


| Basic Information | |
|---|---|
| Family ID | F017858 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 238 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MYYNVFGEKVSRRRYKEMCEAAKNRRELIAAGLTSRRDLMKMGL |
| Number of Associated Samples | 182 |
| Number of Associated Scaffolds | 238 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 97.90 % |
| % of genes near scaffold ends (potentially truncated) | 98.74 % |
| % of genes from short scaffolds (< 2000 bps) | 89.92 % |
| Associated GOLD sequencing projects | 170 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.622 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.227 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.933 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.664 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 5.56% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 238 Family Scaffolds |
|---|---|---|
| PF12833 | HTH_18 | 28.57 |
| PF00196 | GerE | 2.52 |
| PF00578 | AhpC-TSA | 1.26 |
| PF03544 | TonB_C | 0.84 |
| PF00999 | Na_H_Exchanger | 0.84 |
| PF00719 | Pyrophosphatase | 0.42 |
| PF01063 | Aminotran_4 | 0.42 |
| PF00873 | ACR_tran | 0.42 |
| PF01614 | IclR | 0.42 |
| PF03795 | YCII | 0.42 |
| PF13426 | PAS_9 | 0.42 |
| PF00583 | Acetyltransf_1 | 0.42 |
| PF08281 | Sigma70_r4_2 | 0.42 |
| PF02744 | GalP_UDP_tr_C | 0.42 |
| PF13412 | HTH_24 | 0.42 |
| PF02239 | Cytochrom_D1 | 0.42 |
| PF13483 | Lactamase_B_3 | 0.42 |
| PF04542 | Sigma70_r2 | 0.42 |
| PF00908 | dTDP_sugar_isom | 0.42 |
| PF04972 | BON | 0.42 |
| PF00266 | Aminotran_5 | 0.42 |
| PF13189 | Cytidylate_kin2 | 0.42 |
| PF12728 | HTH_17 | 0.42 |
| PF06537 | DHOR | 0.42 |
| PF13431 | TPR_17 | 0.42 |
| PF00339 | Arrestin_N | 0.42 |
| PF00403 | HMA | 0.42 |
| PF01565 | FAD_binding_4 | 0.42 |
| PF00749 | tRNA-synt_1c | 0.42 |
| PF00144 | Beta-lactamase | 0.42 |
| PF02683 | DsbD | 0.42 |
| PF02776 | TPP_enzyme_N | 0.42 |
| PF08534 | Redoxin | 0.42 |
| PF00692 | dUTPase | 0.42 |
| PF01022 | HTH_5 | 0.42 |
| PF07719 | TPR_2 | 0.42 |
| PF13520 | AA_permease_2 | 0.42 |
| PF01625 | PMSR | 0.42 |
| PF13487 | HD_5 | 0.42 |
| PF00165 | HTH_AraC | 0.42 |
| PF10056 | DUF2293 | 0.42 |
| PF00817 | IMS | 0.42 |
| PF05816 | TelA | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 238 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.84 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 0.84 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.84 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.84 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.84 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.84 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.42 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.42 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.42 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.42 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.42 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.42 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.42 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.42 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.42 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.42 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.42 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.42 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.42 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.42 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.42 |
| COG3853 | Uncharacterized conserved protein YaaN involved in tellurite resistance | Defense mechanisms [V] | 0.42 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.62 % |
| All Organisms | root | All Organisms | 45.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y02JE7NA | Not Available | 514 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10113385 | Not Available | 664 | Open in IMG/M |
| 3300000650|AP72_2010_repI_A1DRAFT_1018706 | Not Available | 590 | Open in IMG/M |
| 3300000953|JGI11615J12901_10797468 | Not Available | 605 | Open in IMG/M |
| 3300001471|JGI12712J15308_10015183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2047 | Open in IMG/M |
| 3300001471|JGI12712J15308_10050009 | Not Available | 1062 | Open in IMG/M |
| 3300001546|JGI12659J15293_10018679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1846 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100180226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1999 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100635578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 945 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101404461 | Not Available | 591 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101478393 | Not Available | 574 | Open in IMG/M |
| 3300002568|C688J35102_117701183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300002568|C688J35102_118131560 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
| 3300002568|C688J35102_118991594 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300002914|JGI25617J43924_10015881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2546 | Open in IMG/M |
| 3300002914|JGI25617J43924_10292012 | Not Available | 560 | Open in IMG/M |
| 3300004479|Ga0062595_102101465 | Not Available | 549 | Open in IMG/M |
| 3300005093|Ga0062594_101233135 | Not Available | 744 | Open in IMG/M |
| 3300005167|Ga0066672_10133049 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300005168|Ga0066809_10101478 | Not Available | 704 | Open in IMG/M |
| 3300005177|Ga0066690_10258214 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1170 | Open in IMG/M |
| 3300005180|Ga0066685_10417318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 932 | Open in IMG/M |
| 3300005290|Ga0065712_10272775 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005328|Ga0070676_10979019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300005332|Ga0066388_105790966 | Not Available | 625 | Open in IMG/M |
| 3300005332|Ga0066388_107779705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. 99 | 537 | Open in IMG/M |
| 3300005332|Ga0066388_107808730 | Not Available | 536 | Open in IMG/M |
| 3300005343|Ga0070687_100062929 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300005345|Ga0070692_10026636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2860 | Open in IMG/M |
| 3300005366|Ga0070659_101608871 | Not Available | 580 | Open in IMG/M |
| 3300005435|Ga0070714_100062624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3197 | Open in IMG/M |
| 3300005457|Ga0070662_101285656 | Not Available | 629 | Open in IMG/M |
| 3300005518|Ga0070699_100842665 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005541|Ga0070733_10023002 | All Organisms → cellular organisms → Bacteria | 3883 | Open in IMG/M |
| 3300005542|Ga0070732_10008769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5519 | Open in IMG/M |
| 3300005542|Ga0070732_10235985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300005544|Ga0070686_101396847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300005560|Ga0066670_10215101 | Not Available | 1158 | Open in IMG/M |
| 3300005586|Ga0066691_10005047 | All Organisms → cellular organisms → Bacteria | 5737 | Open in IMG/M |
| 3300005586|Ga0066691_10170175 | Not Available | 1259 | Open in IMG/M |
| 3300005591|Ga0070761_10446509 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005764|Ga0066903_103066844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300005764|Ga0066903_104325074 | Not Available | 759 | Open in IMG/M |
| 3300005764|Ga0066903_106365019 | Not Available | 616 | Open in IMG/M |
| 3300005937|Ga0081455_10796998 | Not Available | 593 | Open in IMG/M |
| 3300005944|Ga0066788_10157168 | Not Available | 580 | Open in IMG/M |
| 3300006028|Ga0070717_11745404 | Not Available | 563 | Open in IMG/M |
| 3300006041|Ga0075023_100441192 | Not Available | 573 | Open in IMG/M |
| 3300006046|Ga0066652_100305005 | Not Available | 1416 | Open in IMG/M |
| 3300006176|Ga0070765_101062676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 765 | Open in IMG/M |
| 3300006854|Ga0075425_103138344 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006914|Ga0075436_100030437 | All Organisms → cellular organisms → Bacteria | 3716 | Open in IMG/M |
| 3300006954|Ga0079219_10481664 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300006954|Ga0079219_10994173 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300006954|Ga0079219_11559842 | Not Available | 602 | Open in IMG/M |
| 3300007788|Ga0099795_10031547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1826 | Open in IMG/M |
| 3300009038|Ga0099829_10729543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300009038|Ga0099829_10736790 | Not Available | 819 | Open in IMG/M |
| 3300009088|Ga0099830_10566479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8 | 930 | Open in IMG/M |
| 3300009089|Ga0099828_10960751 | Not Available | 762 | Open in IMG/M |
| 3300009090|Ga0099827_10269079 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300009174|Ga0105241_11607931 | Not Available | 629 | Open in IMG/M |
| 3300009553|Ga0105249_10547527 | Not Available | 1207 | Open in IMG/M |
| 3300009651|Ga0105859_1184835 | Not Available | 606 | Open in IMG/M |
| 3300010042|Ga0126314_10599618 | Not Available | 804 | Open in IMG/M |
| 3300010046|Ga0126384_10448146 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300010046|Ga0126384_11368922 | Not Available | 659 | Open in IMG/M |
| 3300010048|Ga0126373_10042159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4020 | Open in IMG/M |
| 3300010048|Ga0126373_11470425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300010048|Ga0126373_12804802 | Not Available | 544 | Open in IMG/M |
| 3300010159|Ga0099796_10230980 | Not Available | 762 | Open in IMG/M |
| 3300010301|Ga0134070_10393636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300010358|Ga0126370_10798310 | Not Available | 841 | Open in IMG/M |
| 3300010359|Ga0126376_11626245 | Not Available | 679 | Open in IMG/M |
| 3300010360|Ga0126372_10475709 | Not Available | 1165 | Open in IMG/M |
| 3300010360|Ga0126372_11887889 | Not Available | 642 | Open in IMG/M |
| 3300010361|Ga0126378_10030996 | All Organisms → cellular organisms → Bacteria | 4786 | Open in IMG/M |
| 3300010361|Ga0126378_10071692 | All Organisms → cellular organisms → Bacteria | 3321 | Open in IMG/M |
| 3300010361|Ga0126378_12346354 | Not Available | 609 | Open in IMG/M |
| 3300010362|Ga0126377_11715889 | Not Available | 703 | Open in IMG/M |
| 3300010366|Ga0126379_10180269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2008 | Open in IMG/M |
| 3300010366|Ga0126379_10509869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1276 | Open in IMG/M |
| 3300010366|Ga0126379_11895246 | Not Available | 699 | Open in IMG/M |
| 3300010366|Ga0126379_12171380 | Not Available | 656 | Open in IMG/M |
| 3300010366|Ga0126379_12950449 | Not Available | 569 | Open in IMG/M |
| 3300010371|Ga0134125_10866808 | Not Available | 992 | Open in IMG/M |
| 3300010375|Ga0105239_12438004 | Not Available | 609 | Open in IMG/M |
| 3300010376|Ga0126381_100362699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2007 | Open in IMG/M |
| 3300010376|Ga0126381_100602713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1563 | Open in IMG/M |
| 3300010376|Ga0126381_100677893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1473 | Open in IMG/M |
| 3300010376|Ga0126381_104516173 | Not Available | 537 | Open in IMG/M |
| 3300010396|Ga0134126_10148155 | All Organisms → cellular organisms → Bacteria | 2845 | Open in IMG/M |
| 3300010398|Ga0126383_13120985 | Not Available | 541 | Open in IMG/M |
| 3300010398|Ga0126383_13463464 | Not Available | 515 | Open in IMG/M |
| 3300010401|Ga0134121_10593502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300011119|Ga0105246_11617055 | Not Available | 613 | Open in IMG/M |
| 3300011120|Ga0150983_13209977 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300011271|Ga0137393_10062021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2955 | Open in IMG/M |
| 3300011271|Ga0137393_10764414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 826 | Open in IMG/M |
| 3300012189|Ga0137388_10903897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 816 | Open in IMG/M |
| 3300012199|Ga0137383_11009306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300012201|Ga0137365_11207452 | Not Available | 540 | Open in IMG/M |
| 3300012202|Ga0137363_10581057 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300012202|Ga0137363_10829658 | Not Available | 784 | Open in IMG/M |
| 3300012206|Ga0137380_10730757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 858 | Open in IMG/M |
| 3300012209|Ga0137379_11805105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300012349|Ga0137387_10033447 | All Organisms → cellular organisms → Bacteria | 3336 | Open in IMG/M |
| 3300012354|Ga0137366_10215184 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300012357|Ga0137384_10398819 | Not Available | 1136 | Open in IMG/M |
| 3300012357|Ga0137384_11500139 | Not Available | 523 | Open in IMG/M |
| 3300012361|Ga0137360_10396358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1163 | Open in IMG/M |
| 3300012361|Ga0137360_10615395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16 | 930 | Open in IMG/M |
| 3300012361|Ga0137360_10641559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16 | 910 | Open in IMG/M |
| 3300012362|Ga0137361_10881684 | Not Available | 812 | Open in IMG/M |
| 3300012363|Ga0137390_11349922 | Not Available | 658 | Open in IMG/M |
| 3300012469|Ga0150984_110853998 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012683|Ga0137398_11234892 | Not Available | 509 | Open in IMG/M |
| 3300012685|Ga0137397_10041505 | All Organisms → cellular organisms → Bacteria | 3289 | Open in IMG/M |
| 3300012912|Ga0157306_10377920 | Not Available | 547 | Open in IMG/M |
| 3300012917|Ga0137395_10215201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1341 | Open in IMG/M |
| 3300012924|Ga0137413_10746603 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300012927|Ga0137416_11866539 | Not Available | 550 | Open in IMG/M |
| 3300012948|Ga0126375_10624280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 827 | Open in IMG/M |
| 3300012948|Ga0126375_11676929 | Not Available | 550 | Open in IMG/M |
| 3300012960|Ga0164301_10406166 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300012971|Ga0126369_11463079 | Not Available | 773 | Open in IMG/M |
| 3300012971|Ga0126369_13045971 | Not Available | 549 | Open in IMG/M |
| 3300012984|Ga0164309_10536224 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300013308|Ga0157375_11983762 | Not Available | 692 | Open in IMG/M |
| 3300014199|Ga0181535_10645379 | Not Available | 605 | Open in IMG/M |
| 3300016294|Ga0182041_11497460 | Not Available | 621 | Open in IMG/M |
| 3300016294|Ga0182041_11600503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300016294|Ga0182041_12164784 | Not Available | 519 | Open in IMG/M |
| 3300016319|Ga0182033_11289382 | Not Available | 656 | Open in IMG/M |
| 3300016319|Ga0182033_11783232 | Not Available | 558 | Open in IMG/M |
| 3300016357|Ga0182032_11493567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300016371|Ga0182034_11916975 | Not Available | 523 | Open in IMG/M |
| 3300016387|Ga0182040_11186846 | Not Available | 642 | Open in IMG/M |
| 3300016422|Ga0182039_11792587 | Not Available | 562 | Open in IMG/M |
| 3300016445|Ga0182038_12197100 | Not Available | 500 | Open in IMG/M |
| 3300017946|Ga0187879_10251336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300017970|Ga0187783_11235412 | Not Available | 538 | Open in IMG/M |
| 3300017973|Ga0187780_11009941 | Not Available | 606 | Open in IMG/M |
| 3300017974|Ga0187777_11124678 | Not Available | 572 | Open in IMG/M |
| 3300018468|Ga0066662_11128098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300020199|Ga0179592_10382658 | Not Available | 616 | Open in IMG/M |
| 3300020579|Ga0210407_10237483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1419 | Open in IMG/M |
| 3300020580|Ga0210403_10863415 | Not Available | 716 | Open in IMG/M |
| 3300020582|Ga0210395_10413166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300020583|Ga0210401_10865429 | Not Available | 763 | Open in IMG/M |
| 3300021088|Ga0210404_10388948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300021171|Ga0210405_10222291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1496 | Open in IMG/M |
| 3300021180|Ga0210396_10227149 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300021362|Ga0213882_10330532 | Not Available | 638 | Open in IMG/M |
| 3300021384|Ga0213876_10594922 | Not Available | 588 | Open in IMG/M |
| 3300021402|Ga0210385_10590596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300021402|Ga0210385_10977623 | Not Available | 650 | Open in IMG/M |
| 3300021403|Ga0210397_11435171 | Not Available | 536 | Open in IMG/M |
| 3300021404|Ga0210389_11508789 | Not Available | 511 | Open in IMG/M |
| 3300021405|Ga0210387_10700799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300021407|Ga0210383_10368580 | Not Available | 1238 | Open in IMG/M |
| 3300021432|Ga0210384_10710126 | Not Available | 899 | Open in IMG/M |
| 3300021433|Ga0210391_10847691 | Not Available | 714 | Open in IMG/M |
| 3300021475|Ga0210392_10987157 | Not Available | 630 | Open in IMG/M |
| 3300021479|Ga0210410_10337700 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300021559|Ga0210409_10343348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300021560|Ga0126371_10180196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2196 | Open in IMG/M |
| 3300021560|Ga0126371_11484864 | Not Available | 807 | Open in IMG/M |
| 3300021560|Ga0126371_11865305 | Not Available | 721 | Open in IMG/M |
| 3300021560|Ga0126371_12693400 | Not Available | 603 | Open in IMG/M |
| 3300021560|Ga0126371_12764433 | Not Available | 595 | Open in IMG/M |
| 3300022504|Ga0242642_1088950 | Not Available | 528 | Open in IMG/M |
| 3300022557|Ga0212123_10027096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 6075 | Open in IMG/M |
| 3300022898|Ga0247745_1011887 | Not Available | 1182 | Open in IMG/M |
| 3300024288|Ga0179589_10531947 | Not Available | 547 | Open in IMG/M |
| 3300025321|Ga0207656_10232202 | Not Available | 899 | Open in IMG/M |
| 3300025906|Ga0207699_10831084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300025914|Ga0207671_10951889 | Not Available | 678 | Open in IMG/M |
| 3300025916|Ga0207663_11173511 | Not Available | 618 | Open in IMG/M |
| 3300025924|Ga0207694_11227036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 634 | Open in IMG/M |
| 3300025939|Ga0207665_11424064 | Not Available | 551 | Open in IMG/M |
| 3300025939|Ga0207665_11518687 | Not Available | 532 | Open in IMG/M |
| 3300026023|Ga0207677_11087840 | Not Available | 728 | Open in IMG/M |
| 3300026075|Ga0207708_10411852 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1120 | Open in IMG/M |
| 3300026078|Ga0207702_10679300 | Not Available | 1014 | Open in IMG/M |
| 3300026095|Ga0207676_11412793 | Not Available | 692 | Open in IMG/M |
| 3300026551|Ga0209648_10202605 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300027117|Ga0209732_1028431 | Not Available | 958 | Open in IMG/M |
| 3300027330|Ga0207777_1094720 | Not Available | 515 | Open in IMG/M |
| 3300027505|Ga0209218_1046848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300027512|Ga0209179_1107755 | Not Available | 621 | Open in IMG/M |
| 3300027521|Ga0209524_1125278 | Not Available | 535 | Open in IMG/M |
| 3300027548|Ga0209523_1137224 | Not Available | 504 | Open in IMG/M |
| 3300027674|Ga0209118_1119905 | Not Available | 735 | Open in IMG/M |
| 3300027738|Ga0208989_10225193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300027773|Ga0209810_1024419 | All Organisms → cellular organisms → Bacteria | 3801 | Open in IMG/M |
| 3300027826|Ga0209060_10459721 | Not Available | 578 | Open in IMG/M |
| 3300027842|Ga0209580_10611342 | Not Available | 540 | Open in IMG/M |
| 3300027846|Ga0209180_10099653 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300027846|Ga0209180_10528593 | Not Available | 658 | Open in IMG/M |
| 3300027853|Ga0209274_10096614 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300027867|Ga0209167_10282525 | Not Available | 895 | Open in IMG/M |
| 3300027875|Ga0209283_10507025 | Not Available | 776 | Open in IMG/M |
| 3300027875|Ga0209283_10867649 | Not Available | 549 | Open in IMG/M |
| 3300027879|Ga0209169_10382907 | Not Available | 740 | Open in IMG/M |
| 3300027895|Ga0209624_10849756 | Not Available | 597 | Open in IMG/M |
| 3300027895|Ga0209624_10883584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300027908|Ga0209006_11088340 | Not Available | 631 | Open in IMG/M |
| 3300027910|Ga0209583_10802754 | Not Available | 501 | Open in IMG/M |
| 3300027915|Ga0209069_10178464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
| 3300027986|Ga0209168_10310562 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300028021|Ga0265352_1006996 | Not Available | 683 | Open in IMG/M |
| 3300028047|Ga0209526_10355568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300028047|Ga0209526_10440828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 858 | Open in IMG/M |
| 3300028536|Ga0137415_10008110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 10411 | Open in IMG/M |
| 3300028536|Ga0137415_10164082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2054 | Open in IMG/M |
| 3300028536|Ga0137415_10537038 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300028536|Ga0137415_10541057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 974 | Open in IMG/M |
| 3300029951|Ga0311371_10493013 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300030520|Ga0311372_10354956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2261 | Open in IMG/M |
| 3300030737|Ga0302310_10541732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM3983 | 620 | Open in IMG/M |
| 3300030906|Ga0302314_10200083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2455 | Open in IMG/M |
| 3300030945|Ga0075373_11504300 | Not Available | 675 | Open in IMG/M |
| 3300031231|Ga0170824_107390892 | Not Available | 602 | Open in IMG/M |
| 3300031546|Ga0318538_10780093 | Not Available | 519 | Open in IMG/M |
| 3300031715|Ga0307476_11001119 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031715|Ga0307476_11311429 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031718|Ga0307474_10254183 | Not Available | 1346 | Open in IMG/M |
| 3300031718|Ga0307474_11480479 | Not Available | 534 | Open in IMG/M |
| 3300031720|Ga0307469_11378948 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031754|Ga0307475_11118544 | Not Available | 616 | Open in IMG/M |
| 3300031823|Ga0307478_10301723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16 | 1312 | Open in IMG/M |
| 3300031962|Ga0307479_11552570 | Not Available | 618 | Open in IMG/M |
| 3300032001|Ga0306922_11178922 | Not Available | 781 | Open in IMG/M |
| 3300032066|Ga0318514_10298970 | Not Available | 851 | Open in IMG/M |
| 3300032076|Ga0306924_11785584 | Not Available | 642 | Open in IMG/M |
| 3300032076|Ga0306924_11860893 | Not Available | 625 | Open in IMG/M |
| 3300032174|Ga0307470_10314943 | Not Available | 1068 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.68% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.42% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.42% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.42% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.42% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028021 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_05048740 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MYFNVFGEKVSRRRFKEMCEAAKNRRELIAAGLTSRRDLFKMGLLTAGGM |
| AF_2010_repII_A1DRAFT_101133851 | 3300000597 | Forest Soil | MYYNVFGEKVSRARYKEMLRAAENRRELIAAGLTSRRDLFKMGLLTASGMLVAKSGL |
| AP72_2010_repI_A1DRAFT_10187061 | 3300000650 | Forest Soil | MYFNHRGERVSRARWKEMYQAFQTRQELIKAGLTSRRDLMKLGLLTAAGTLLPKRGLSWGDNNCRY |
| JGI11615J12901_107974682 | 3300000953 | Soil | MYFNARGQRVSRARWKEMYQAFKNRQELIKAKLTRRDLVRMGLLTGGGML |
| JGI12712J15308_100151835 | 3300001471 | Forest Soil | MYYNVFGEKVSKRRFKQMCAAAKNRRELIAAGVTSRREMFKMG |
| JGI12712J15308_100500093 | 3300001471 | Forest Soil | MYFNVYGEKVSRKRYREMVEAGKNRRELIAAGLTSRRDLMKLGLLTAGGML |
| JGI12659J15293_100186791 | 3300001546 | Forest Soil | MAYYNVFGEKVSRKRYKEMVNAAKNRRELITAGLTSRRDLMKLGL |
| JGIcombinedJ26739_1001802264 | 3300002245 | Forest Soil | MYYNVFGEKVSRKRYKEMVNAAKNRRELITAGLTSRRDLMKLGLLTAAGM |
| JGIcombinedJ26739_1006355781 | 3300002245 | Forest Soil | MYYNVFGEKVSRARYKEMLVAAKNRRELIAAGLTSRRDLFKMGLLTAGGMLVA |
| JGIcombinedJ26739_1014044611 | 3300002245 | Forest Soil | MYYNALGERVSRRRYREMLAAAKNRRELIAAGLHNRRDLFKMGL |
| JGIcombinedJ26739_1014783932 | 3300002245 | Forest Soil | MYYNVFGEKVSRRRFKQMCAAAKNRRELIAAGLTSRR |
| C688J35102_1177011831 | 3300002568 | Soil | MYFNSRGEAVSRARWKEMYQAFLNRQELIKAGLTSRRDLLRMGLLGGAGMLIAKNGLSSWGGGDCRY |
| C688J35102_1181315601 | 3300002568 | Soil | MYFNANGERVSRARWKAMYDAFKNRQELIKAGFTRRDLMRMGLLSSSGMLIDKIGL |
| C688J35102_1189915942 | 3300002568 | Soil | MEYNSLGDKVSRARFKEMYNAFKNRQELLKAGLMNRRSLLKMGL |
| JGI25617J43924_100158811 | 3300002914 | Grasslands Soil | MYFNVFGEKVSKARHKEMVNAQKNRRELIAARLNRRDLFRMGLLTG |
| JGI25617J43924_102920121 | 3300002914 | Grasslands Soil | MYFNVFGQKVSKSRHKEMVNAQKNRRELIAARLNRRDLFRMGLLTG |
| Ga0062595_1021014651 | 3300004479 | Soil | VYFNANGERVSRRLWKEMYQAFKNRQELIKAGVTRRDMIRMGLIASTG |
| Ga0062594_1012331351 | 3300005093 | Soil | VYYDANGARVSRRRWKEMYQAFKNRQELVAAGFTRRDLMRMGLIGSTG |
| Ga0066672_101330491 | 3300005167 | Soil | VYFNVFGEKVSRAQWKEMLTAMKNRQEIIAAGLTRRDLLKMGLLTS |
| Ga0066809_101014782 | 3300005168 | Soil | MYFNVFGEKVSRRRFKEMCEAAKNRRELIAAGLTSRRDLFKMGLLTAGGML |
| Ga0066690_102582141 | 3300005177 | Soil | VYYNALGEKVSRRRYREMLNAAKNRRELIEAGLTSRRDLFKLGLLTGS |
| Ga0066685_104173182 | 3300005180 | Soil | MYYNVFGEKVSRRKYKEMLEAAKNRRELIAAGLTSRRDLMKMGL |
| Ga0065712_102727752 | 3300005290 | Miscanthus Rhizosphere | MYRNTKGERISRAKWREMVTTFRNRQELIRAGLMNRRDLMKLGLLTAAGTLIPKRGLSAW |
| Ga0070676_109790192 | 3300005328 | Miscanthus Rhizosphere | MYFNHRGERVSRAAWKEMYRAFQNRQELIKAGLTSRRDLMK |
| Ga0066388_1057909661 | 3300005332 | Tropical Forest Soil | MYYNVFGEKVSKRRFKEMCEAAKNRRELIAAGLTSRRDLMKMGLL |
| Ga0066388_1077797051 | 3300005332 | Tropical Forest Soil | MYYNVYGEKVSKRRFKEMCDAANNRRELIAHGLTSRRDLFKMGLLTAGGMLVAKS |
| Ga0066388_1078087302 | 3300005332 | Tropical Forest Soil | MYYNVFGEKVSRARYREMLNAAKNRRELIAAGLTSRRDLFKMGLLTAGGM |
| Ga0070687_1000629291 | 3300005343 | Switchgrass Rhizosphere | MYFNHRGERVSHARWKEMYQAFQNRQELIKAGLTSRRDLLRLGLLTAAGTLIPK |
| Ga0070692_100266363 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MYFNSRGEKVSRARWKEMYQAFQNRQELIKSGLTSRRDLLRLGL |
| Ga0070659_1016088712 | 3300005366 | Corn Rhizosphere | MYYNANGEKVSRARWKEMYNAFKNRQELVKAGLTSRRDLMRMGLLTAGGMLVAKKGLSSR |
| Ga0070714_1000626241 | 3300005435 | Agricultural Soil | MYFNANGEKVSRARWKEMYNAFKNRQELVKAGLTSRRDLMKMGLLTSAGML |
| Ga0070662_1012856561 | 3300005457 | Corn Rhizosphere | MYFDANGERVSRARWKEMYRAFKNRQELIRAGFSRRDLMKMGLL |
| Ga0070699_1008426651 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MYFNVFGEKVSRRRYKEMCEAAKNRRELIAAGLTSRRDLFKMGL |
| Ga0070733_100230025 | 3300005541 | Surface Soil | MYFNVFGERVSKRRFKEMCEAAKNRRELIAAGLTSRRDL |
| Ga0070732_100087697 | 3300005542 | Surface Soil | MYYNVFGEKVSRKKYREMLRAAENRRELIAAGLTSRRDLMKM |
| Ga0070732_102359851 | 3300005542 | Surface Soil | MYFNVLGEKVSGARYREMVNAAKNRRELIAAGLTSRRDLFKMGL |
| Ga0070686_1013968471 | 3300005544 | Switchgrass Rhizosphere | MYFNHRGERVSRASWKEMYRAFQNRQELIKAGLTSRRDLMKLGLLTAAGTLIPKR |
| Ga0066670_102151011 | 3300005560 | Soil | MYYNVFGEKVSKRRFKEMCEAAKNRRELIAAGLTSRRDLLKM |
| Ga0066691_100050471 | 3300005586 | Soil | MYFNARGEKVSRAQWKEMLTAMKNRQEIIAAGLTRRDLL |
| Ga0066691_101701751 | 3300005586 | Soil | MYYNVFGEKVSRRRFKEMCEAAKNRRELIAAGLTSRRDLFKMG |
| Ga0070761_104465092 | 3300005591 | Soil | MYFNVFGEKVSKARYREMVNAGKNRRELIAAGLTSRRDLCKMGLLT |
| Ga0066903_1030668443 | 3300005764 | Tropical Forest Soil | MYYNVFGEKVSRRRYKEMLEAAKNRRELIAAGLTSRRD |
| Ga0066903_1043250742 | 3300005764 | Tropical Forest Soil | MYRNVFGEKVSRARYREMLRAAENRRELIAAGLTSRR |
| Ga0066903_1063650191 | 3300005764 | Tropical Forest Soil | MYYNVFGEKVSRARYREMLTAAENRRELIAAGLTS |
| Ga0081455_107969981 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MYFNVFGEKVSKRRFKEMVRASENRRELIAAGLGRRELL |
| Ga0066788_101571682 | 3300005944 | Soil | MYFNVFGEKVSRKRYKEMQNAAKNRRELIAAGLSGRRELMKLGLLTA |
| Ga0070717_117454042 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MYYNIFGEKVSRARYQEMLTAAKNRRELIAAGLTSRRDLFIRDLLKEGAPPGQ |
| Ga0075023_1004411922 | 3300006041 | Watersheds | MYYNVFGEKVSRARYQEMLTAAKNRRELIAAGLTSRRDLFKM |
| Ga0066652_1003050053 | 3300006046 | Soil | MYYNNRGERVSRARWKEMYQAFQNRQELIKAGLTSRRDLM |
| Ga0070765_1010626762 | 3300006176 | Soil | MYYNVFGEKVSRRRFKEMCNAAKNRRELIAAGLTSRRDLFKMG |
| Ga0075425_1031383441 | 3300006854 | Populus Rhizosphere | MYFNHRGERVSRAVWKEMYQAFQNRQELIKAGLTSRRDLMKLGLLTAGGLLIPRRGLSWGDNNCR |
| Ga0075436_1000304371 | 3300006914 | Populus Rhizosphere | MYFNIFGQRISRTKYKEMAAAATNRRELIAAQLSRRDLMKMGLLTGAGYLAS |
| Ga0079219_104816643 | 3300006954 | Agricultural Soil | MYFNHRGERVSRARWKEMYQAFQNRQELIKAGLTSRRDLMKLGL |
| Ga0079219_109941731 | 3300006954 | Agricultural Soil | MYFNVFGEKVSRRRFKEMCEAAKNRRELIAAGLTSRRDLFKMGL |
| Ga0079219_115598421 | 3300006954 | Agricultural Soil | MYFNALGEKVSKARHKEMETAAKNRRELIAAGLSSRRDLLKMGLLTAGGMLV |
| Ga0099795_100315474 | 3300007788 | Vadose Zone Soil | MYYNVFGEKVSRARYREMLEAAKNRRELIAAGLTSR |
| Ga0099829_107295431 | 3300009038 | Vadose Zone Soil | MYYNVFGEKVSRRRYKEMCDAAKNRRELIAAGLTSRRDLFKMGL |
| Ga0099829_107367902 | 3300009038 | Vadose Zone Soil | MYYNVFGEKVSRKKYKEMLEAAKNRRELIAAGLTSRRDLM |
| Ga0099830_105664791 | 3300009088 | Vadose Zone Soil | MYFNVLGEKVSKARHREMVAAAKKRRELIAAGLTSRRDLMKMGLLT |
| Ga0099828_109607512 | 3300009089 | Vadose Zone Soil | MYFNVFGEKVSRARYREMVNAANNRRELIAAGLTSRRDLFKLGLLTAGG |
| Ga0099827_102690791 | 3300009090 | Vadose Zone Soil | VYFNVFGEKVSKGRFKQMVNAFRNRQELIKAGLTSRRDLLKM |
| Ga0105241_116079311 | 3300009174 | Corn Rhizosphere | MYFNVFGEKVSRRRFKEMCDAAKNRRELIAAGLTSRRDLFKMGLLTASG |
| Ga0105249_105475271 | 3300009553 | Switchgrass Rhizosphere | MYYNRNGERVSRARFKEMYAAFKNRQELIKAGLMNRQSLAKMGLLAG |
| Ga0105859_11848351 | 3300009651 | Permafrost Soil | MYFNANGEKVSRARWKEMYDAFKNRQEIVKAGLDRRELLKMG |
| Ga0126314_105996182 | 3300010042 | Serpentine Soil | MYYNSRGERVSRARWKEMYAAFQNRQELIKAGLMNRR |
| Ga0126384_104481461 | 3300010046 | Tropical Forest Soil | MYFNVLGEKVSKARYKEMLKAAENRRELIAAGLTSRRDLLKMGLLTAGG |
| Ga0126384_113689221 | 3300010046 | Tropical Forest Soil | MYFNVFGEKVSRARYKEMLNAAKNRRELIAAGLNRRDL |
| Ga0126373_100421591 | 3300010048 | Tropical Forest Soil | MYYNVFGEKVSKKKYKEMLQAAENRRELIAAGLTSRRDLMKMGL |
| Ga0126373_114704252 | 3300010048 | Tropical Forest Soil | MYFNALGEKVSRARYREMQQAAKNRRELIAAGLTS |
| Ga0126373_128048022 | 3300010048 | Tropical Forest Soil | LYYNVYGEKVSRARFKGMLNAAKNRKELIAAGLTSRRDLWKMG |
| Ga0099796_102309801 | 3300010159 | Vadose Zone Soil | MYFNALGEKVSRARFREMENAAKNRRELIAAGLTSR |
| Ga0134070_103936362 | 3300010301 | Grasslands Soil | MYYNVFGEKVSRARWKEMQNAAKNRRELIAAGFDRRQLFKMGLLTS |
| Ga0126370_107983103 | 3300010358 | Tropical Forest Soil | MFMYYNVFGEKVSRRRFKEMCEAAKNRRELIAAGLTSRRDL |
| Ga0126376_116262451 | 3300010359 | Tropical Forest Soil | MEYNVFGEKVSRARYKLMLESLKNRQELIKAGLTS |
| Ga0126372_104757091 | 3300010360 | Tropical Forest Soil | MYFNVFGEKVSRSRYKEMLTAAKNRRELISAGLTGRRDLIKMG |
| Ga0126372_118878891 | 3300010360 | Tropical Forest Soil | MYYNVYGEKVSKRRFKEMCDAANNRRELIAHGLTSRRDLFKMGLLTAGGMLVAK |
| Ga0126378_100309961 | 3300010361 | Tropical Forest Soil | MYYNVFGEKVSKRRFKEMCEAAKNRRELIAAGLTSRRDLFKMGLLTA |
| Ga0126378_100716926 | 3300010361 | Tropical Forest Soil | MYYNVFGEKVSRRRFKEMCDAAKNRRELIAAGLTSRRDLFKMGLLTAGGM |
| Ga0126378_123463541 | 3300010361 | Tropical Forest Soil | MYYNVFGEKVSKRRFKEMCEAAKNRRELIAAGLTSRRDL |
| Ga0126377_117158892 | 3300010362 | Tropical Forest Soil | MFMYYNVFGEKVSRRRFKEMCEAAKNRRELIAAGLTSRR |
| Ga0126379_101802691 | 3300010366 | Tropical Forest Soil | MYFNVFGEKVSHGRYKAMLNAARNRRELIAAGLTGR |
| Ga0126379_105098691 | 3300010366 | Tropical Forest Soil | MYYNVFGEKVSKRRFDEMCEAAKNRRELIAAGLTSR |
| Ga0126379_118952462 | 3300010366 | Tropical Forest Soil | VGKFSFVDTKGETAVYYNVYGEKVSRARYNEMLNAAKNRRELIAAGLTSRRNLWKMGLLT |
| Ga0126379_121713801 | 3300010366 | Tropical Forest Soil | MYYNVFGEKVSRRRYKEMCEAAKNRRELIAAGLTSRRDLMKMGL |
| Ga0126379_129504491 | 3300010366 | Tropical Forest Soil | MYYNVFGEKVSKKKYKEMLQAAENRRELIAAGLTSRRDLMKMGLLTAGGMLV |
| Ga0134125_108668081 | 3300010371 | Terrestrial Soil | MYYNANGEKVSRARWKEMYNAFKNRQELVKAGLTS |
| Ga0105239_124380041 | 3300010375 | Corn Rhizosphere | MYFNANGEKVSRARWKEMYNAFKNRQELVKAGLTSRRDLMRMGLLTGAG |
| Ga0126381_1003626991 | 3300010376 | Tropical Forest Soil | MYFNVFGERVSRRRHREMLTAAKNRRELIAAGFGRRDL |
| Ga0126381_1006027134 | 3300010376 | Tropical Forest Soil | MYYNVFGEKVSKARWKQMVSAFRNRQELIKARLTSRRDLLK |
| Ga0126381_1006778931 | 3300010376 | Tropical Forest Soil | MYYNVFGEKVSRRRYKEMLEAAKNRRELIAAGLTSRRDLFRMGLLTAG |
| Ga0126381_1045161732 | 3300010376 | Tropical Forest Soil | MYSNIFGEKVSRRRFKEMINAARNRRELIAAGLTSRRDLMKMGLLTP |
| Ga0134126_101481551 | 3300010396 | Terrestrial Soil | MYYNVFGEKVSRRRFKEMCNAAKNRRELIAAGLTSRR |
| Ga0126383_131209852 | 3300010398 | Tropical Forest Soil | MYFNVFGEKVSHGRYKAMLNAARNRRELIAAGLTGRR |
| Ga0126383_134634641 | 3300010398 | Tropical Forest Soil | MYYNVFGEKVSRARYREMLRAAENRRELIAAGLTSRRDLF |
| Ga0134121_105935024 | 3300010401 | Terrestrial Soil | MYFNNRGERVSHARWKEMYQAFQNRQELIKAGLTSRRDLMKLGLLTAGGLLIPK |
| Ga0105246_116170552 | 3300011119 | Miscanthus Rhizosphere | MYFNSKGDRISRARWKELYRAFQNRQELIKAQLTRRDLVRMGLLTSGGMLVTQAGLSSR |
| Ga0150983_132099771 | 3300011120 | Forest Soil | MYFNVFGEKVSKAKYREMVNAAKNRRELIAAGLTSRRDLFKMGLLRPVGCWWPKAA* |
| Ga0137393_100620211 | 3300011271 | Vadose Zone Soil | MYYNIFGEKVSRARWKEMENAAKNRRELIAAGFNRRDLFKM |
| Ga0137393_107644142 | 3300011271 | Vadose Zone Soil | MYYNVFGEKVSRRRFKEMCNAAKNRRELIAAGLTSRRDLFKMGLLTAGG |
| Ga0137388_109038971 | 3300012189 | Vadose Zone Soil | MYYNVFGEKVSRARYREMLEAAKNRRELIAAGLTSRRDLFKMGLLTAGGMLV |
| Ga0137383_110093061 | 3300012199 | Vadose Zone Soil | VSASLKRRYLVYFNVFGEKVSKARWKQMVAAFRNRQELVKAGLTSRRDLLKLGLLSAS |
| Ga0137365_112074521 | 3300012201 | Vadose Zone Soil | MYYNVFGERVSRAKYKEMQDAAKNRRELIAGGCFTRRDLMKLGLITGAGMLV |
| Ga0137363_105810573 | 3300012202 | Vadose Zone Soil | MERNVYGEPVSNARWRLMLKALKNRQEIIAAGLSRRDLFKMGLLT |
| Ga0137363_108296581 | 3300012202 | Vadose Zone Soil | MYFNVFGEKVSKTRYKEMLNAAKNRRELIAAGLTSRRELFK |
| Ga0137380_107307571 | 3300012206 | Vadose Zone Soil | MYYNVFVEKVSRRKYKEMLEAAKNRRELIAAGLTSRRDLM |
| Ga0137379_118051051 | 3300012209 | Vadose Zone Soil | VYFNVFGEKVSKGRFKQMVNAFRNRQELIKAGLTSRRDLLKMGLLTASGMLLAKHG |
| Ga0137387_100334476 | 3300012349 | Vadose Zone Soil | VYFNVFGEKVSKGRFKQMVNAFRNRQELIKAGLTS |
| Ga0137366_102151843 | 3300012354 | Vadose Zone Soil | VYFNVFGEKVSKGRFKQMVNAFRNRQELIKAGLTSRRDLL |
| Ga0137384_103988192 | 3300012357 | Vadose Zone Soil | MYYNVFGERVSRAKYKEMQDAAKNRRELIAGGCFTRRDLMKLGLITGAGMLVAKSGLSARAGSFLPQ |
| Ga0137384_115001392 | 3300012357 | Vadose Zone Soil | LMYYNVFGEKVSRRKYKEMLEAAKNRRELIAAGLTSRRDLMKMGLLTAGGTGC* |
| Ga0137360_103963582 | 3300012361 | Vadose Zone Soil | MYYNVFGEKVSRREYKGMLEAAKNRRELIAAGLTSRRD |
| Ga0137360_106153952 | 3300012361 | Vadose Zone Soil | MYYNVFGEKVSKRRYKEMLEAAKNRRELIAAGLTSRRDL |
| Ga0137360_106415591 | 3300012361 | Vadose Zone Soil | MYFNVFGEKVSKTRYKEMLNAAKNRRELIAAGLTSR |
| Ga0137361_108816841 | 3300012362 | Vadose Zone Soil | MYYNVFGEKVSRARYREMLTAAKNRRELIAAGLTSRRDLFKMGLLTAGGMLVAK |
| Ga0137390_113499221 | 3300012363 | Vadose Zone Soil | MYYNVFGEKVSRARYREMLTAAKNRRELIAAGLTSRRD |
| Ga0150984_1108539981 | 3300012469 | Avena Fatua Rhizosphere | MYFNANGEKVSRARWQAMYDAFKNRQELIKAGYSRRELMKMGLLTSGGLLVAKMGL |
| Ga0137398_112348921 | 3300012683 | Vadose Zone Soil | MYYNSNGERVSRARWKEMYNAFKNRQELVKARLTSRRDL |
| Ga0137397_100415051 | 3300012685 | Vadose Zone Soil | MYYNVFGEKVSRARFKQMCEAAKNRRELIAAGLTSRRDLMKLGLLTAGGMLV |
| Ga0157306_103779201 | 3300012912 | Soil | MYYNANGEKVSRRRWKDMYQAFKNRQELIKAGFSRRDLMRMGLI |
| Ga0137395_102152011 | 3300012917 | Vadose Zone Soil | VYFNVFGEKVSKGRFKQMVNAFRNRQELIKAGLTSRRDLLKMGLLT |
| Ga0137413_107466032 | 3300012924 | Vadose Zone Soil | MYFNVFGEKVSKRRYKEMCEAAKNRRELIAAGLTSRRDLF |
| Ga0137416_118665391 | 3300012927 | Vadose Zone Soil | MYYNVFGEKVSRARYREMLEAAKNRRELIAAGLTSRRDLFKMGLLTAG |
| Ga0126375_106242801 | 3300012948 | Tropical Forest Soil | MYYNVFGEKVSRARYREMLAAAKNRRELIAAGLTSRRDLFKMG |
| Ga0126375_116769292 | 3300012948 | Tropical Forest Soil | MFMYYNVFGEKVSKRRFEEMCKAAENRRELIAAGLTSRRDLFKMGLLTAGGMLVAKS |
| Ga0164301_104061662 | 3300012960 | Soil | MYFNVFGEKVSKRRYKEMCEAAKNRRELIAAGLTSRRDLFKMGLL |
| Ga0126369_114630791 | 3300012971 | Tropical Forest Soil | MYKNVYGEKVSKRRFKEMCDAANNRRELIAHGLTSRRDLFKMGLLTAGGMLVAKS |
| Ga0126369_130459712 | 3300012971 | Tropical Forest Soil | VKEETAVYYNVLGEKVSRARYKEMLNAAKNRRELIAA |
| Ga0164309_105362242 | 3300012984 | Soil | MYFNVFGEKVSRRRFKEMCEAAKNRRELIAAGLTSRRDLFKMGLLTAGGMLVA |
| Ga0157375_119837621 | 3300013308 | Miscanthus Rhizosphere | MYFNANGEKVSRARWKEMYNAFKNRQELVKAGLTSRRDLMRMGLLTGAGMLIA |
| Ga0181535_106453792 | 3300014199 | Bog | MYFNVFGEKVSKARYREMVNAAKNRRELIAAGLTSRRDLMKMGR* |
| Ga0182041_114974601 | 3300016294 | Soil | MYRNVFGDKVSRRRYKEMCEAAKNRRELIAAGLTSRRDLMKM |
| Ga0182041_116005031 | 3300016294 | Soil | MYFNALGERVSRARYKEMENAAKNRRELIAAGLHTRRDLAKLGLLTASGMLV |
| Ga0182041_121647841 | 3300016294 | Soil | MYYNVYGEKVSRRRFKEMEEAAKNRRELIAHGLTSRRDLFK |
| Ga0182033_112893822 | 3300016319 | Soil | MYFNALGEKVSRARYREMQQAAKNRRELIAAGLTSRRDLFKLGLLSA |
| Ga0182033_117832323 | 3300016319 | Soil | MYRNVFGEKVSRAQYKLMLEAAKNRRELIAAGLTSRRDLFKMGLLTAGGMLVAK |
| Ga0182032_114935672 | 3300016357 | Soil | MYFNALGERVSRARFKEMENAAKNRRELIAAGLHTRRELA |
| Ga0182034_119169751 | 3300016371 | Soil | MYYNVYGEKVSKRRFKEMCDAAKNRRELIAAGLTSRRDLFKMGLLTAGGM |
| Ga0182040_111868461 | 3300016387 | Soil | MYHNVFGEKVSRARYREMLAAAKNRRELIAAGLTSRRDLFKMGLLTAGGML |
| Ga0182039_117925871 | 3300016422 | Soil | MYRNVFGEKVSRAQYKLMLEAAKNRRELIAAGLTSRRDLFKMGLLTAGGLLVAKAGLSAR |
| Ga0182038_121971002 | 3300016445 | Soil | VYYNTYGERVSRARYKEMLNAAKNRRELIAAGLSSRRDLWKMGLLTAA |
| Ga0187879_102513362 | 3300017946 | Peatland | MAYYNVFGEKVSRKRYKEMVNAAKNRRELITAGLTSRRDLMKLGLLTAGGMLV |
| Ga0187783_112354122 | 3300017970 | Tropical Peatland | MYYNVFGEKVSRRRYKEMCQAAKNRRELIAAGLTNRR |
| Ga0187780_110099411 | 3300017973 | Tropical Peatland | MHYNVFGEKVSRRRYKEMCAALKNRRELVAAGLTSRRDLMKMGLLTAGGMLVAKSGLSAR |
| Ga0187777_111246781 | 3300017974 | Tropical Peatland | MYYNVFGEKVSRRRYKEMCAALKNRRELIAAGLTSRRD |
| Ga0066662_111280982 | 3300018468 | Grasslands Soil | VYFNVFGEKVSKGRFKQMVNAFKNRQELIAAGLTSRRDLLKLGLLTASGVLLAK |
| Ga0179592_103826582 | 3300020199 | Vadose Zone Soil | MYFNVFGEKVSKSRYKEMLNAAKNRRELIAAGLTSRRELFKMGLLTAGG |
| Ga0210407_102374831 | 3300020579 | Soil | MYFNVFGEKVSRKRYKEMLNAAKNRRELIAAGLTSRRDLMKLGL |
| Ga0210403_108634151 | 3300020580 | Soil | MYRNVLGEKVSKSRFREMQNAAKNRRKLIAAGLGRRDLMKMGL |
| Ga0210395_104131662 | 3300020582 | Soil | MYYNVFGEKVSKRRFKQMCAAAKNRRELIAAGVTSRREMFKMGLLTAGGLLIAKHGLSSRVL |
| Ga0210401_108654292 | 3300020583 | Soil | MYYNVFGEKVSKRRFKQMCAAAKNRRELIAAGLTSRRDLFKMGLLTAGGMLVAKH |
| Ga0210404_103889481 | 3300021088 | Soil | MYYNVFGEKVSRKRYKEMVNAAKNRRELITAGLTSRR |
| Ga0210405_102222911 | 3300021171 | Soil | MYFNVFGERVSKARYREMVNAAKNRRELIAAGLTS |
| Ga0210396_102271493 | 3300021180 | Soil | MYYNVFGEKVSKRRFKQMCAAAKNRRELIAAGLTSRRDLFKMGLLTAGGLLIAKHGLS |
| Ga0213882_103305321 | 3300021362 | Exposed Rock | MYYNVFGEKVSKRRFKEMCEAARNRRELIAARLTNRRDLLKMGLLTAGGM |
| Ga0213876_105949222 | 3300021384 | Plant Roots | MDFNHRGERVSRARWKEMYQAFQNRQELVKAGLTS |
| Ga0210385_105905962 | 3300021402 | Soil | MYYNVFGEKVSKRRFKQMCAAAKNRRELIAAGVTSRREMFKMGLLTAGGLLIAKHGLSSRAYGQSVT |
| Ga0210385_109776231 | 3300021402 | Soil | MYFNVFGQKVSRRVYKEMQNAAKNRQELIKAGLTSRRDLM |
| Ga0210397_114351712 | 3300021403 | Soil | MYRNVLGEKVSRKRYREMLAAARNRRELIAAGLGRRELLKM |
| Ga0210389_115087891 | 3300021404 | Soil | MYYNVFGEKVSRRRFKLMCNALKNRRELIAAGLTSRRDLMKMGLLTAGGLLVAKHGLSARAWAQVDP |
| Ga0210387_107007992 | 3300021405 | Soil | MYYNVFGEKVSRRRYKEMCAAAKNRRELIAAGLTSRRDLMKMGLLTA |
| Ga0210383_103685802 | 3300021407 | Soil | MYFNVYGEKVSRKRYREMVQAGKNRRELISANLTSRRDLMKLGLLTAGGMLAAKSG |
| Ga0210384_107101261 | 3300021432 | Soil | MYYNTRGERVSRARFKEMYTALQNRQELFKAGLMNRR |
| Ga0210391_108476911 | 3300021433 | Soil | MYFNVYGEKVSRKRYREMVEAGKNRRELIAAGLTSRRDLMKLGLLTAGGMLV |
| Ga0210392_109871571 | 3300021475 | Soil | MYYNVFGEKVSRRRFKLMCNALKNRRELIAAGLTSRRDLMKMGLLTAGGVLVAKHGLSARAWGQVDPSITGKA |
| Ga0210410_103377002 | 3300021479 | Soil | MYFNVFGEKVSKARYREMVNAAKNRRELITAGLTSRRDLLKMGLLTAGGML |
| Ga0210409_103433483 | 3300021559 | Soil | MYFNVFGERVSRARYKEMLNAAKNRRELVAAQFDRRDLIKMGLVTA |
| Ga0126371_101801961 | 3300021560 | Tropical Forest Soil | MYRNVFGEKVSKRRFKEMCDAAKNRRELIAAGLTSR |
| Ga0126371_114848642 | 3300021560 | Tropical Forest Soil | MKGENALYYNVYGEKVSRARFKGMLNAAKNRKELIAAGLTSRRGLWKMGLLTAAG |
| Ga0126371_118653051 | 3300021560 | Tropical Forest Soil | MYRNVLGEKVSKARYKEMLEAAKNRRELIAAGLTSRRDLLKMG |
| Ga0126371_126934001 | 3300021560 | Tropical Forest Soil | MYYNVFGEKVSRRRYKEMCEAAKNRRELIAAGLTSR |
| Ga0126371_127644331 | 3300021560 | Tropical Forest Soil | MYFNVFGEKISRARYREMVNAQKNRRELIAARLNRRDLFKMGLLTGAGYL |
| Ga0242642_10889501 | 3300022504 | Soil | MYRNALGERVSRRRYREMLNAAKNRRELIAAGLTNRRDLFKMGLL |
| Ga0212123_100270961 | 3300022557 | Iron-Sulfur Acid Spring | MYYNVFGEKVSRSRYKEMLAAAKNRRELIAAGLTNRRDLFK |
| Ga0247745_10118874 | 3300022898 | Soil | MYYNANGEKVSRRRWKDMYQAFKNRQELIKAGFSRRDLMRMGLIGAT |
| Ga0179589_105319471 | 3300024288 | Vadose Zone Soil | VYHNADGERVSRARWKAMYDAFKNRQELIKAGFSRRELM |
| Ga0207656_102322021 | 3300025321 | Corn Rhizosphere | MYYNANGEKVSRARWKEMYNAFKNRQELVKAGLTSRRDLMRMGLLTAGGMLVAKKG |
| Ga0207699_108310841 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MYFNVLGEKVSRARHREMVAAAKNRRELIDAGLTGRRDL |
| Ga0207671_109518891 | 3300025914 | Corn Rhizosphere | MYFNVFGEKVSRRRYKEMCEAAKNRRELIAAGLTS |
| Ga0207663_111735111 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MYFNVFGEKVSKRRFKEMCEAAKNRRELIAAGLTSRR |
| Ga0207694_112270362 | 3300025924 | Corn Rhizosphere | MYYNVFGERVSRRRFKQMCDAAKNRRELIAAGLTSRRDLFKMGLLTAGG |
| Ga0207665_114240641 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MYYNVFGEKVSKRRFKEMCEAAKNRRELIAAGLTNRRDL |
| Ga0207665_115186872 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MYFNSRGEKVSRARWREMYAAFQNRQELIKAGLTSRRDLMKLGLLTSAG |
| Ga0207677_110878401 | 3300026023 | Miscanthus Rhizosphere | MYYNANGEKVSRARWKEMYNAFKNRQELVKAGLTSRRDLMKMG |
| Ga0207708_104118521 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MYFNSKGDRISRARWKELYRAFQNRQELIKAQLTRRDLVRMG |
| Ga0207702_106793002 | 3300026078 | Corn Rhizosphere | MYYNSLGERVSRARFKEMYKAFQNRQELIKAGLMNR |
| Ga0207676_114127932 | 3300026095 | Switchgrass Rhizosphere | MYYDANGERVSRARWKEMYQAFKNRQELIKAGFTRRDLMNMGLLTAGGVL |
| Ga0209648_102026051 | 3300026551 | Grasslands Soil | VYFNVFGEKVSRKQYKEMLEAAKNRRELIAAGLTSR |
| Ga0209732_10284311 | 3300027117 | Forest Soil | MYFNANGEKVSRARWKEMYNAFKNRQELVKAGLTSRRDLLK |
| Ga0207777_10947202 | 3300027330 | Tropical Forest Soil | MYYNVFGEKVSRARYQAMLTAAKNRRKLIAAGLTSRRDLFKM |
| Ga0209218_10468482 | 3300027505 | Forest Soil | MYYNVFGEKVSKRRFKQMCAAAKNRRELIAAGVTSRREMFKMGLLTAGGLLIAKHGLS |
| Ga0209179_11077551 | 3300027512 | Vadose Zone Soil | MYFNKNGEKVSHARWKEMYNAFKNRQELVKAGLTS |
| Ga0209524_11252781 | 3300027521 | Forest Soil | MYRNVLGEKVSKGRFQEMQAAAKNRREFIAAGLGRRDLMKMGLLT |
| Ga0209523_11372242 | 3300027548 | Forest Soil | MYLNSKGEKVSRARWQEMYNAFKNRQELIKAGLMNRRDLFKMGLLS |
| Ga0209118_11199051 | 3300027674 | Forest Soil | MYLNVLGEKVSRARHREMVAAAKNRRELIAAGLTSRRDLMK |
| Ga0208989_102251931 | 3300027738 | Forest Soil | VYRNVFGEKVSKWRFKQMLNAAKNRRELIAAGLTSRRDLLKM |
| Ga0209810_10244195 | 3300027773 | Surface Soil | MYYNANGEKVSRARWKEMYNAFKNRQELVKAGLTSRRDLMKLGLLTS |
| Ga0209060_104597211 | 3300027826 | Surface Soil | MYFNVFGEKVSRRRFKEMEEAAKNRRELIAHGLTSRRDLFKMGLLTAGGM |
| Ga0209580_106113421 | 3300027842 | Surface Soil | MYFNVFGEKVSRARYREMINAAKNRRELIAAGLTSRRDLCKMGLLTA |
| Ga0209180_100996531 | 3300027846 | Vadose Zone Soil | MYYNVFGEKVSRKRYKEMLEAAKNRRELVAAGLTS |
| Ga0209180_105285933 | 3300027846 | Vadose Zone Soil | MYRNVFGEKVSKKRYQEMLNAAKNRRELIAAGLTSRRDLFKMGLLT |
| Ga0209274_100966141 | 3300027853 | Soil | MYYNVFGEKVSRKRYKEMVNAAKNRRELITAGLTSRRD |
| Ga0209167_102825251 | 3300027867 | Surface Soil | MYFNVFGERVSKRRFKEMCEAAKNRRELIAAGLTSRRDLMKLG |
| Ga0209283_105070251 | 3300027875 | Vadose Zone Soil | MYYNVFGEKVSRRKYKEMLEAAKNRRELIAAGLTSR |
| Ga0209283_108676491 | 3300027875 | Vadose Zone Soil | MTYYNVFGEKVSRARWTEMLNAAKNRRELIAAGLTSRRDLFKMGLLTAGGLLVAKS |
| Ga0209169_103829071 | 3300027879 | Soil | MYRNVFGEKVSKARYREMVNAAKNRRELIAAIAQV |
| Ga0209624_108497562 | 3300027895 | Forest Soil | MYYNVFGEKVSRRRFKQMCAAAKNRRELIAAGLTSRRELFKMGLLTAGGLLV |
| Ga0209624_108835842 | 3300027895 | Forest Soil | MYYNVFGEKVSRRRYKEMCEAAKNRRELIAAGLTS |
| Ga0209006_110883401 | 3300027908 | Forest Soil | MYYNVFGEKVSKRRFKLMCAAAKNRRELIAAGVTS |
| Ga0209583_108027541 | 3300027910 | Watersheds | MYYNVFGEKVSRARYQEMLTAAKNRRELIAAGLTSRRDLFKMGLLTAGGMLVA |
| Ga0209069_101784641 | 3300027915 | Watersheds | MYYNVFGEKVSKRRFKEMCDAAKNRRELIAAGLTSR |
| Ga0209168_103105622 | 3300027986 | Surface Soil | MDFNSLGERVSRARFKEMYNAFRNRQELIKAGLMNRRSLLCHCSVLRM |
| Ga0265352_10069961 | 3300028021 | Soil | MYYNVFGEKVSKRRFKLMCAAAKNRRELIAAGVTSRREMFK |
| Ga0209526_103555682 | 3300028047 | Forest Soil | MYFNVFGEKVSRKRYKEMLNAAKNRRELIAAGMTSRRDLMKLG |
| Ga0209526_104408281 | 3300028047 | Forest Soil | MYFNALGEKVSKARHREMEAAAKNRRELIAAGLTSRRDLLKM |
| Ga0137415_100081101 | 3300028536 | Vadose Zone Soil | MYFNANGGRVSRSRWKEMYQAFKNRQELIKAGFTRRDLIQMGLL |
| Ga0137415_101640821 | 3300028536 | Vadose Zone Soil | MYYNVFGEKVSRARYREMLEAAKNRRELIAAGLTSRRDLFKMGLLTAGG |
| Ga0137415_105370381 | 3300028536 | Vadose Zone Soil | MYYKANGERVSRSRWKEMYQAFKNRQELIKAGFTRRDLIQMGLL |
| Ga0137415_105410571 | 3300028536 | Vadose Zone Soil | VYFNVFGEKVSKARWKQMVAAFRNRQELIKAGLTSRRDLLKLGLLSASGMLIAKH |
| Ga0311371_104930133 | 3300029951 | Palsa | MYYNVFGEKVSRARYREMLTAAKNRRELIAAGLTSRRDLFKLGLLTAGGLLVA |
| Ga0311372_103549561 | 3300030520 | Palsa | MYYNVFGEKVSRRRFKEMCNAAKNRRELIAAGLTSR |
| Ga0302310_105417321 | 3300030737 | Palsa | MYYNVFGEKVSRRRFKEMCNAAKNRRELIAAGLTSRRD |
| Ga0302314_102000833 | 3300030906 | Palsa | MYYNVFGEKVSRRRFKEMCNAAKNRRELIAAGLTS |
| Ga0075373_115043002 | 3300030945 | Soil | MYFNVFGEKVSRRRYKEMCEAAKNRRELIAAGLTSRRDLFKMGLLTA |
| Ga0170824_1073908921 | 3300031231 | Forest Soil | MYFNSNGEKVSRARWKEMYNAFKNRQELVKAGLTSRRDLMKM |
| Ga0318538_107800931 | 3300031546 | Soil | MYRNVFGDKVSRRRYKEMCEAAKNRRELIAAGLTSRRDLMK |
| Ga0307476_110011191 | 3300031715 | Hardwood Forest Soil | MFRNVLGEKVSRGRFKEMQAAARNRREFIAAGLGRRDLMKMGLLTAAGTLLP |
| Ga0307476_113114291 | 3300031715 | Hardwood Forest Soil | MYRNVLGEKVSKGRFKEMQAAAKNRREFIAAGLGR |
| Ga0307474_102541832 | 3300031718 | Hardwood Forest Soil | MYRNVLGEKVSKGRFKEMQAAAKNRREFIAAGLGRRDLMKMGLLTAAGTL |
| Ga0307474_114804791 | 3300031718 | Hardwood Forest Soil | MYFNVFGEKVSRARYREMVDAAKNRGELIAAGLTS |
| Ga0307469_113789481 | 3300031720 | Hardwood Forest Soil | MYFNVFGEKVSKRRYKEMCEAAKNRRELIAAGLTS |
| Ga0307475_111185442 | 3300031754 | Hardwood Forest Soil | MYYNVFGEKVSRRRFKLMCNAAKNRRELIAAGLTSRRDLMKMGFLTAG |
| Ga0307478_103017231 | 3300031823 | Hardwood Forest Soil | MYFNVLGEKVSRARFREMLNAAKNRRELIAAGLTSRRDLFK |
| Ga0307479_115525701 | 3300031962 | Hardwood Forest Soil | VYFNVFGKRVSRTQYKEMLNAAKNRRELIAAQFSRRELIKMGLITSA |
| Ga0306922_111789221 | 3300032001 | Soil | VYYNVYGEKVSRARYREMLNAAKNRRELIAAGLTSRRDLWKMGLL |
| Ga0318514_102989702 | 3300032066 | Soil | MYYNALGEKVSRARYREMLNAAKNRRELIAAGLYGRRELAKMGLLTAGGML |
| Ga0306924_117855841 | 3300032076 | Soil | MYFNVFGEKVSRARHREMVNAQKNRRELIAACLSRRDLFKMGLLTS |
| Ga0306924_118608931 | 3300032076 | Soil | LYYNVYGEKVSRARHKAMLNAAKNRRELIAAGLTSRRDLWKMGLLSSVGM |
| Ga0307470_103149432 | 3300032174 | Hardwood Forest Soil | MYFNVFGEKVSRARYREMLNAAKNRRELIAAGLTSRRTLFKMGLLTAGGMLIT |
| ⦗Top⦘ |