVSDTLGEGKTEKVSIILSGYSSRIFEINNVPMPDPVPPPRE* |
| Ga0116226_114675072 | 3300009787 | Host-Associated | VSDTFGEGNTEKVIIILSGYSSRILEINNVPMPDPVPPPKEWHT* |
| Ga0116226_119230782 | 3300009787 | Host-Associated | GNTENVIIILSGYSSRILEINNVPMPEPVPPPNEWHT* |
| Ga0114964_104557941 | 3300010157 | Freshwater Lake | ITEKVAIILSGYSSRILEIKRVPIPEPVPPPREWVT* |
| Ga0129320_1530942 | 3300010305 | Aqueous | GMTEKVAMILSGYSSRILEIKRVPIPEPVPPPREWVT* |
| Ga0136654_12153441 | 3300010315 | Marine Gutless Worms | LGDGTTEKVFMMRSGYSSRILLINSVPMPDPVPPPSECVS |
| Ga0138316_101834882 | 3300010981 | Marine | SDTFGDGKTEKVAITYEGYSSLILPISSVPIPEPVPPPRECVI* |
| Ga0138326_112992431 | 3300010985 | Marine | TFGDGKTEKVQITYYGYSSLIFPIKSVPIPDPVPPPKE* |
| Ga0138324_105887111 | 3300010987 | Marine | ETFGEGITEYVDIIRSGYSSRILEINNVPIPDPVPPPKE* |
| Ga0138324_106178051 | 3300010987 | Marine | TFGDGKTEKVSMILSGYSSLILEIRRVPIPDPVPPPREWVI* |
| Ga0138324_106487951 | 3300010987 | Marine | DGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVI* |
| Ga0129318_102290491 | 3300011009 | Freshwater To Marine Saline Gradient | VSETLGEGITEKVAIILSGYSSRIFEMRRVPIPEPVPPPREWVIWKPWRQ |
| Ga0150983_150132001 | 3300011120 | Forest Soil | ETLGEGTTEKVSIILSGYSSRTLEINKVPIPDPVPPPREWVI* |
| Ga0138389_10965132 | 3300011295 | Marine | TEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT* |
| Ga0102688_11257691 | 3300011381 | Freshwater Lake | ETFGDGTIEKVSMILSGYSSLTFEINKVPIPDPVPPPNEWVI* |
| Ga0150985_1021096761 | 3300012212 | Avena Fatua Rhizosphere | TTVSETFGDGTTENVHMILSGYSSLTLEIKRVPIPDPVPPPREWVI* |
| Ga0150985_1054760911 | 3300012212 | Avena Fatua Rhizosphere | EGKTENVSIILSGYSSLILEIKSVPIPDPVPPPREWQT* |
| Ga0150985_1183586192 | 3300012212 | Avena Fatua Rhizosphere | EGNTENVSIMRSGYSSLILDINRVPMPDPVPPPRE* |
| Ga0138258_11660321 | 3300012413 | Polar Marine | STTVSDTFGDGTIEKVSMILSGYSSLTFEINKVPIPDPVPPPNEWVI* |
| Ga0138260_105123452 | 3300012419 | Polar Marine | STTVSDTLGEGTTENVSIILSGYSSLILEINKVPIPDPVPPPKE* |
| Ga0129329_10250191 | 3300012470 | Aqueous | MTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVTWKP |
| Ga0129331_12982071 | 3300012524 | Aqueous | ETLGEGTTEKVVMILSGYSSLTLEIKRVPIPDPVPPPRE* |
| Ga0157608_10847411 | 3300012709 | Freshwater | SETLGEGTTEKVSMILSGYSSLILEIRRVPIPDPVPPPREWVI* |
| Ga0157607_12209323 | 3300012711 | Freshwater | ETFGEGTTENVSIILSGYYYLIFEIKRVPIPDPVPPPNEWVIWKP* |
| Ga0157599_12526412 | 3300012715 | Freshwater | STTVSETFGDGTTEKVSMILSGYYSLIFEMRRVPIPDPVPPPNE* |
| Ga0157605_11947442 | 3300012716 | Freshwater | GEGTTEKVSMILSGYSSLTLEIKRVPIPDPVPPPKEWVI* |
| Ga0157630_12841642 | 3300012722 | Freshwater | VSETLGDGTTEKVSMILSGYSSLIFEIKRVPIPEPVPPPKECVI* |
| Ga0157552_12204621 | 3300012728 | Freshwater | EGMTEKVAMILSGYSSRILEIKRVPIPEPVPPPREWVT* |
| Ga0157606_11137852 | 3300012733 | Freshwater | GTTEKVHMILSGYSSLTLEIKRVPIPEPVPPPREWVIWTP* |
| Ga0157615_13878701 | 3300012734 | Freshwater | STTVSETLGEGTTEKVSMILSGYSSLILEIKRVPIPDPVPPPREWVI* |
| Ga0157532_1800502 | 3300012745 | Freshwater | GSTTVSETLGEGTTEKVSIILSGYSSLILEIKRVPIPDPVPPPKEWVI* |
| Ga0138272_10588932 | 3300012756 | Freshwater Lake | ETLGEGTTEKVSMILSGYSSLILEIKRVPIPDPVPPPREWVI* |
| Ga0138289_10071202 | 3300012763 | Freshwater Lake | STTVSDTFGDGTTENVSIILSGYSSLTLEINRVPIPDPVPPPKEWVI* |
| Ga0138289_10805502 | 3300012763 | Freshwater Lake | MILSGYSSLILEMSRVPIPDPVPPPIEWVTWNPCR |
| Ga0138276_10840932 | 3300012768 | Freshwater Lake | TLGEGTTEKVSMILSGYSSLILEIRRVPIPDPVPPPREWVI* |
| Ga0138287_12535251 | 3300012772 | Freshwater Lake | DGTTEKVSIILSGYSSLTFEIKRVPIPDPVPAPKEWVI* |
| Ga0138257_16798042 | 3300012935 | Polar Marine | PVSETLGEGTTEKVSMILSGYSSLTFEIKRVPIPDPVPPPKD* |
| Ga0129335_10994952 | 3300012962 | Aqueous | MEKVIIMRSGYSSRILEIKRVPIPEPVPPPREWAIW |
| Ga0164294_107630341 | 3300013006 | Freshwater | SDTLGEGMTEKVAMILSGYSSRILEIKRVPIPEPVPPPREWVT* |
| Ga0164294_110711671 | 3300013006 | Freshwater | SDTLGEGMTEKVAMILSGYSSRILEIKRVPIPEPVPPPRE* |
| Ga0170791_112933893 | 3300013295 | Freshwater | VSETLGDGMTEKVAMILSGYSSRIFEMRRVPIPEPVPPPREWVI* |
| Ga0157622_12380512 | 3300013310 | Freshwater | GTTEKVSMILSGYSSLILEIRRVPIPDPVPPPREWVI* |
| Ga0182112_10268181 | 3300015304 | Miscanthus Phyllosphere | SETFGDGNTEKVNIILSGYSSLILEIRRVPMPDPVPPPKEWQT* |
| Ga0182049_11662332 | 3300016736 | Salt Marsh | VSETLGEGTTEKVVMILSGYSSLILEIKRVPIPDPVPPPREWVI |
| Ga0193355_10283351 | 3300018628 | Marine | VALYGSTTVSDTFGDGTTEKVSMTRSGYSSRILEMRRVPIPAPVPPPREWVSWKP |
| Ga0188873_10151321 | 3300018632 | Freshwater Lake | MESVALYGSTTVSETFGDGTTENVFMIRSGYSSRTLDTKSVPRPEPVPPPRECV |
| Ga0192848_10081183 | 3300018662 | Marine | VSETFGDGTTEKKVYMILSGYSSLILEMRRVPIPDPVPPPRE |
| Ga0193110_10197842 | 3300018696 | Marine | VSETLGEGTTEKVSMILSGYSSLTLEINKVPIPDPVPPPKEWVI |
| Ga0193247_10588972 | 3300018744 | Marine | VSETFGDGTTEKVYMILSGYSSLILEMRRVPIPDPVPPPRE |
| Ga0188883_100182721 | 3300018843 | Freshwater Lake | TVSDTFGLGTTEKVSIILSGYSSLTFEINKVPIPEPVPPPRE |
| Ga0193276_11225562 | 3300018883 | Marine | VSETFGEGNTEKVHIIRSGYSSRILEMRRVPMPDPVPPPR |
| Ga0193176_101457701 | 3300018912 | Marine | VSETFGDGTTEKVYMILSGYSSLILEMRRVPIPDPVPPP |
| Ga0192947_102442031 | 3300018982 | Marine | TVSDTLGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT |
| Ga0192951_100279142 | 3300019022 | Marine | VSDTFGDGTTENVSIILSGYSSLILEIKRVPIPDPVPPPRE |
| Ga0192998_101260741 | 3300019043 | Marine | VSDTFGDGTIEKVSIILSGYSSLILDIKRVPIPEPVPPPKEWVI |
| Ga0193336_104616943 | 3300019045 | Marine | DTLGDGTTLKVFMILSGYSSRILEMRRVPIPDPVPPPRE |
| Ga0192992_100189054 | 3300019054 | Marine | MMEKVSMILSGYSSLILEMSRVPIPDPVPPPREWVIWKP |
| Ga0193157_10091672 | 3300019118 | Marine | MTEKVAMILSGYSSLILEIRRVPIPDPVPPPREWVT |
| Ga0181512_15383871 | 3300019270 | Peatland | VSETFGDGTTEKVSIILSGYSSLTLEIKRVPIPDPVPPPKEWVI |
| Ga0182059_11779623 | 3300019272 | Salt Marsh | TLGDGTTEKVVMILSGYSSLTLEIKRVPIPDPVPPPREWVI |
| Ga0182044_10202491 | 3300020014 | Salt Marsh | DTFGDGTIEKVSIILSGYSSLTFEINKVPIPDPVPPPKE |
| Ga0206356_114083952 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | ETLGEGKTEKVSMILSGYSSLTLEMRRVPIPDPVPPPSE |
| Ga0206355_10066671 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | ETLGEGATEKVHIILSGNSSLILESNKVPIPEPVPPPKD |
| Ga0211731_106414681 | 3300020205 | Freshwater | TTVSDTLGEGMTEKVAMILSGYSSRILEIKRVPIPEPVPPPRE |
| Ga0206687_13048843 | 3300021169 | Seawater | SDTLGDGNTENVCMILSGYSSLIFEISKVPIPDPVPPPIE |
| Ga0206687_13534291 | 3300021169 | Seawater | MEKVSIILSGYSSLILEIKRVPIPEPVPPPKEWVI |
| Ga0206687_15570552 | 3300021169 | Seawater | LGDGTTEKVSMILSGYSSLIFEIKRVPIPDPVPPPREWVI |
| Ga0210340_10991471 | 3300021273 | Estuarine | TTEKVSIILSGYSSLTLEMRRVPIPDPVPPPKEWVIWNP |
| Ga0206694_11312761 | 3300021291 | Seawater | TIEKVVIILSGYSSLILEIKRVPIPDPVPPPREWVI |
| Ga0210300_1334501 | 3300021296 | Estuarine | TMEKVSIILSGYSSLTLEINNVPIPDPVPPPNEWVI |
| Ga0210302_10028231 | 3300021299 | Estuarine | TVSETFGDGTIEKVSMILSGYSSLTFEINKVPIPDPVPPPNE |
| Ga0206696_14062673 | 3300021334 | Seawater | MEKVTMILSGYSSLILEIKRVPIPDPVPPPKEWVV |
| Ga0206691_13326401 | 3300021342 | Seawater | TVSDTFGDGTTEKVVMILSGYSSLILDIKRVPIPDPVPPPRECVI |
| Ga0206691_14154961 | 3300021342 | Seawater | MEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVTWKPWRQS |
| Ga0206691_15701003 | 3300021342 | Seawater | STTVSDTFGDGTIEKVVMILSGYSSLILEIKRVPIPDPVPPPREWVI |
| Ga0206688_105885061 | 3300021345 | Seawater | VSDTFGDGKTENVAITYEGYSSLILPISSVPIPEPVPPPRECVI |
| Ga0206695_14377901 | 3300021348 | Seawater | VSETLGEGKIEKVSMILSGYSSLILEMSRVPMPDPVPPPREWV |
| Ga0206695_14851621 | 3300021348 | Seawater | VSDTFGDGTTEKVSIILSGYSSLIFEIKRVPIPEPVPPPKE |
| Ga0206693_16030821 | 3300021353 | Seawater | TTVSDTFGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT |
| Ga0206693_18266543 | 3300021353 | Seawater | TVSDTFGDGTIEKVVMILSGYSSLIFEIKRVPIPDPVPPPREWVI |
| Ga0206690_103614122 | 3300021355 | Seawater | STTVSETFGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT |
| Ga0206690_108441092 | 3300021355 | Seawater | TEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT |
| Ga0206689_101950221 | 3300021359 | Seawater | GMTEKVTIILSGYSSLILEIRRVPIPDPVPPPREWVTWKP |
| Ga0206689_107497771 | 3300021359 | Seawater | VSDTFGDGTIEKVSIILSGYSSLIFEIKRVPIPEPVPPPKE |
| Ga0206689_108969852 | 3300021359 | Seawater | MEKVVMILSGYSSLILEIKRVPIPDPVPPPREWVI |
| Ga0210317_11259851 | 3300021852 | Estuarine | VSDTFGEGTTEKVSIILSGYSSLTLEINKVPIPDPVPPPNE |
| Ga0213850_11144391 | 3300021856 | Watersheds | GTMEKVSMILSGYSSLTLEINKVPIPDPVPPPKEWVI |
| Ga0213850_12707675 | 3300021856 | Watersheds | VSETFGDGTTEKVSIILSGYSSLTFEIKRVPIPDPVPPPKEWVI |
| Ga0063097_10205131 | 3300021898 | Marine | VSDTFGDGKTEKVAITYEGYSSLILPISSVPIPEPVPPPRECVI |
| Ga0063100_10226741 | 3300021910 | Marine | KTEKVAITYEGYSSLILPISSVPIPEPVPPPRECVI |
| Ga0063096_10316961 | 3300021925 | Marine | FGDGKTEKVAITYEGYSSLILPISSVPIPEPVPPPRECVI |
| Ga0063139_10243532 | 3300021934 | Marine | VSDTFGDGTTENVSIILSGYSSLILEIKRVPIPEPVPPPKE |
| Ga0063102_10747082 | 3300021941 | Marine | TEKVAITYEGYSSLILPISSVPIPEPVPPPRECVI |
| Ga0213929_10248871 | 3300022154 | Freshwater | VALYGSTTVSDTLGEGTTEKVAMILSGYSSLTLEMRRVPFPKPRRPPRE |
| Ga0213934_10592182 | 3300022156 | Freshwater | VSETLGDGTTENVHMILSGYSSLTFEIKRVPIPEPVPPPNEWVI |
| Ga0242669_11215482 | 3300022528 | Soil | TLGDGTTEKVHMILSGYSSLTFEIRRVPIPEPVPPPREWVI |
| Ga0228633_10036511 | 3300024228 | Seawater | TVSDTLGDGTTENVSIIISGYSSMTFEIKRVPIPDPVPPPKEWVI |
| Ga0233399_10052491 | 3300024231 | Seawater | STTVSDTLGDGTTENVSMILSGYSSLTFEIKRVPIPDPVPPPKEWVI |
| Ga0228629_10029273 | 3300024296 | Seawater | VSDTLGDGTTENVSMILSGYSSLTFEIKRVPIPDPVPPPKEWVI |
| Ga0244777_109264791 | 3300024343 | Estuarine | SETLGDGMTEKVAIILSGYSSRILEIKSVPIPEPVPPPREWVI |
| Ga0256348_10850491 | 3300024543 | Freshwater | TFGDGTIEKVSMILSGYSSLTFEINKVPIPDPVPPPNEWVI |
| Ga0256347_10776491 | 3300024545 | Freshwater | VSETFGDGTTEKVAMILSGYSSLTFEINKVPIPDPVPPPNEWVI |
| Ga0255292_11076591 | 3300024547 | Freshwater | TVSDTFGDGTTEKVSMILSGYSSLTFEINNVPIPDPVPPPKEWVI |
| Ga0255229_10129863 | 3300024848 | Freshwater | VSETLGEGTTEKVSMILSGYSSLILEIRRVPIPDPVPPPREWVI |
| Ga0256340_11535981 | 3300024865 | Freshwater | TTEKVSIILSRYSSLTLEIKRVPIPDPVPPPKEWVI |
| Ga0208740_10392453 | 3300025391 | Freshwater | GDGMTEKVTICLSGYSSLIFEIRSVPIPDPVPPPSEWVT |
| Ga0247603_11158261 | 3300026468 | Seawater | TVSDTFGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT |
| Ga0255269_12010762 | 3300026573 | Freshwater | TFGDGTTEKVSIILSGYSSLTFEINKVPIPDPVPPPKEWVI |
| Ga0209366_11202543 | 3300027347 | Marine Gutless Worms Symbiont | MQEILTFGEGTTEKVFMMRSGYSSRILLMSSVPMPDPVPPP |
| Ga0255582_12249682 | 3300027507 | Coral | VSDTLGEGTTEKVSMILSGYSSLTLEINKVPIPDPVPPPKE |
| Ga0209617_100590061 | 3300027720 | Freshwater And Sediment | VSETFGEGITEKVTIYLSGYSSLIFEISKVPIPDPVPPPRECVT |
| Ga0209092_103441321 | 3300027833 | Marine | TFGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT |
| Ga0209974_103602312 | 3300027876 | Arabidopsis Thaliana Rhizosphere | VSETFGDGTTENVHMILSGYSSLTLEMRRVPIPDPVPPPSEWVIWKPCKQS |
| Ga0209067_108443601 | 3300027898 | Watersheds | GEGTTEKVSMILSGYSSLTFEIKRVPIPDPVPPPREWVI |
| Ga0256417_12105081 | 3300028233 | Seawater | FGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT |
| Ga0247601_10620331 | 3300028330 | Seawater | TTENVSIILSGYSSLTFEIKRVPIPDPVPPPKEWVI |
| Ga0304731_107267482 | 3300028575 | Marine | SDTFGDGKTEKVAITYEGYSSLILPISSVPIPEPVPPPRECVI |
| Ga0304731_109678792 | 3300028575 | Marine | GEGTTEKVVMILSGYSSRILEIRRVPIPDPVPPPSE |
| Ga0265780_105844833 | 3300028588 | Plant Litter | MTEKVHIIRSGYSSLIFEIKSVPIPAPVPPPREWVI |
| Ga0272412_10895852 | 3300028647 | Activated Sludge | VSETFGDGTIEKLSMILSGYSSLTFEINKVPIPDPVPPPNEWVI |
| Ga0256301_10312391 | 3300029697 | Freshwater | VSETLGEGTTEKVSMILSGYSSLILEIRRVTIPDPVP |
| Ga0210284_13395583 | 3300030529 | Soil | TTEKVAIILSGYSSLTFEIKRVPIPEPVPPPNEWVI |
| Ga0210249_12221241 | 3300030542 | Soil | TEKVHIIRSGYSSLILEINKVPIPDPVPPPREWVI |
| Ga0210252_111384951 | 3300030548 | Soil | TTENVSIILSGYSSLTFEIKSVPIPEPVPPPNEWVI |
| Ga0210258_107050041 | 3300030572 | Soil | VSETFGEGTTEKVAIILSGYSSLTFEIKRVPIPEPVPPPNEWVI |
| Ga0247613_104553161 | 3300030610 | Soil | DTFGDGTTEKVSIILSGYSSLTFEINNVPIPDPVPPPKE |
| Ga0247629_104154312 | 3300030628 | Soil | ETFGDGTTEKVSMILSGYSSLTFEINKVPIPDPVPPPNEWVI |
| Ga0210250_112600181 | 3300030632 | Soil | GSTTVSDTFGDGTMEKVSMILSGYSSLTFEINKVPIPDPVPPPNEWVI |
| Ga0247627_103364221 | 3300030635 | Soil | DTFGDGTTEKVSMILSGYSSLTFEINKVPIPDPVPPPNEWVI |
| Ga0308137_11028972 | 3300030722 | Marine | DTFGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVI |
| Ga0308131_10594703 | 3300030729 | Marine | MIEKVSMILSGYSSLILEMSRVPIPDPVPPPREWVIWKP |
| Ga0265462_116775951 | 3300030738 | Soil | TVSDTLGDGTTEKVHMILSGYSSLTFEIRRVPMPDPVPPPRE |
| Ga0265459_107653763 | 3300030741 | Soil | VSDTLGDGTTEKVSIILSGYSSLTFEINRVPIPEPVPPRGEWV |
| Ga0265459_141118042 | 3300030741 | Soil | TTEKVSIILSGYSSLTFEIKSVPIPEPVPPPNEWVI |
| Ga0073988_123647662 | 3300030780 | Marine | GTIEKVVMILSGYSSLILEIKRVPIPDPVPPPREWVI |
| Ga0073964_100291962 | 3300030788 | Marine | GDGTTEKVSIILSGYSSLILEIKRVPIPDPVPPPSE |
| Ga0073972_113824141 | 3300030865 | Marine | TVSDTFGDGTIEKVVMILSGYSSLILEIKRVPIPDPVPPPREWVI |
| Ga0138299_100117902 | 3300030938 | Soil | GKTEKVSIILSGYSSLTLVIKRVPIPEPVPPPNEWVI |
| Ga0138297_10342162 | 3300030962 | Soil | MEYVLIILLGYSSWIFEIKMVPIPAPVPPPREWEIWKQT |
| Ga0075375_121166702 | 3300030971 | Soil | VSETFGDGKTEKVSIILSGYSSLTLVIKRVPIPEPVPPPNEWVI |
| Ga0073980_100074311 | 3300031032 | Marine | MTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVTW |
| Ga0170824_1090573752 | 3300031231 | Forest Soil | FGDGKTEKVSIILSGYSSLTLVIKRVPIPEPVPPPNEWVI |
| Ga0170824_1280998032 | 3300031231 | Forest Soil | STTVSDTFGDGTTENVSMILSGYSSLTLEIKRVPIPDPVPPPSE |
| Ga0102761_101118181 | 3300031411 | Soil | VSETLGEGKTEKVSMILSGYSSLTLEIKRVPIPDPVPPPKEWVIWN |
| Ga0170819_119666101 | 3300031469 | Forest Soil | VSDTFGEGTTEKVSIILSGYSSLTFEIKRVPIPEP |
| Ga0272437_14627251 | 3300031472 | Rock | LERALGEGTTEKVSIMRSGYSSRILLISSVPMPDPVPPPSEC |
| Ga0170818_1142175991 | 3300031474 | Forest Soil | TFGDGTTEKVSMILSGYSSLTFEINKVPIPDPVPPPNEWVI |
| Ga0308150_10355931 | 3300031505 | Soil | GSTTVSDTLGDGTTEKVHMILSGYSSLTLEIRRVPMPEPVPPPREWVI |
| Ga0308148_10402211 | 3300031557 | Marine | TVSETFGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT |
| Ga0308147_10445262 | 3300031558 | Marine | STTVSDTFGDGMTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVT |
| Ga0315291_111389702 | 3300031707 | Sediment | VSETFGEGTTENVIIMRSGYSSRILEMSRVPMPDPV |
| Ga0307381_101513922 | 3300031725 | Marine | VSDTFGDGKTEKVAITYEGYSSLILPISNVPIPEPVPPPRECVI |
| Ga0307387_109393932 | 3300031737 | Marine | TVSETFGDGNTEKVAITYYGYSSFILPIKRVPIPEPVPPPRECVI |
| Ga0307395_102508072 | 3300031742 | Marine | VALYGSTTVSETLGEGTTEKVVMILSGYSSLTLEIKRVPIPDPVP |
| Ga0315907_110620121 | 3300031758 | Freshwater | YGSTTVSETLGEGITEKVIIYLSGYSSLIFEIRRVPIPDPVPPPRECVT |
| Ga0315899_116239732 | 3300031784 | Freshwater | TEKVAMILSGYSSRIFEIKSVPIPDPVPPPREWVT |
| Ga0315304_11145132 | 3300032145 | Marine | MMEKVSMILSGYSSLILEMRRVPMPDPVPPPREWVIWKP |
| Ga0315304_11889232 | 3300032145 | Marine | STTVSDTFGDGTIEKVVMILSGYSSLILEIRRVPIPDPVPPPREWVT |
| Ga0315334_116262481 | 3300032360 | Seawater | GSTTVSDTFGDGKTEKVAITYEGYSSLILPISSVPIPDPVPPPSE |
| Ga0335396_101135771 | 3300032462 | Freshwater | VSETFGDGTTEKVYMILSGYSSLIFEIRRVPIPDPVPPPNEWVNWKP |
| Ga0314689_103906382 | 3300032518 | Seawater | MTEKVAMILSGYSSLILEMRRVPIPDPVPPPREWVTWKPWR |
| Ga0314676_106835212 | 3300032519 | Seawater | VSETLGDGTTEKVVMILSGYSSRILEIRSVPIPDPVPPPREWVSWNPWRQS |
| Ga0314669_107307741 | 3300032708 | Seawater | TFGDGKTEKVAITYEGYSSLILPISSVPIPEPVPPPRECVI |
| Ga0314690_105047941 | 3300032713 | Seawater | MTEKVAMILSGYSSLILEMRRVPMPDPVPPPREWV |
| Ga0315742_131548571 | 3300032756 | Forest Soil | VSETFGDGTTENVHIILSGYSSLTFEIKRVPIPDPVPPPSECVI |
| Ga0315742_133111461 | 3300032756 | Forest Soil | TTVSETLGEGKTEKVSIILSGYSSLTFEIKRVPIPDPVPPPKEWVIWNP |
| Ga0334992_0094870_2_112 | 3300033992 | Freshwater | NVSIILSGYYSLIFEIKRVPIPDPVPPPNEWVIWKP |
| Ga0335004_0505735_535_657 | 3300034021 | Freshwater | LGDGMMEKVNIILSGYSSRILEIKRVPIPEPVPPPSEWVT |
| Ga0334990_0445614_37_177 | 3300034068 | Freshwater | MPTLGEGMTLNVFMILSGYSSLIFEIRRVPIPDPVPPPNEWVSWNP |
| Ga0334990_0475727_517_660 | 3300034068 | Freshwater | MLPVYLSICTFGEGTTEKVFMILSGYASRIFEIKRVPMPDPVPPPRE |
| Ga0335064_0384323_589_729 | 3300034357 | Freshwater | MPTLGEGMTLNVFMILSGYSSLIFEIKRVPIPDPVPPPNEWVSWNP |
| ⦗Top⦘ |