


| Basic Information | |
|---|---|
| Family ID | F017997 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 237 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VNIIEQIVTALLKWLTGLAKTPPTVEDAKPDKELKAKLLDRIDRSGG |
| Number of Associated Samples | 152 |
| Number of Associated Scaffolds | 237 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 53.16 % |
| % of genes near scaffold ends (potentially truncated) | 16.03 % |
| % of genes from short scaffolds (< 2000 bps) | 70.46 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.696 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.034 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.899 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (46.835 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.67% β-sheet: 0.00% Coil/Unstructured: 57.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 237 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 5.91 |
| PF03837 | RecT | 2.53 |
| PF00574 | CLP_protease | 1.69 |
| PF05876 | GpA_ATPase | 1.27 |
| PF05866 | RusA | 1.27 |
| PF13385 | Laminin_G_3 | 0.84 |
| PF05136 | Phage_portal_2 | 0.84 |
| PF07880 | T4_gp9_10 | 0.84 |
| PF01503 | PRA-PH | 0.84 |
| PF03796 | DnaB_C | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 237 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.38 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 3.38 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 2.53 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 1.27 |
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 1.27 |
| COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 0.84 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.42 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.70 % |
| All Organisms | root | All Organisms | 44.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_108252651 | Not Available | 569 | Open in IMG/M |
| 3300002408|B570J29032_108983126 | Not Available | 558 | Open in IMG/M |
| 3300002408|B570J29032_109476724 | Not Available | 794 | Open in IMG/M |
| 3300002835|B570J40625_100011547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15927 | Open in IMG/M |
| 3300002835|B570J40625_100023047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10337 | Open in IMG/M |
| 3300003277|JGI25908J49247_10003127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5273 | Open in IMG/M |
| 3300003277|JGI25908J49247_10093618 | Not Available | 729 | Open in IMG/M |
| 3300003413|JGI25922J50271_10040016 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
| 3300003413|JGI25922J50271_10044650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
| 3300003499|JGI25930J51415_1022620 | Not Available | 1173 | Open in IMG/M |
| 3300003499|JGI25930J51415_1028338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
| 3300004796|Ga0007763_11314583 | Not Available | 746 | Open in IMG/M |
| 3300005525|Ga0068877_10554785 | Not Available | 629 | Open in IMG/M |
| 3300005528|Ga0068872_10137669 | All Organisms → Viruses → Predicted Viral | 1432 | Open in IMG/M |
| 3300005580|Ga0049083_10336653 | Not Available | 503 | Open in IMG/M |
| 3300005581|Ga0049081_10038301 | All Organisms → Viruses → Predicted Viral | 1822 | Open in IMG/M |
| 3300005581|Ga0049081_10130827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
| 3300005583|Ga0049085_10156781 | Not Available | 767 | Open in IMG/M |
| 3300005805|Ga0079957_1190624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300005805|Ga0079957_1328873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 677 | Open in IMG/M |
| 3300005955|Ga0073922_1000154 | Not Available | 7006 | Open in IMG/M |
| 3300006030|Ga0075470_10000180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22232 | Open in IMG/M |
| 3300006030|Ga0075470_10055330 | Not Available | 1213 | Open in IMG/M |
| 3300006030|Ga0075470_10077055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
| 3300006484|Ga0070744_10129886 | Not Available | 725 | Open in IMG/M |
| 3300006484|Ga0070744_10132514 | Not Available | 717 | Open in IMG/M |
| 3300006637|Ga0075461_10154198 | Not Available | 703 | Open in IMG/M |
| 3300006639|Ga0079301_1013092 | All Organisms → Viruses → Predicted Viral | 3037 | Open in IMG/M |
| 3300006639|Ga0079301_1014003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2910 | Open in IMG/M |
| 3300006641|Ga0075471_10067018 | All Organisms → Viruses → Predicted Viral | 1969 | Open in IMG/M |
| 3300006802|Ga0070749_10012957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 5358 | Open in IMG/M |
| 3300006802|Ga0070749_10222679 | Not Available | 1075 | Open in IMG/M |
| 3300006802|Ga0070749_10271242 | Not Available | 957 | Open in IMG/M |
| 3300006802|Ga0070749_10403581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 754 | Open in IMG/M |
| 3300006805|Ga0075464_10619516 | Not Available | 667 | Open in IMG/M |
| 3300007169|Ga0102976_1126908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1469 | Open in IMG/M |
| 3300007177|Ga0102978_1182511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9708 | Open in IMG/M |
| 3300007363|Ga0075458_10024548 | Not Available | 1917 | Open in IMG/M |
| 3300007544|Ga0102861_1000102 | Not Available | 22329 | Open in IMG/M |
| 3300007544|Ga0102861_1003013 | All Organisms → Viruses → Predicted Viral | 3726 | Open in IMG/M |
| 3300007544|Ga0102861_1013622 | Not Available | 1974 | Open in IMG/M |
| 3300007544|Ga0102861_1113236 | Not Available | 728 | Open in IMG/M |
| 3300007544|Ga0102861_1140066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 655 | Open in IMG/M |
| 3300007544|Ga0102861_1213495 | Not Available | 532 | Open in IMG/M |
| 3300007562|Ga0102915_1129974 | Not Available | 823 | Open in IMG/M |
| 3300007590|Ga0102917_1212194 | Not Available | 675 | Open in IMG/M |
| 3300007639|Ga0102865_1047545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1269 | Open in IMG/M |
| 3300007670|Ga0102862_1173189 | Not Available | 556 | Open in IMG/M |
| 3300007735|Ga0104988_10522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16905 | Open in IMG/M |
| 3300007972|Ga0105745_1137218 | Not Available | 742 | Open in IMG/M |
| 3300007972|Ga0105745_1202992 | Not Available | 624 | Open in IMG/M |
| 3300007973|Ga0105746_1141582 | Not Available | 807 | Open in IMG/M |
| 3300007973|Ga0105746_1173061 | Not Available | 733 | Open in IMG/M |
| 3300007974|Ga0105747_1355234 | Not Available | 502 | Open in IMG/M |
| 3300008055|Ga0108970_10225009 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
| 3300008055|Ga0108970_10695829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9695 | Open in IMG/M |
| 3300008055|Ga0108970_11322953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300008107|Ga0114340_1239898 | Not Available | 563 | Open in IMG/M |
| 3300008261|Ga0114336_1009205 | Not Available | 13721 | Open in IMG/M |
| 3300008261|Ga0114336_1136084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1106 | Open in IMG/M |
| 3300008261|Ga0114336_1346151 | Not Available | 535 | Open in IMG/M |
| 3300008266|Ga0114363_1014528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3604 | Open in IMG/M |
| 3300008266|Ga0114363_1031952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2215 | Open in IMG/M |
| 3300008267|Ga0114364_1045818 | Not Available | 1600 | Open in IMG/M |
| 3300008267|Ga0114364_1062522 | Not Available | 1284 | Open in IMG/M |
| 3300008448|Ga0114876_1000995 | Not Available | 21614 | Open in IMG/M |
| 3300008448|Ga0114876_1034874 | All Organisms → Viruses → Predicted Viral | 2419 | Open in IMG/M |
| 3300008448|Ga0114876_1055316 | Not Available | 1766 | Open in IMG/M |
| 3300008448|Ga0114876_1209533 | Not Available | 648 | Open in IMG/M |
| 3300008450|Ga0114880_1025240 | Not Available | 2716 | Open in IMG/M |
| 3300008996|Ga0102831_1030539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1828 | Open in IMG/M |
| 3300008996|Ga0102831_1057869 | All Organisms → Viruses → Predicted Viral | 1296 | Open in IMG/M |
| 3300008999|Ga0102816_1035124 | Not Available | 1471 | Open in IMG/M |
| 3300009026|Ga0102829_1004575 | All Organisms → Viruses → Predicted Viral | 3798 | Open in IMG/M |
| 3300009026|Ga0102829_1005775 | Not Available | 3380 | Open in IMG/M |
| 3300009039|Ga0105152_10060439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1522 | Open in IMG/M |
| 3300009039|Ga0105152_10315573 | Not Available | 652 | Open in IMG/M |
| 3300009059|Ga0102830_1170924 | Not Available | 637 | Open in IMG/M |
| 3300009068|Ga0114973_10002933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12222 | Open in IMG/M |
| 3300009152|Ga0114980_10010607 | Not Available | 5932 | Open in IMG/M |
| 3300009152|Ga0114980_10654013 | Not Available | 591 | Open in IMG/M |
| 3300009155|Ga0114968_10009650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6971 | Open in IMG/M |
| 3300009155|Ga0114968_10320402 | Not Available | 862 | Open in IMG/M |
| 3300009158|Ga0114977_10208597 | Not Available | 1142 | Open in IMG/M |
| 3300009159|Ga0114978_10002707 | All Organisms → cellular organisms → Bacteria | 14590 | Open in IMG/M |
| 3300009159|Ga0114978_10518396 | Not Available | 698 | Open in IMG/M |
| 3300009161|Ga0114966_10290853 | Not Available | 992 | Open in IMG/M |
| 3300009161|Ga0114966_10302897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
| 3300009164|Ga0114975_10076764 | Not Available | 1945 | Open in IMG/M |
| 3300009180|Ga0114979_10778249 | Not Available | 538 | Open in IMG/M |
| 3300009181|Ga0114969_10574076 | Not Available | 621 | Open in IMG/M |
| 3300009183|Ga0114974_10305952 | Not Available | 933 | Open in IMG/M |
| 3300010354|Ga0129333_10004430 | All Organisms → cellular organisms → Bacteria | 13142 | Open in IMG/M |
| 3300010354|Ga0129333_10897367 | Not Available | 750 | Open in IMG/M |
| 3300010354|Ga0129333_11650489 | Not Available | 522 | Open in IMG/M |
| 3300010885|Ga0133913_11412549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia terrae | 1769 | Open in IMG/M |
| 3300010885|Ga0133913_11958109 | Not Available | 1458 | Open in IMG/M |
| 3300011010|Ga0139557_1054088 | Not Available | 680 | Open in IMG/M |
| 3300011114|Ga0151515_10177 | Not Available | 29861 | Open in IMG/M |
| 3300011116|Ga0151516_10931 | All Organisms → cellular organisms → Bacteria | 12906 | Open in IMG/M |
| 3300011268|Ga0151620_1140183 | Not Available | 746 | Open in IMG/M |
| 3300011335|Ga0153698_1332 | All Organisms → cellular organisms → Bacteria | 20316 | Open in IMG/M |
| 3300011995|Ga0153800_1010663 | Not Available | 903 | Open in IMG/M |
| 3300013004|Ga0164293_10123450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1957 | Open in IMG/M |
| 3300013004|Ga0164293_10374647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 965 | Open in IMG/M |
| 3300013004|Ga0164293_10855266 | Not Available | 574 | Open in IMG/M |
| 3300013372|Ga0177922_10628675 | Not Available | 572 | Open in IMG/M |
| 3300013372|Ga0177922_11166391 | Not Available | 538 | Open in IMG/M |
| 3300015050|Ga0181338_1056622 | Not Available | 568 | Open in IMG/M |
| 3300017707|Ga0181363_1009011 | All Organisms → Viruses → Predicted Viral | 2073 | Open in IMG/M |
| 3300017707|Ga0181363_1040153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300017716|Ga0181350_1054315 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300017736|Ga0181365_1071761 | Not Available | 853 | Open in IMG/M |
| 3300017736|Ga0181365_1122266 | Not Available | 623 | Open in IMG/M |
| 3300017736|Ga0181365_1140190 | Not Available | 576 | Open in IMG/M |
| 3300017747|Ga0181352_1056683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1129 | Open in IMG/M |
| 3300017747|Ga0181352_1159469 | Not Available | 593 | Open in IMG/M |
| 3300017754|Ga0181344_1003106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5813 | Open in IMG/M |
| 3300017754|Ga0181344_1018497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2174 | Open in IMG/M |
| 3300017754|Ga0181344_1091311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 889 | Open in IMG/M |
| 3300017754|Ga0181344_1099030 | Not Available | 848 | Open in IMG/M |
| 3300017754|Ga0181344_1185385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 587 | Open in IMG/M |
| 3300017777|Ga0181357_1027188 | Not Available | 2268 | Open in IMG/M |
| 3300017777|Ga0181357_1190615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300017777|Ga0181357_1303769 | Not Available | 541 | Open in IMG/M |
| 3300017784|Ga0181348_1023630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2609 | Open in IMG/M |
| 3300017785|Ga0181355_1106665 | All Organisms → Viruses → Predicted Viral | 1155 | Open in IMG/M |
| 3300019784|Ga0181359_1024045 | Not Available | 2323 | Open in IMG/M |
| 3300019784|Ga0181359_1029885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2100 | Open in IMG/M |
| 3300019784|Ga0181359_1143606 | Not Available | 827 | Open in IMG/M |
| 3300019784|Ga0181359_1227886 | Not Available | 581 | Open in IMG/M |
| 3300020172|Ga0211729_11004820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2207 | Open in IMG/M |
| 3300020172|Ga0211729_11267065 | Not Available | 516 | Open in IMG/M |
| 3300020172|Ga0211729_11370463 | Not Available | 667 | Open in IMG/M |
| 3300020220|Ga0194119_10802103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300020515|Ga0208234_1010861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1126 | Open in IMG/M |
| 3300020553|Ga0208855_1010951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1485 | Open in IMG/M |
| 3300021312|Ga0210306_1109411 | Not Available | 552 | Open in IMG/M |
| 3300021328|Ga0210298_1022303 | Not Available | 550 | Open in IMG/M |
| 3300021952|Ga0213921_1065426 | Not Available | 514 | Open in IMG/M |
| 3300021956|Ga0213922_1118490 | Not Available | 523 | Open in IMG/M |
| 3300021961|Ga0222714_10011226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7656 | Open in IMG/M |
| 3300021962|Ga0222713_10184569 | Not Available | 1409 | Open in IMG/M |
| 3300021962|Ga0222713_10818355 | Not Available | 518 | Open in IMG/M |
| 3300021962|Ga0222713_10847635 | Not Available | 506 | Open in IMG/M |
| 3300021963|Ga0222712_10206345 | Not Available | 1283 | Open in IMG/M |
| 3300021963|Ga0222712_10515579 | Not Available | 704 | Open in IMG/M |
| 3300022179|Ga0181353_1035458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1323 | Open in IMG/M |
| 3300022179|Ga0181353_1054026 | Not Available | 1047 | Open in IMG/M |
| 3300022179|Ga0181353_1126586 | Not Available | 606 | Open in IMG/M |
| 3300024346|Ga0244775_10019488 | Not Available | 6209 | Open in IMG/M |
| 3300024346|Ga0244775_10077552 | Not Available | 2843 | Open in IMG/M |
| 3300024346|Ga0244775_11179975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300024348|Ga0244776_10160900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1627 | Open in IMG/M |
| 3300024490|Ga0255185_1032422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300024512|Ga0255186_1038482 | Not Available | 639 | Open in IMG/M |
| 3300025445|Ga0208424_1020113 | Not Available | 780 | Open in IMG/M |
| 3300025635|Ga0208147_1005373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3725 | Open in IMG/M |
| 3300025635|Ga0208147_1025143 | Not Available | 1585 | Open in IMG/M |
| 3300025848|Ga0208005_1175739 | Not Available | 666 | Open in IMG/M |
| 3300025872|Ga0208783_10144242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
| 3300025889|Ga0208644_1279608 | Not Available | 674 | Open in IMG/M |
| 3300027193|Ga0208800_1024568 | Not Available | 801 | Open in IMG/M |
| 3300027205|Ga0208926_1000140 | All Organisms → cellular organisms → Bacteria | 14290 | Open in IMG/M |
| 3300027205|Ga0208926_1000223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10966 | Open in IMG/M |
| 3300027213|Ga0208555_1013570 | Not Available | 1284 | Open in IMG/M |
| 3300027320|Ga0208923_1005377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2253 | Open in IMG/M |
| 3300027499|Ga0208788_1020028 | All Organisms → Viruses → Predicted Viral | 2147 | Open in IMG/M |
| 3300027631|Ga0208133_1087956 | Not Available | 729 | Open in IMG/M |
| 3300027659|Ga0208975_1007244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3967 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1013422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7019 | Open in IMG/M |
| 3300027754|Ga0209596_1001255 | Not Available | 22211 | Open in IMG/M |
| 3300027759|Ga0209296_1001126 | Not Available | 21281 | Open in IMG/M |
| 3300027759|Ga0209296_1023895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3445 | Open in IMG/M |
| 3300027760|Ga0209598_10005022 | Not Available | 9521 | Open in IMG/M |
| 3300027763|Ga0209088_10000826 | Not Available | 21022 | Open in IMG/M |
| 3300027770|Ga0209086_10124652 | Not Available | 1281 | Open in IMG/M |
| 3300027782|Ga0209500_10002082 | All Organisms → cellular organisms → Bacteria | 14558 | Open in IMG/M |
| 3300027793|Ga0209972_10270889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 759 | Open in IMG/M |
| 3300027804|Ga0209358_10289988 | Not Available | 808 | Open in IMG/M |
| 3300027806|Ga0209985_10366586 | Not Available | 633 | Open in IMG/M |
| 3300027973|Ga0209298_10009916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5110 | Open in IMG/M |
| 3300029349|Ga0238435_111751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300031772|Ga0315288_10462956 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
| 3300031787|Ga0315900_10266786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1448 | Open in IMG/M |
| 3300031787|Ga0315900_10425219 | Not Available | 1037 | Open in IMG/M |
| 3300031787|Ga0315900_10731024 | Not Available | 695 | Open in IMG/M |
| 3300031857|Ga0315909_10022139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6366 | Open in IMG/M |
| 3300031857|Ga0315909_10491760 | Not Available | 850 | Open in IMG/M |
| 3300031885|Ga0315285_10106184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2435 | Open in IMG/M |
| 3300031885|Ga0315285_10383377 | Not Available | 1013 | Open in IMG/M |
| 3300031885|Ga0315285_10906517 | Not Available | 539 | Open in IMG/M |
| 3300031951|Ga0315904_10139710 | All Organisms → Viruses → Predicted Viral | 2471 | Open in IMG/M |
| 3300031951|Ga0315904_10562850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 990 | Open in IMG/M |
| 3300031951|Ga0315904_11232450 | Not Available | 572 | Open in IMG/M |
| 3300031952|Ga0315294_10228033 | Not Available | 1833 | Open in IMG/M |
| 3300031963|Ga0315901_11219811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 508 | Open in IMG/M |
| 3300032046|Ga0315289_10811736 | Not Available | 822 | Open in IMG/M |
| 3300032053|Ga0315284_11588697 | Not Available | 688 | Open in IMG/M |
| 3300032093|Ga0315902_11095043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300032116|Ga0315903_10540400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 910 | Open in IMG/M |
| 3300032177|Ga0315276_10263493 | Not Available | 1826 | Open in IMG/M |
| 3300032256|Ga0315271_10809080 | Not Available | 807 | Open in IMG/M |
| 3300032401|Ga0315275_10637184 | Not Available | 1189 | Open in IMG/M |
| 3300033233|Ga0334722_10060916 | All Organisms → cellular organisms → Bacteria | 2940 | Open in IMG/M |
| 3300033981|Ga0334982_0010357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5545 | Open in IMG/M |
| 3300033981|Ga0334982_0341888 | Not Available | 693 | Open in IMG/M |
| 3300033992|Ga0334992_0003338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11982 | Open in IMG/M |
| 3300033993|Ga0334994_0005050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9291 | Open in IMG/M |
| 3300033993|Ga0334994_0092373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1793 | Open in IMG/M |
| 3300033993|Ga0334994_0262809 | Not Available | 896 | Open in IMG/M |
| 3300033993|Ga0334994_0411830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300033995|Ga0335003_0127668 | Not Available | 1288 | Open in IMG/M |
| 3300033996|Ga0334979_0173306 | Not Available | 1289 | Open in IMG/M |
| 3300034013|Ga0334991_0047420 | Not Available | 2266 | Open in IMG/M |
| 3300034021|Ga0335004_0001933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15613 | Open in IMG/M |
| 3300034061|Ga0334987_0003209 | All Organisms → cellular organisms → Bacteria | 15750 | Open in IMG/M |
| 3300034061|Ga0334987_0095987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2294 | Open in IMG/M |
| 3300034061|Ga0334987_0278688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
| 3300034062|Ga0334995_0139347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1768 | Open in IMG/M |
| 3300034063|Ga0335000_0098790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1999 | Open in IMG/M |
| 3300034066|Ga0335019_0659220 | Not Available | 606 | Open in IMG/M |
| 3300034073|Ga0310130_0017374 | All Organisms → Viruses → Predicted Viral | 2344 | Open in IMG/M |
| 3300034101|Ga0335027_0001462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20487 | Open in IMG/M |
| 3300034101|Ga0335027_0079207 | Not Available | 2560 | Open in IMG/M |
| 3300034102|Ga0335029_0386098 | Not Available | 850 | Open in IMG/M |
| 3300034104|Ga0335031_0018676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5084 | Open in IMG/M |
| 3300034104|Ga0335031_0569835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300034104|Ga0335031_0673577 | Not Available | 598 | Open in IMG/M |
| 3300034112|Ga0335066_0173083 | Not Available | 1301 | Open in IMG/M |
| 3300034116|Ga0335068_0004474 | Not Available | 9344 | Open in IMG/M |
| 3300034167|Ga0335017_0281802 | Not Available | 931 | Open in IMG/M |
| 3300034279|Ga0335052_0426117 | Not Available | 701 | Open in IMG/M |
| 3300034283|Ga0335007_0596295 | Not Available | 640 | Open in IMG/M |
| 3300034284|Ga0335013_0107193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1949 | Open in IMG/M |
| 3300034356|Ga0335048_0529358 | Not Available | 558 | Open in IMG/M |
| 3300034356|Ga0335048_0568804 | Not Available | 530 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.13% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.13% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.17% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.22% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.38% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.53% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.53% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.11% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.27% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.27% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.27% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.27% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.84% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.42% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.42% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.42% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021328 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R877 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024512 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1082526513 | 3300001213 | Wetland | VNIIEQIVTALLKWLTGLAKTPPIVEDAKPDKELKAKLLDRIDRSGG* |
| B570J29032_1089831264 | 3300002408 | Freshwater | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKK |
| B570J29032_1094767241 | 3300002408 | Freshwater | HHGQGRREEGMNVIEQIVTAILKWLTGLANTQPTAEDAKPDPELKQKLLDRIDKSGV* |
| B570J40625_10001154725 | 3300002835 | Freshwater | MNVIEQIVTALLKWFTGLAKTEPTAEDAKPDKELKQKLLDRIDRAGG* |
| B570J40625_10002304715 | 3300002835 | Freshwater | MNVIEQIVTAILKWLTGLANTQPTAEDAKPDPELKQKLLDRIDKSGV* |
| JGI25908J49247_100031274 | 3300003277 | Freshwater Lake | VNFIEQIVTALLKWLTSFVQTPPTVEDAKRDPDLKKKLLDRIAESDR* |
| JGI25908J49247_100936181 | 3300003277 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLDRIDKSGV* |
| JGI25922J50271_100400162 | 3300003413 | Freshwater Lake | VNVIEQIVTALLKWLTGLAKTEPTAEDAKQDPELKAKLLDRIDRAGK* |
| JGI25922J50271_100446502 | 3300003413 | Freshwater Lake | VNIVEQIITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG* |
| JGI25930J51415_10226202 | 3300003499 | Freshwater Lake | VNFIEQIVTALLKWLTSFVQKPPTVEDAKRDPNLKKKLLDRIAKSDR* |
| JGI25930J51415_10283382 | 3300003499 | Freshwater Lake | VNVIEQIITALLKWLTGLAKTPPTVEDAKQNPELKKKLLDRIDRAGG* |
| Ga0007763_113145834 | 3300004796 | Freshwater Lake | VSVIEQIITALLKWLTGLAKTEPTAEDAKPDKELKAKLLDRIDRAGK* |
| Ga0068877_105547852 | 3300005525 | Freshwater Lake | MNVVEQIVTAILKWLTGLAKTQPTAEDAKPDPELKAKLLDRIDRSGV* |
| Ga0068872_101376692 | 3300005528 | Freshwater Lake | VNIIEQIVTAVLKWLTGLAKTPPTVEDAKPDKELKEKLLDRIDRSGG* |
| Ga0049083_103366532 | 3300005580 | Freshwater Lentic | VNFIEQIVTALLKWLTSFVQTPPTVEDAKRDPDLKKKLLDRIADSNR* |
| Ga0049081_100383012 | 3300005581 | Freshwater Lentic | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAESNR* |
| Ga0049081_101308275 | 3300005581 | Freshwater Lentic | VNFIEQIVTALLKWLTSFVQKPPTVEDAKRDPDLKKKLLDRIA |
| Ga0049085_101567812 | 3300005583 | Freshwater Lentic | VNFIEQIVTALLKWLTGFVQKPPTVEDAKRDPDLKKKLLDRIADSNR* |
| Ga0079957_11906241 | 3300005805 | Lake | VNIIEQIVTALLKWLTGLAKTPSTVEDAKQDPELKKKLLDRIDRAGG* |
| Ga0079957_13288731 | 3300005805 | Lake | VNIIEQIVTALLKWLTGLAKTPPTVEDAKPDKDLKAKLLDRIDRSGG* |
| Ga0073922_10001541 | 3300005955 | Sand | VNIIEQIITALLKWLTGLAKTPPTAEDAKPDKELKAKLLDRIDRAGK* |
| Ga0075470_100001806 | 3300006030 | Aqueous | VNIIEQIVTALLKWLTGLAKTPPTVEDAKQDPELKKKLLDRIDRAGG* |
| Ga0075470_100553304 | 3300006030 | Aqueous | VNIIEQIVTALLKWLTGLAKTPPTVEDAKPDKELKAKLLDRIDRSGG* |
| Ga0075470_100770555 | 3300006030 | Aqueous | VNIIEQIVTAILKWLTGLAKTPPTVEDAKQDPELKKKLLDRIDRAGG* |
| Ga0070744_101298863 | 3300006484 | Estuarine | MNVIEQIVTAILKWLTGLAKTEPTAEDAKPDPELKQKLLDRIDKSGV* |
| Ga0070744_101325143 | 3300006484 | Estuarine | VNFIEQIVTALLKWLTGFVQTPPTVEDAKQDPDLKKKLLDRIAESDR* |
| Ga0075461_101541982 | 3300006637 | Aqueous | VNIIEQIVTALLKWLTSLAKTPPTVEDAKQDPELKKKLLDRIDRAGG* |
| Ga0079301_10130925 | 3300006639 | Deep Subsurface | VNIIEQIVTALLKWLTSLAKTPPTVEDAKPDKELKEKLLDRIDRSGG* |
| Ga0079301_10140036 | 3300006639 | Deep Subsurface | VNIIEQIVAAVLKWLTGLAKTPPTVEDARPDKELKAKLLDRINRSGG* |
| Ga0075471_100670185 | 3300006641 | Aqueous | VNIIEQIVTALLKWLTGLAKTPATVEDAKPDKELKAKLLDRIDRSGG* |
| Ga0070749_1001295710 | 3300006802 | Aqueous | VNIIEQIVTAVLKWLTGLAKTPPTVEDAKPDKELKAKLLDRIDRSGG* |
| Ga0070749_102226793 | 3300006802 | Aqueous | VNIIEQIVTALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG* |
| Ga0070749_102712421 | 3300006802 | Aqueous | IITALLKWLTGLAKTPPTAEDAKQNPELKAKLLDRIDRAGG* |
| Ga0070749_104035812 | 3300006802 | Aqueous | VNIIEQIVTAVLKWLTSLAKTPPTVEDAKPDKELKEKLLDRIDRAGG* |
| Ga0075464_106195162 | 3300006805 | Aqueous | VNFIEQIVTALLKWLTSFVQKPPTVEDSKRDPDLKKKLLDRIADSNR* |
| Ga0102976_11269085 | 3300007169 | Freshwater Lake | VNFIEQIITALLKWLTGLAKTPPTVEDAKPDQELRKKLLDRIDNAGK* |
| Ga0102978_118251114 | 3300007177 | Freshwater Lake | VNFIEQIVTALLKWLTGLAKTPPTVEDAKPDQELRKKLLDRIDNAGK* |
| Ga0075458_100245484 | 3300007363 | Aqueous | VNIIEQIVTALLKWLTGLAKTPPTVEDAKPDKELKAKLLDRIDRAGG* |
| Ga0102861_10001029 | 3300007544 | Estuarine | VNFIEQIVTALLKWLTSFVQKPPTVEDAKRDPDLKKKLLDRIAESDR* |
| Ga0102861_10030134 | 3300007544 | Estuarine | VNIIEQIVTALLKWLTGLAKTQPTVEDAKPDKELKAKLLDRINHAGR* |
| Ga0102861_10136223 | 3300007544 | Estuarine | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIADSNR* |
| Ga0102861_11132362 | 3300007544 | Estuarine | MNVIEQIVTAILKWLTGLTKTEPTAEDAKPDPDLKQKLLDRIDKSGV* |
| Ga0102861_11400662 | 3300007544 | Estuarine | VNIIEQIVTAILKWLTGLAKTESTAEDAKPDKELKQKLLDRIDRAGG* |
| Ga0102861_12134953 | 3300007544 | Estuarine | MNVIEQIVTAILKWLTGLAKTQSTSEDAKPDPELKQKLLDRIDKSGV* |
| Ga0102915_11299742 | 3300007562 | Estuarine | MNVIEQIVTAILKWLTGLAKTEPTAEDAKPDPDLKQKLLDRVDKSGL* |
| Ga0102917_12121941 | 3300007590 | Estuarine | QEAGMNVIEQIVTAILKWLTGLAKTEPTAEDAKPDPELKQKLLDCIDKSGV* |
| Ga0102865_10475454 | 3300007639 | Estuarine | VNFIEQIVTALLKWLTGFVQVPPTVEDAKRDPDLKKKLLDRIAESDR* |
| Ga0102862_11731892 | 3300007670 | Estuarine | MNVIEQIVTAILKWLTGLAKTQPTSEDAKPDPELKQKLLDRIDKSGV* |
| Ga0104988_1052226 | 3300007735 | Freshwater | VNIIEQIVTAVLKWLTGLAKTEPTVEDAKPDKELKAKLLDRIDRAGG* |
| Ga0105745_11372181 | 3300007972 | Estuary Water | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLDRVDKSGL* |
| Ga0105745_12029922 | 3300007972 | Estuary Water | MNVIEQIVTAILKWLTGLTKTEPTAEDAKPDPDLKQKLLDRINKSGV* |
| Ga0105746_11415824 | 3300007973 | Estuary Water | MNVIEQIVTAILKWLTGLTKTEPTAEDAKPDPDLKQKLLDRINKSGV |
| Ga0105746_11730613 | 3300007973 | Estuary Water | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDQDLKKKLLDRIADSNR* |
| Ga0105747_13552341 | 3300007974 | Estuary Water | VNFIEQIVTALLKWLTGFVQVPPTVEDAKRDPDLKKKLLDRIADSNR* |
| Ga0108970_102250094 | 3300008055 | Estuary | VNIIEQIVTALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRINHAGR* |
| Ga0108970_106958296 | 3300008055 | Estuary | VNIIEQIVTAVLKWLTGLAKTPPTVEDAKPDKELKEKLLDRIDRAGG* |
| Ga0108970_113229532 | 3300008055 | Estuary | VNIVEQIVTALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG* |
| Ga0114340_12398981 | 3300008107 | Freshwater, Plankton | VNIVEQIITALLKWLTGLAKTSPTAEDAKQDPELKAKLLDRIDRAGK* |
| Ga0114336_10092056 | 3300008261 | Freshwater, Plankton | VNIIEQIVTALLKWLTGLAKTPPTAEDAKQDPELKAKLLDRIDRAGG* |
| Ga0114336_11360842 | 3300008261 | Freshwater, Plankton | VNIIEQIITALLKWLTGLAKTPPTAEDAKQDPELKAKLLDRIDRAGK* |
| Ga0114336_13461512 | 3300008261 | Freshwater, Plankton | VNVIEQIIAALLKWLTGLAKTPPTAEDAKQDPELKAKLLDRIDRAGK* |
| Ga0114363_10145289 | 3300008266 | Freshwater, Plankton | VNIIEQIVTALLKWLTSLAKTPPTVEDAKPDKELKAKLLDRIDRAGG* |
| Ga0114363_10319525 | 3300008266 | Freshwater, Plankton | VNIIEQIVTALLKWLTGLAKTPPIVEDAKPDKELKEKLLDRIDRAGG* |
| Ga0114364_10458183 | 3300008267 | Freshwater, Plankton | VNIIEQIITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGK* |
| Ga0114364_10625226 | 3300008267 | Freshwater, Plankton | VNIIEQIITALLKWLTGLAKTPPTAEDAKQDPELKAKLLDRIDRAGG* |
| Ga0114876_100099537 | 3300008448 | Freshwater Lake | VNIIEQIVTALLKWLTGLAKTPPTVEDAKQDPELKKKLLDRIDRAGE* |
| Ga0114876_10348742 | 3300008448 | Freshwater Lake | VNIIEQIVTALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGK* |
| Ga0114876_10553162 | 3300008448 | Freshwater Lake | VNIIEQIVAAVLKWLTGLAKTPPTVEDAKPDKELKAKLLDRIDRAGG* |
| Ga0114876_12095332 | 3300008448 | Freshwater Lake | VNIIEQIVTALLKWLTGLAKTPPTVEDAKPDKELKAKLLDRINRSGG* |
| Ga0114880_10252404 | 3300008450 | Freshwater Lake | VNIIEQIVTALLKWLTGLAKTPPTAEDAKPDKELKAKLLDRIDRAGG* |
| Ga0102831_10305393 | 3300008996 | Estuarine | VNIIEQIVTALLKWLTGLAKTPPTAEDAKPDTELKQKLLDRIDRSGG* |
| Ga0102831_10578691 | 3300008996 | Estuarine | KEVRVNIVEQIITALLKWLTGLAKTPPTAEDAKPDKELKAKLLDRIDRAGG* |
| Ga0102816_10351242 | 3300008999 | Estuarine | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAESDR* |
| Ga0102829_100457510 | 3300009026 | Estuarine | VNFIEQIITALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAKSN |
| Ga0102829_10057755 | 3300009026 | Estuarine | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAKSNR* |
| Ga0105152_100604394 | 3300009039 | Lake Sediment | MNVVEQIVTAILKWLTGLAKTEPTAEDAKPDPELKQKLLDRVDKSGL* |
| Ga0105152_103155733 | 3300009039 | Lake Sediment | VNFIEQIVVALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAESDR* |
| Ga0102830_11709241 | 3300009059 | Estuarine | VNIVEQIITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGK* |
| Ga0114973_100029339 | 3300009068 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPDLKQKLLDRIDKSGV* |
| Ga0114980_1001060710 | 3300009152 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQTSPTVEDAKRDPDLKKKLLDRIADSNR* |
| Ga0114980_106540132 | 3300009152 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLDRIDKSGI* |
| Ga0114968_1000965011 | 3300009155 | Freshwater Lake | VNFIEQIVTALLKWLTGFIQTPPTIEDAKSDPDLKKKLLDRIAESDR* |
| Ga0114968_103204022 | 3300009155 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKSDPDLKQKLLDRIDKSGV* |
| Ga0114977_102085972 | 3300009158 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTEPTAEDAKPDPDLKQKLLDRIDKSGV* |
| Ga0114978_1000270726 | 3300009159 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQKPPTVEDAKRDPDLKKKLLDRIAESNR* |
| Ga0114978_105183961 | 3300009159 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKSDPKLKQKLLDRIDKSGV* |
| Ga0114966_102908531 | 3300009161 | Freshwater Lake | QIVTAILKWLTGLAKTEPTAEDAKPDPDLKQKLLDRIDKSGI* |
| Ga0114966_103028971 | 3300009161 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTEPTAEDAKPDPDLKQKLLDRIDKSGI* |
| Ga0114975_100767644 | 3300009164 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQTPPTIEDAKRDPDLKKKLLDRIADSNR* |
| Ga0114979_107782491 | 3300009180 | Freshwater Lake | VNFIEQIVTALLKWLTSFVQKSPTVEDAKRDPDLKKKLLDRIAESDR* |
| Ga0114969_105740761 | 3300009181 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKIQPTAEDAKPDPDLKQKLLDRIDKSGV* |
| Ga0114974_103059522 | 3300009183 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTELTAEDAKSDPKLKQKLLDRIDKSGI* |
| Ga0129333_1000443018 | 3300010354 | Freshwater To Marine Saline Gradient | VNIIEQIVTALLKWLTGLAKTPPTVEDAKQDKELKAKLLDRIDRAGG* |
| Ga0129333_108973672 | 3300010354 | Freshwater To Marine Saline Gradient | VNIIEQIVTALLKWLTSLSKTPPTVEDAKQDPELKKKLLDRIDRAGG* |
| Ga0129333_116504892 | 3300010354 | Freshwater To Marine Saline Gradient | VNIIEQIVTALLKWLTGLAKTHPTVEDAKQDPELKKKLLDRIDRAGG* |
| Ga0133913_114125496 | 3300010885 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQ |
| Ga0133913_119581092 | 3300010885 | Freshwater Lake | VNIVEQIVTALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGK* |
| Ga0139557_10540881 | 3300011010 | Freshwater | VNFIEQIVTALLKWLTGFVQKPPTVEDAKRDPDLKKKLLDRIAES |
| Ga0151515_1017735 | 3300011114 | Freshwater | VNFIEQIVTALLKWLTSFVQTPPTVEDAKRDPDLKKKLLDRIAKSDR* |
| Ga0151516_1093118 | 3300011116 | Freshwater | VNVIEQIVTALLKWLTGLAKTEPTVEDAKPDKELKQKLLDRIDRSGG* |
| Ga0151620_11401831 | 3300011268 | Freshwater | MNVIEQIVSAILKWLVWLAKTPYTAEDAKPDPELKK |
| Ga0153698_133224 | 3300011335 | Freshwater | VNFIEQIVTALLKWLTSFVQKPPTVEDAKRDPELKKKLLDCIAKSDR* |
| Ga0153800_10106631 | 3300011995 | Freshwater | QKARVNFIEQIVTALLKWLTSFVQKPPTVEDAKRDPDLKKKLLDRIAESDR* |
| Ga0164293_101234503 | 3300013004 | Freshwater | VNFIEQIVAALLKWLTSFVQKPPTVEDAKRDPDLKKKLLDRIADSNR* |
| Ga0164293_103746473 | 3300013004 | Freshwater | EQVITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG* |
| Ga0164293_108552661 | 3300013004 | Freshwater | VNIIEQVITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDR |
| Ga0177922_106286754 | 3300013372 | Freshwater | VNLIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIADSN |
| Ga0177922_111663912 | 3300013372 | Freshwater | MNVIEQIVTAILKWLTGLAKTEPTAEDAKPDPELKQKLLDRIDKSGI* |
| Ga0181338_10566221 | 3300015050 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLD |
| Ga0181363_10090112 | 3300017707 | Freshwater Lake | VNFIEQIVTALLKWLTNFVQKPPTVEDAKRDPNLKKKLLDRIAKSDR |
| Ga0181363_10401531 | 3300017707 | Freshwater Lake | VNIVEQIITALLKWLTGLAKTPQTAEDAKPDKELKAKLLDRIDRAFSFS |
| Ga0181350_10543151 | 3300017716 | Freshwater Lake | EQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAESDR |
| Ga0181365_10717613 | 3300017736 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQTPPTVEDAKSDPDLKKKLLDRIADSNR |
| Ga0181365_11222663 | 3300017736 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPNLKKKLLDRIADSNR |
| Ga0181365_11401901 | 3300017736 | Freshwater Lake | VNFIEQIVTALLKWLTSFVQTPPTVEDSKRDPDLKKKLLDRIA |
| Ga0181352_10566831 | 3300017747 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQKPPTVEDSKRDPDLKKKLLDRIADSNR |
| Ga0181352_11594691 | 3300017747 | Freshwater Lake | VNVIEQIVTALLKWLTGLAKTEPTSEDAKQDPELKAKLLDRIDRAGK |
| Ga0181344_10031063 | 3300017754 | Freshwater Lake | MSVIEQIVTAILKWLTGLAKTEPTSEDAKPDPELKQKLLDRIDRSGV |
| Ga0181344_10184975 | 3300017754 | Freshwater Lake | VNVIEQIVTALLKWLTGLAKTEPTAEDAKPDKELKQKLLDRIDRAGG |
| Ga0181344_10913114 | 3300017754 | Freshwater Lake | VNVIEQIITALLKWLTGLAKTPPTVEDAKQDPELKKKLLDRIDRAGG |
| Ga0181344_10990301 | 3300017754 | Freshwater Lake | VNIIEQIVTAILKWLTGLAKTPPTVEDAKQDPELKAKLLDRIDRAGG |
| Ga0181344_11853852 | 3300017754 | Freshwater Lake | VNVIEQIVTALLKWLTGLAKTPPTAEDAKQDPELKAKLLDRIDRAGK |
| Ga0181357_10271881 | 3300017777 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQK |
| Ga0181357_11906154 | 3300017777 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQTPPTVEDAKSDPDLKKKLLDRIAESDR |
| Ga0181357_13037692 | 3300017777 | Freshwater Lake | MNVIEQIVTAILKWLTGLANTQPTAEDAKPDPELKQKLLDRIDKSGI |
| Ga0181348_10236304 | 3300017784 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQKPPTVEDAKRDPDLKKKLLDRITESGR |
| Ga0181355_11066655 | 3300017785 | Freshwater Lake | VNIIEQIITALLKWLTGLAKTPPTVEDAKQDPELKKKLLDRIDRAGK |
| Ga0181359_10240455 | 3300019784 | Freshwater Lake | VNFIEQIVTALLKWLTGLAKTPPTVEDAKSDPDLKKKLLDRIAESDR |
| Ga0181359_10298856 | 3300019784 | Freshwater Lake | VNIVEQIITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG |
| Ga0181359_11436062 | 3300019784 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKEKLLDRIDKSGV |
| Ga0181359_12278862 | 3300019784 | Freshwater Lake | VNFIEQIVTALLKWLTSFVQTPPTVEDAKRDPDLKKKLLDRIAESDR |
| Ga0211729_110048203 | 3300020172 | Freshwater | MNVVEQIVTAILKWLTGLAKTEPTAEDAKPDPELKQKLLDRVDKSGL |
| Ga0211729_112670651 | 3300020172 | Freshwater | RVNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIADSNR |
| Ga0211729_113704631 | 3300020172 | Freshwater | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAKSNR |
| Ga0194119_108021032 | 3300020220 | Freshwater Lake | VNFIEQIVTALLKWLTGLAKTPSTIEDAKPDAELKAKLLDRIDRSGK |
| Ga0208234_10108614 | 3300020515 | Freshwater | MNVIEQIVTALLKWFTGLAKTEPTAEDAKPDKELKQKLLDRIDRAGG |
| Ga0208855_10109512 | 3300020553 | Freshwater | MNVIEQIVTAILKWLTGLANTQPTAEDAKPDPELKQKLLDRIDKSGV |
| Ga0210306_11094112 | 3300021312 | Estuarine | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAKSDR |
| Ga0210298_10223031 | 3300021328 | Estuarine | VNFIEQIVAALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIADSNR |
| Ga0213921_10654262 | 3300021952 | Freshwater | VNIIEQIVTALLKWMTGLAKTPPTVEDAKQDPELKKKLLDRIDRAGG |
| Ga0213922_11184902 | 3300021956 | Freshwater | VNIIEQIVTALLKWLTGLAKTPPTVEDAKPDKELKAKLLDRIDRSGG |
| Ga0222714_100112268 | 3300021961 | Estuarine Water | VNIIEQIVTALLKWLTGLAKNPPTVEDAKPDKELKAKLLDRIDRAGG |
| Ga0222713_101845692 | 3300021962 | Estuarine Water | VNIIEQIVTALLKWLTGLAKTQPTVEDAKQDPELKKKLLDRIDRAGG |
| Ga0222713_108183551 | 3300021962 | Estuarine Water | VNIIEQIVTAVLKWLTGLAKTPPIVEDAKPDKELKEKLLDRIDRSGG |
| Ga0222713_108476351 | 3300021962 | Estuarine Water | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLDRVDKSGL |
| Ga0222712_102063453 | 3300021963 | Estuarine Water | VNFIEQIVTALLKWLTGLAKTPPNVEDAKPDKELKAKLLDRIDRAGG |
| Ga0222712_105155791 | 3300021963 | Estuarine Water | VNIIEQIVTALLKWLTGLAKTSPTAEDAKPDKELKQKLLDRIDRANK |
| Ga0181353_10354582 | 3300022179 | Freshwater Lake | VNFIEQIVTALLKWLTSFVQKPPTVEDAKRDPNLKKKLLDRIAKSDR |
| Ga0181353_10540265 | 3300022179 | Freshwater Lake | VNVIEQIVTALLKWLTGLAKTEPTAEDAKQDPELKAKLLDRIDRAGK |
| Ga0181353_11265863 | 3300022179 | Freshwater Lake | VNFIEQIVTALLKWLTNFVQKPPTVEDAKRDPDLKKKLLDRIAESDR |
| Ga0244775_1001948813 | 3300024346 | Estuarine | MNVIEQIVSAILKWLVWLAKTPYIAEDAKPDPELKKK |
| Ga0244775_100775524 | 3300024346 | Estuarine | VNFIEQIVTALLKWLTGFVQTPPTVEDAKQDPDLKKKLLDRIAESDR |
| Ga0244775_111799751 | 3300024346 | Estuarine | VTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIADSNR |
| Ga0244776_101609006 | 3300024348 | Estuarine | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLDRVDKSGV |
| Ga0255185_10324222 | 3300024490 | Freshwater | VNIIEQIITALLKWLTGLAKTPPTAEDAKPDKELKAKLLDRIDRAGK |
| Ga0255186_10384822 | 3300024512 | Freshwater | QIITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG |
| Ga0208424_10201132 | 3300025445 | Aqueous | VNIIEQIVTAILKWLTGLAKTPPTVEDAKQDPELKKKLLDRIDRAGG |
| Ga0208147_10053734 | 3300025635 | Aqueous | VNIIEQIVTALLKWLTNLAKTPPTVEDAKQDPELKKKLLDRIDRAGG |
| Ga0208147_10251434 | 3300025635 | Aqueous | VNIIEQIVTALLKWLTGLAKTPPTVEDAKPDKELKAKLLDRIDRAGG |
| Ga0208005_11757391 | 3300025848 | Aqueous | VNIIEQIVTAILKWLTGLAKTPPTVEDAKQDPELKK |
| Ga0208783_101442425 | 3300025872 | Aqueous | VNIIEQIVTALLKWLTGLAKTPATVEDAKPDKELKAKLLDRIDRSGG |
| Ga0208644_12796082 | 3300025889 | Aqueous | VNIIEQIVTALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG |
| Ga0208800_10245685 | 3300027193 | Estuarine | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIA |
| Ga0208926_100014013 | 3300027205 | Estuarine | VNFIEQIVTALLKWLTSFVQKPPTVEDAKRDPDLKKKLLDRIAESDR |
| Ga0208926_10002232 | 3300027205 | Estuarine | VNIIEQIVTALLKWLTGLAKTQPTVEDAKPDKELKAKLLDRINHAGR |
| Ga0208555_10135702 | 3300027213 | Estuarine | MNVIEQIVTAILKWLTGLAKTQSTSEDAKPDPELKQKLLDRIDKSGV |
| Ga0208923_10053777 | 3300027320 | Estuarine | VNFIEQIITALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAKSNR |
| Ga0208788_10200286 | 3300027499 | Deep Subsurface | VNIIEQIVAAVLKWLTGLAKTPPTVEDARPDKELKAKLLDRINRSGG |
| Ga0208133_10879561 | 3300027631 | Estuarine | IVTALLKWLTGFVQTPPTVEDAKQDPDLKKKLLDRIAESDR |
| Ga0208975_10072446 | 3300027659 | Freshwater Lentic | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAESNR |
| (restricted) Ga0247836_10134222 | 3300027728 | Freshwater | MNIIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLDRIDKSGL |
| Ga0209596_100125516 | 3300027754 | Freshwater Lake | VNFIEQIVTALLKWLTGFIQTPPTIEDAKSDPDLKKKLLDRIAESDR |
| Ga0209296_100112617 | 3300027759 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQTPPTIEDAKRDPDLKKKLLDRIADSNR |
| Ga0209296_10238955 | 3300027759 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTEPTAEDAKPDPDLKQKLLDRIDKSGI |
| Ga0209598_1000502213 | 3300027760 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPDLKQKLLDRIDKSGV |
| Ga0209088_1000082614 | 3300027763 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLDRIDKSGI |
| Ga0209086_101246522 | 3300027770 | Freshwater Lake | MNVIEQIVTAILKWLTGLAKTQPTAEDAKSDPDLKQKLLDRIDKSGV |
| Ga0209500_100020824 | 3300027782 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQKPPTVEDAKRDPDLKKKLLDRIAESNR |
| Ga0209972_102708892 | 3300027793 | Freshwater Lake | VNIIEQIVTAVLKWLTGLAKTPPTVEDAKPDKELKEKLLDRIDRSGG |
| Ga0209358_102899885 | 3300027804 | Freshwater Lake | VSVIEQIITALLKWLTGLAKTEPTAEDAKPDKELKAKLLDRIDRAGK |
| Ga0209985_103665862 | 3300027806 | Freshwater Lake | MNVVEQIVTAILKWLTGLAKTQPTAEDAKPDPELKAKLLDRIDRSGV |
| Ga0209298_100099166 | 3300027973 | Freshwater Lake | VNFIEQIVTALLKWLTGFVQTSPTVEDAKRDPDLKKKLLDRIADSNR |
| Ga0238435_1117511 | 3300029349 | Freshwater | VNVIEQIVTALLKWLTGLAKTEPTAEDAKPDKELKQKLLDRIDRAGR |
| Ga0315288_104629563 | 3300031772 | Sediment | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKEKLLDRIAKSDR |
| Ga0315900_102667863 | 3300031787 | Freshwater | VNIIEQIITALLKWLTGLAKTPPTAEDAKQDPELKAKLLDRIDRAGG |
| Ga0315900_104252192 | 3300031787 | Freshwater | VNIVEQIITALLKWLTGLAKTSPTAEDAKQDPELKAKLLDRIDRAGK |
| Ga0315900_107310242 | 3300031787 | Freshwater | VNIIEQIVTALLKWLTGLAKTPPTVEDAKQDPELKKKLLDRIDRAGE |
| Ga0315909_100221398 | 3300031857 | Freshwater | VNIIEQIVAAVLKWLTGLAKTPPTVEDAKPDKELKAKLLDRIDRAGG |
| Ga0315909_104917605 | 3300031857 | Freshwater | VNIIEQIITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG |
| Ga0315285_101061846 | 3300031885 | Sediment | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLDR |
| Ga0315285_103833772 | 3300031885 | Sediment | VNFIEQIVAALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAKSNR |
| Ga0315285_109065172 | 3300031885 | Sediment | MNVVEQIVTAILKWLTGLAKTQPTSEDAKPDSELKQKLLDRVDKSGV |
| Ga0315904_101397103 | 3300031951 | Freshwater | VNIIEQIVTALLKWLTSLAKTPPTVEDAKPDKELKAKLLDRIDRAGG |
| Ga0315904_105628501 | 3300031951 | Freshwater | EQIVTAVLKWLTGLAKTPPTVEDAKPDKELKEKLLDRIDRAGG |
| Ga0315904_112324501 | 3300031951 | Freshwater | VNIIEQIVTALLKWLTGLAKTPPTVEDAKQDPELKKKLLDR |
| Ga0315294_102280334 | 3300031952 | Sediment | QKARVNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIADSNR |
| Ga0315901_112198111 | 3300031963 | Freshwater | VNVIEQIIAALLKWLTGLAKTPPTAEDAKQDPELKAKLLDRIDRAGK |
| Ga0315289_108117364 | 3300032046 | Sediment | VNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAESDR |
| Ga0315284_115886972 | 3300032053 | Sediment | VNFIEQIVTALLKWLTGFVQTPPAVEDAKRDPDLKKKLLDRIADSNR |
| Ga0315902_110950431 | 3300032093 | Freshwater | VNIIEQIVTALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGK |
| Ga0315903_105404002 | 3300032116 | Freshwater | VNIIEQIVTALLKWLTGLAKTPPTVEDAKPDKELKAKLLDRINRSGG |
| Ga0315276_102634934 | 3300032177 | Sediment | IVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAESDR |
| Ga0315271_108090804 | 3300032256 | Sediment | VNFIEQIVTALLKWLTSFVQTPPTVEDAKRDPDLKKKLLDRIAKSDR |
| Ga0315275_106371842 | 3300032401 | Sediment | VNFIEQIVTALLKWLTGFVQKPPTVEDAKRDPDLKKKLLDRIAKSNR |
| Ga0334722_100609162 | 3300033233 | Sediment | MNIIEQIVTAILKWLTGLAKTEPTAEDAKPDPDLKQKLLDRINKSGV |
| Ga0334982_0010357_3800_3943 | 3300033981 | Freshwater | VNIIEQIITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGK |
| Ga0334982_0341888_486_629 | 3300033981 | Freshwater | VNIIEQIITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDKSGV |
| Ga0334992_0003338_11443_11586 | 3300033992 | Freshwater | VNVIEQIITALLKWLTGLAKTHPTAEDAKPDPELKQKLLDRIDKSGI |
| Ga0334994_0005050_8617_8760 | 3300033993 | Freshwater | VNVIEQIITALLKWLTGLAKTQPTAEDAKPDPELKQKLLDRIDKSGI |
| Ga0334994_0092373_1228_1371 | 3300033993 | Freshwater | VNIVEQVITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG |
| Ga0334994_0262809_761_895 | 3300033993 | Freshwater | MNVIEQIVTAILKWLTGLAKTQSTSEDAKPDPELKQKLLDRIDKS |
| Ga0334994_0411830_440_583 | 3300033993 | Freshwater | VNIIEQIVTAVLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG |
| Ga0335003_0127668_1098_1241 | 3300033995 | Freshwater | VNFTEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIADSNR |
| Ga0334979_0173306_686_829 | 3300033996 | Freshwater | VNIIEQVITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGG |
| Ga0334991_0047420_1714_1857 | 3300034013 | Freshwater | VNFIEQIVAALLKWLTGFVQKPPTVEDAKRDPDLKKKLLDRIADSNR |
| Ga0335004_0001933_8676_8819 | 3300034021 | Freshwater | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLDRIDRSGI |
| Ga0334987_0003209_14465_14608 | 3300034061 | Freshwater | VNVIEQIVTALLKWLTGLAKTPPTAEDAKPDKELKEKLLDRIDRAGG |
| Ga0334987_0095987_1821_1964 | 3300034061 | Freshwater | VNVIEQIITALLKWLTGLAKTQPTAEDAKPDPELKQKLLDRIDKSGV |
| Ga0334987_0278688_982_1119 | 3300034061 | Freshwater | VNIVEQIITALLKWLTGLAKTPPTAEDAKPDKELKEKLLDRIDRAG |
| Ga0334995_0139347_22_165 | 3300034062 | Freshwater | MNVIEQIVTAILKWLTGLAKTQPTAEDAKPDPELKQKLLDRIDRAGG |
| Ga0335000_0098790_1284_1427 | 3300034063 | Freshwater | VNIIEQVITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRADG |
| Ga0335019_0659220_143_286 | 3300034066 | Freshwater | VNFIEQIVAALLKWLTSFVQKPPTVEDAKRDPDLKKKLLDRIADSNR |
| Ga0310130_0017374_1341_1484 | 3300034073 | Fracking Water | VNIIEQIVAALLKWLTGLAKTPPTVEDAKPDKELKEKLLDRIDRAGG |
| Ga0335027_0001462_772_915 | 3300034101 | Freshwater | VNVIEQIITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGK |
| Ga0335027_0079207_710_853 | 3300034101 | Freshwater | VNIIEQVITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRIDRAGK |
| Ga0335029_0386098_93_236 | 3300034102 | Freshwater | MNFIEQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIADSNR |
| Ga0335031_0018676_4243_4383 | 3300034104 | Freshwater | VNIIEQIVTALLKWLTGLAKTPPTVEDAKPDKELKEKLLDRIDRIG |
| Ga0335031_0569835_450_593 | 3300034104 | Freshwater | MNVIEQIVTAILKWLTGLAKTEPTAEDAKPDPELKQKLLDRIDKSGI |
| Ga0335031_0673577_399_542 | 3300034104 | Freshwater | VNFIEQIVTALLKWLTGFVQTPPTVEDSKQDPDLKKKLLDRIADSNR |
| Ga0335066_0173083_565_708 | 3300034112 | Freshwater | VNIVEQIITALLKWLTGLAKTPPTAEDAKPDKELKQKLLDRINRAGG |
| Ga0335068_0004474_7321_7464 | 3300034116 | Freshwater | VNIVEQIITALLKWLTGLAKTEPTAEDAKQDSELKAKLLDRIDRAGG |
| Ga0335017_0281802_739_882 | 3300034167 | Freshwater | VNFIEQIVTALLKWLTSFVQKPPTVEDAKRDPELKKKLLDRIADSNR |
| Ga0335052_0426117_543_701 | 3300034279 | Freshwater | RQETKVNVIEQIITALLKWLTGLAKTHPTAEDAKPDPELKQKLLDRIDKSGI |
| Ga0335007_0596295_164_307 | 3300034283 | Freshwater | VNFIEQIITALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAESDR |
| Ga0335013_0107193_1444_1587 | 3300034284 | Freshwater | VNIVEQVITALLKWLTGLAKTPPTAEDAKPDKELKAKLLDRIDRAGG |
| Ga0335048_0529358_1_132 | 3300034356 | Freshwater | EQIVTALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIADSNR |
| Ga0335048_0568804_411_530 | 3300034356 | Freshwater | TALLKWLTGFVQTPPTVEDAKRDPDLKKKLLDRIAESDR |
| ⦗Top⦘ |