


| Basic Information | |
|---|---|
| Family ID | F017807 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 238 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPMLLGSTTVVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE |
| Number of Associated Samples | 185 |
| Number of Associated Scaffolds | 238 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.33 % |
| % of genes near scaffold ends (potentially truncated) | 28.15 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 162 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.941 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.546 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.151 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.437 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 238 Family Scaffolds |
|---|---|---|
| PF12697 | Abhydrolase_6 | 11.34 |
| PF12695 | Abhydrolase_5 | 7.56 |
| PF12804 | NTP_transf_3 | 6.30 |
| PF05425 | CopD | 5.04 |
| PF03477 | ATP-cone | 0.84 |
| PF00072 | Response_reg | 0.42 |
| PF07728 | AAA_5 | 0.42 |
| PF13379 | NMT1_2 | 0.42 |
| PF05239 | PRC | 0.42 |
| PF04055 | Radical_SAM | 0.42 |
| PF00903 | Glyoxalase | 0.42 |
| PF03050 | DDE_Tnp_IS66 | 0.42 |
| PF01189 | Methyltr_RsmB-F | 0.42 |
| PF09489 | CbtB | 0.42 |
| PF05762 | VWA_CoxE | 0.42 |
| PF08282 | Hydrolase_3 | 0.42 |
| PF13417 | GST_N_3 | 0.42 |
| PF08240 | ADH_N | 0.42 |
| PF01663 | Phosphodiest | 0.42 |
| PF01863 | YgjP-like | 0.42 |
| PF09587 | PGA_cap | 0.42 |
| PF03610 | EIIA-man | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 238 Family Scaffolds |
|---|---|---|---|
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 5.04 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.42 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.42 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.42 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.42 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.42 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.42 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.42 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.94 % |
| Unclassified | root | N/A | 47.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig36986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 1075 | Open in IMG/M |
| 2140918007|ConsensusfromContig3721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 1104 | Open in IMG/M |
| 3300001356|JGI12269J14319_10099893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1429 | Open in IMG/M |
| 3300002568|C688J35102_119563954 | Not Available | 720 | Open in IMG/M |
| 3300002568|C688J35102_120797522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1609 | Open in IMG/M |
| 3300002568|C688J35102_120950453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2885 | Open in IMG/M |
| 3300004009|Ga0055437_10117572 | Not Available | 799 | Open in IMG/M |
| 3300004081|Ga0063454_100213142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1113 | Open in IMG/M |
| 3300004082|Ga0062384_100934985 | Not Available | 616 | Open in IMG/M |
| 3300004091|Ga0062387_100803696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 701 | Open in IMG/M |
| 3300004092|Ga0062389_104882681 | Not Available | 505 | Open in IMG/M |
| 3300004156|Ga0062589_100188715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1471 | Open in IMG/M |
| 3300004463|Ga0063356_100113064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2987 | Open in IMG/M |
| 3300004463|Ga0063356_103062477 | Not Available | 720 | Open in IMG/M |
| 3300004643|Ga0062591_101515747 | Not Available | 671 | Open in IMG/M |
| 3300005179|Ga0066684_10732974 | Not Available | 659 | Open in IMG/M |
| 3300005180|Ga0066685_10700510 | Not Available | 695 | Open in IMG/M |
| 3300005330|Ga0070690_100837705 | Not Available | 716 | Open in IMG/M |
| 3300005336|Ga0070680_100470231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1074 | Open in IMG/M |
| 3300005338|Ga0068868_100622058 | Not Available | 959 | Open in IMG/M |
| 3300005366|Ga0070659_101352868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 632 | Open in IMG/M |
| 3300005435|Ga0070714_100210037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1784 | Open in IMG/M |
| 3300005435|Ga0070714_101851126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 589 | Open in IMG/M |
| 3300005436|Ga0070713_100180005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 1899 | Open in IMG/M |
| 3300005451|Ga0066681_10307153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 971 | Open in IMG/M |
| 3300005454|Ga0066687_10894886 | Not Available | 529 | Open in IMG/M |
| 3300005456|Ga0070678_100924959 | Not Available | 798 | Open in IMG/M |
| 3300005458|Ga0070681_10132091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2429 | Open in IMG/M |
| 3300005466|Ga0070685_10655497 | Not Available | 761 | Open in IMG/M |
| 3300005529|Ga0070741_10861681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 786 | Open in IMG/M |
| 3300005532|Ga0070739_10107775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1559 | Open in IMG/M |
| 3300005535|Ga0070684_100987926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 790 | Open in IMG/M |
| 3300005538|Ga0070731_10022446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4346 | Open in IMG/M |
| 3300005541|Ga0070733_10236132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300005542|Ga0070732_10042163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2624 | Open in IMG/M |
| 3300005542|Ga0070732_10241072 | Not Available | 1082 | Open in IMG/M |
| 3300005542|Ga0070732_10924640 | Not Available | 533 | Open in IMG/M |
| 3300005544|Ga0070686_100452686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 987 | Open in IMG/M |
| 3300005555|Ga0066692_10450995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 819 | Open in IMG/M |
| 3300005560|Ga0066670_10515250 | Not Available | 734 | Open in IMG/M |
| 3300005560|Ga0066670_11003018 | Not Available | 510 | Open in IMG/M |
| 3300005563|Ga0068855_101528055 | Not Available | 685 | Open in IMG/M |
| 3300005566|Ga0066693_10236223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium TMPK1 | 721 | Open in IMG/M |
| 3300005576|Ga0066708_10040838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2547 | Open in IMG/M |
| 3300005602|Ga0070762_10208294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1199 | Open in IMG/M |
| 3300005607|Ga0070740_10070135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum brasilense | 1675 | Open in IMG/M |
| 3300005764|Ga0066903_100614050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1889 | Open in IMG/M |
| 3300005842|Ga0068858_100773745 | Not Available | 936 | Open in IMG/M |
| 3300005891|Ga0075283_1031976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 861 | Open in IMG/M |
| 3300005904|Ga0075280_10062319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 727 | Open in IMG/M |
| 3300006032|Ga0066696_10375778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 927 | Open in IMG/M |
| 3300006046|Ga0066652_100943144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 822 | Open in IMG/M |
| 3300006794|Ga0066658_10677259 | Not Available | 567 | Open in IMG/M |
| 3300006796|Ga0066665_11683455 | Not Available | 502 | Open in IMG/M |
| 3300006797|Ga0066659_11127527 | Not Available | 656 | Open in IMG/M |
| 3300006797|Ga0066659_11226064 | Not Available | 626 | Open in IMG/M |
| 3300006797|Ga0066659_11372027 | Not Available | 590 | Open in IMG/M |
| 3300006800|Ga0066660_11274396 | Not Available | 575 | Open in IMG/M |
| 3300006871|Ga0075434_101202415 | Not Available | 770 | Open in IMG/M |
| 3300006893|Ga0073928_10000054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 251702 | Open in IMG/M |
| 3300007821|Ga0104323_131106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4014 | Open in IMG/M |
| 3300007982|Ga0102924_1083270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1679 | Open in IMG/M |
| 3300009012|Ga0066710_101550768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1019 | Open in IMG/M |
| 3300009038|Ga0099829_10653891 | Not Available | 874 | Open in IMG/M |
| 3300009038|Ga0099829_10715504 | Not Available | 832 | Open in IMG/M |
| 3300009038|Ga0099829_11113720 | Not Available | 654 | Open in IMG/M |
| 3300009089|Ga0099828_11766360 | Not Available | 543 | Open in IMG/M |
| 3300009090|Ga0099827_10035310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3651 | Open in IMG/M |
| 3300009090|Ga0099827_10356825 | Not Available | 1244 | Open in IMG/M |
| 3300009090|Ga0099827_11445410 | Not Available | 598 | Open in IMG/M |
| 3300009093|Ga0105240_10283726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1901 | Open in IMG/M |
| 3300009094|Ga0111539_11207565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 878 | Open in IMG/M |
| 3300009137|Ga0066709_100535120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1657 | Open in IMG/M |
| 3300009137|Ga0066709_102208148 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae | 759 | Open in IMG/M |
| 3300009137|Ga0066709_103214543 | Not Available | 595 | Open in IMG/M |
| 3300009147|Ga0114129_11094290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 998 | Open in IMG/M |
| 3300009156|Ga0111538_11730578 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300009162|Ga0075423_13009514 | Not Available | 516 | Open in IMG/M |
| 3300009444|Ga0114945_10276165 | Not Available | 986 | Open in IMG/M |
| 3300009610|Ga0105340_1071382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1369 | Open in IMG/M |
| 3300009777|Ga0105164_10158310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 1159 | Open in IMG/M |
| 3300009789|Ga0126307_10137257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1954 | Open in IMG/M |
| 3300010037|Ga0126304_10305360 | Not Available | 1054 | Open in IMG/M |
| 3300010038|Ga0126315_10181622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1260 | Open in IMG/M |
| 3300010040|Ga0126308_11250043 | Not Available | 527 | Open in IMG/M |
| 3300010045|Ga0126311_10576182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 889 | Open in IMG/M |
| 3300010159|Ga0099796_10112535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1038 | Open in IMG/M |
| 3300010159|Ga0099796_10308859 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010359|Ga0126376_11146998 | Not Available | 789 | Open in IMG/M |
| 3300010373|Ga0134128_10693363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1131 | Open in IMG/M |
| 3300010391|Ga0136847_10919694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2415 | Open in IMG/M |
| 3300010397|Ga0134124_12997544 | Not Available | 516 | Open in IMG/M |
| 3300010399|Ga0134127_12039591 | Not Available | 652 | Open in IMG/M |
| 3300010401|Ga0134121_10270893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 1493 | Open in IMG/M |
| 3300011269|Ga0137392_10720764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium TMPK1 | 825 | Open in IMG/M |
| 3300011269|Ga0137392_10746804 | Not Available | 809 | Open in IMG/M |
| 3300011444|Ga0137463_1205769 | Not Available | 737 | Open in IMG/M |
| 3300012189|Ga0137388_10726552 | Not Available | 922 | Open in IMG/M |
| 3300012202|Ga0137363_10155178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1802 | Open in IMG/M |
| 3300012202|Ga0137363_10237909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 1476 | Open in IMG/M |
| 3300012206|Ga0137380_10668444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 904 | Open in IMG/M |
| 3300012207|Ga0137381_11450652 | Not Available | 578 | Open in IMG/M |
| 3300012211|Ga0137377_11198909 | Not Available | 689 | Open in IMG/M |
| 3300012212|Ga0150985_105095277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 1058 | Open in IMG/M |
| 3300012212|Ga0150985_107948865 | Not Available | 562 | Open in IMG/M |
| 3300012212|Ga0150985_109374436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2390 | Open in IMG/M |
| 3300012212|Ga0150985_113725710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 754 | Open in IMG/M |
| 3300012212|Ga0150985_114264016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium TMPK1 | 1015 | Open in IMG/M |
| 3300012212|Ga0150985_115702671 | Not Available | 618 | Open in IMG/M |
| 3300012212|Ga0150985_117466109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 954 | Open in IMG/M |
| 3300012212|Ga0150985_117532773 | Not Available | 580 | Open in IMG/M |
| 3300012359|Ga0137385_10512483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1014 | Open in IMG/M |
| 3300012359|Ga0137385_11134740 | Not Available | 642 | Open in IMG/M |
| 3300012363|Ga0137390_11151460 | Not Available | 724 | Open in IMG/M |
| 3300012363|Ga0137390_11852855 | Not Available | 533 | Open in IMG/M |
| 3300012469|Ga0150984_103161022 | Not Available | 684 | Open in IMG/M |
| 3300012469|Ga0150984_108410753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium TMPK1 | 813 | Open in IMG/M |
| 3300012469|Ga0150984_108704863 | Not Available | 690 | Open in IMG/M |
| 3300012469|Ga0150984_108888967 | Not Available | 1126 | Open in IMG/M |
| 3300012469|Ga0150984_110876625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 722 | Open in IMG/M |
| 3300012469|Ga0150984_121510719 | Not Available | 622 | Open in IMG/M |
| 3300012683|Ga0137398_10638400 | Not Available | 738 | Open in IMG/M |
| 3300012683|Ga0137398_11035716 | Not Available | 568 | Open in IMG/M |
| 3300012685|Ga0137397_10361389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 1082 | Open in IMG/M |
| 3300012895|Ga0157309_10209697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 615 | Open in IMG/M |
| 3300012917|Ga0137395_10844057 | Not Available | 663 | Open in IMG/M |
| 3300012923|Ga0137359_10694078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium TMPK1 | 887 | Open in IMG/M |
| 3300012923|Ga0137359_11146411 | Not Available | 664 | Open in IMG/M |
| 3300012927|Ga0137416_10436408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 1117 | Open in IMG/M |
| 3300012930|Ga0137407_10155190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum brasilense | 2026 | Open in IMG/M |
| 3300012931|Ga0153915_12956408 | Not Available | 554 | Open in IMG/M |
| 3300012955|Ga0164298_11131065 | Not Available | 588 | Open in IMG/M |
| 3300013296|Ga0157374_10603091 | Not Available | 1108 | Open in IMG/M |
| 3300013297|Ga0157378_11594412 | Not Available | 698 | Open in IMG/M |
| 3300013297|Ga0157378_11831045 | Not Available | 655 | Open in IMG/M |
| 3300013764|Ga0120111_1118133 | Not Available | 618 | Open in IMG/M |
| 3300014166|Ga0134079_10486195 | Not Available | 593 | Open in IMG/M |
| 3300014501|Ga0182024_10003726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 35935 | Open in IMG/M |
| 3300015241|Ga0137418_10736919 | Not Available | 749 | Open in IMG/M |
| 3300015262|Ga0182007_10439713 | Not Available | 501 | Open in IMG/M |
| 3300015373|Ga0132257_103779288 | Not Available | 551 | Open in IMG/M |
| 3300016750|Ga0181505_10334240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300017823|Ga0187818_10000761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12167 | Open in IMG/M |
| 3300017970|Ga0187783_10470682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 911 | Open in IMG/M |
| 3300017970|Ga0187783_10547330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 838 | Open in IMG/M |
| 3300017972|Ga0187781_10329519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1085 | Open in IMG/M |
| 3300017975|Ga0187782_10155185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1704 | Open in IMG/M |
| 3300017975|Ga0187782_10816685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300017975|Ga0187782_11119226 | Not Available | 615 | Open in IMG/M |
| 3300018429|Ga0190272_11764751 | Not Available | 644 | Open in IMG/M |
| 3300018433|Ga0066667_12278955 | Not Available | 506 | Open in IMG/M |
| 3300018466|Ga0190268_12018889 | Not Available | 531 | Open in IMG/M |
| 3300018482|Ga0066669_10881899 | Not Available | 799 | Open in IMG/M |
| 3300019767|Ga0190267_11092693 | Not Available | 572 | Open in IMG/M |
| 3300019786|Ga0182025_1151666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1877 | Open in IMG/M |
| 3300019879|Ga0193723_1041058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1375 | Open in IMG/M |
| 3300019888|Ga0193751_1250643 | Not Available | 545 | Open in IMG/M |
| 3300020020|Ga0193738_1074886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum oryzae | 993 | Open in IMG/M |
| 3300020076|Ga0206355_1169061 | Not Available | 587 | Open in IMG/M |
| 3300020580|Ga0210403_10695850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium TMPK1 | 815 | Open in IMG/M |
| 3300020582|Ga0210395_11323858 | Not Available | 527 | Open in IMG/M |
| 3300021086|Ga0179596_10114501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1244 | Open in IMG/M |
| 3300021184|Ga0196959_10113955 | Not Available | 633 | Open in IMG/M |
| 3300021388|Ga0213875_10002319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 11514 | Open in IMG/M |
| 3300021388|Ga0213875_10014833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3797 | Open in IMG/M |
| 3300021388|Ga0213875_10374733 | Not Available | 677 | Open in IMG/M |
| 3300021420|Ga0210394_10006976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 12055 | Open in IMG/M |
| 3300021861|Ga0213853_10793481 | Not Available | 527 | Open in IMG/M |
| 3300022467|Ga0224712_10563441 | Not Available | 554 | Open in IMG/M |
| 3300022557|Ga0212123_10000129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 251829 | Open in IMG/M |
| 3300022557|Ga0212123_10225148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1367 | Open in IMG/M |
| 3300022563|Ga0212128_10400609 | Not Available | 850 | Open in IMG/M |
| 3300022724|Ga0242665_10230089 | Not Available | 623 | Open in IMG/M |
| 3300024330|Ga0137417_1506984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1301 | Open in IMG/M |
| 3300025173|Ga0209824_10250895 | Not Available | 615 | Open in IMG/M |
| 3300025899|Ga0207642_11080311 | Not Available | 518 | Open in IMG/M |
| 3300025901|Ga0207688_10377026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 877 | Open in IMG/M |
| 3300025903|Ga0207680_10949563 | Not Available | 616 | Open in IMG/M |
| 3300025912|Ga0207707_10073385 | All Organisms → cellular organisms → Bacteria | 2984 | Open in IMG/M |
| 3300025912|Ga0207707_10307572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 1370 | Open in IMG/M |
| 3300025912|Ga0207707_11552379 | Not Available | 523 | Open in IMG/M |
| 3300025917|Ga0207660_10841316 | Not Available | 749 | Open in IMG/M |
| 3300025928|Ga0207700_10586167 | Not Available | 992 | Open in IMG/M |
| 3300025930|Ga0207701_10959509 | Not Available | 714 | Open in IMG/M |
| 3300025931|Ga0207644_10694118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 849 | Open in IMG/M |
| 3300025931|Ga0207644_11248095 | Not Available | 625 | Open in IMG/M |
| 3300025932|Ga0207690_11399266 | Not Available | 585 | Open in IMG/M |
| 3300025940|Ga0207691_10540746 | Not Available | 988 | Open in IMG/M |
| 3300025949|Ga0207667_10297666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 1648 | Open in IMG/M |
| 3300025949|Ga0207667_11532419 | Not Available | 637 | Open in IMG/M |
| 3300026023|Ga0207677_11025721 | Not Available | 749 | Open in IMG/M |
| 3300026035|Ga0207703_10612826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1030 | Open in IMG/M |
| 3300026312|Ga0209153_1245500 | Not Available | 579 | Open in IMG/M |
| 3300026319|Ga0209647_1068250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1812 | Open in IMG/M |
| 3300026323|Ga0209472_1016974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3537 | Open in IMG/M |
| 3300026359|Ga0257163_1078840 | Not Available | 533 | Open in IMG/M |
| 3300027660|Ga0209736_1048946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 1207 | Open in IMG/M |
| 3300027667|Ga0209009_1065990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 909 | Open in IMG/M |
| 3300027765|Ga0209073_10376973 | Not Available | 577 | Open in IMG/M |
| 3300027773|Ga0209810_1108419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1232 | Open in IMG/M |
| 3300027842|Ga0209580_10014210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3468 | Open in IMG/M |
| 3300027846|Ga0209180_10272700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 971 | Open in IMG/M |
| 3300027846|Ga0209180_10497019 | Not Available | 683 | Open in IMG/M |
| 3300027855|Ga0209693_10261007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 848 | Open in IMG/M |
| 3300027867|Ga0209167_10121750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1351 | Open in IMG/M |
| 3300027867|Ga0209167_10155993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1200 | Open in IMG/M |
| 3300027869|Ga0209579_10003089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 12313 | Open in IMG/M |
| 3300027869|Ga0209579_10536063 | Not Available | 635 | Open in IMG/M |
| 3300027875|Ga0209283_10735831 | Not Available | 613 | Open in IMG/M |
| 3300027882|Ga0209590_10407439 | Not Available | 878 | Open in IMG/M |
| 3300027905|Ga0209415_10032588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 7416 | Open in IMG/M |
| 3300028380|Ga0268265_10796822 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 921 | Open in IMG/M |
| 3300028536|Ga0137415_10575738 | Not Available | 936 | Open in IMG/M |
| 3300030730|Ga0307482_1071145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 896 | Open in IMG/M |
| 3300030937|Ga0138302_1830492 | Not Available | 559 | Open in IMG/M |
| 3300030981|Ga0102770_11259334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 736 | Open in IMG/M |
| 3300030988|Ga0308183_1076087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 724 | Open in IMG/M |
| 3300031039|Ga0102760_10937829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
| 3300031058|Ga0308189_10216495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 704 | Open in IMG/M |
| 3300031091|Ga0308201_10293058 | Not Available | 577 | Open in IMG/M |
| 3300031670|Ga0307374_10047536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4512 | Open in IMG/M |
| 3300031670|Ga0307374_10083765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2908 | Open in IMG/M |
| 3300031740|Ga0307468_101239070 | Not Available | 675 | Open in IMG/M |
| 3300031897|Ga0318520_10871326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300031938|Ga0308175_101147865 | Not Available | 863 | Open in IMG/M |
| 3300031938|Ga0308175_103270773 | Not Available | 502 | Open in IMG/M |
| 3300031962|Ga0307479_10263178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1704 | Open in IMG/M |
| 3300031965|Ga0326597_10020314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 8601 | Open in IMG/M |
| 3300031965|Ga0326597_10043315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 5672 | Open in IMG/M |
| 3300031965|Ga0326597_10374009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1593 | Open in IMG/M |
| 3300031996|Ga0308176_10906426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 926 | Open in IMG/M |
| 3300032074|Ga0308173_11164265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium TMPK1 | 720 | Open in IMG/M |
| 3300032180|Ga0307471_103568744 | Not Available | 550 | Open in IMG/M |
| 3300032892|Ga0335081_10171331 | All Organisms → cellular organisms → Bacteria | 3061 | Open in IMG/M |
| 3300032892|Ga0335081_10466806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1600 | Open in IMG/M |
| 3300033158|Ga0335077_12117627 | Not Available | 519 | Open in IMG/M |
| 3300033407|Ga0214472_11786232 | Not Available | 518 | Open in IMG/M |
| 3300033486|Ga0316624_10517298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1024 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.30% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.94% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.10% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.52% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.26% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.26% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.84% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.84% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.84% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.84% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.84% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.84% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.42% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.42% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.42% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030981 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031039 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_01856080 | 2124908044 | Soil | MLIGSTIVVCTLLSMMLGQIAMSMEAIGVLLAAGVLMSVQRE |
| A_all_C_02446490 | 2140918007 | Soil | GSPNGTLAMPMLIGSTIVVCTLLSMMLGQIAMSMEAIGVLLAAGVLMSVQRE |
| JGI12269J14319_100998932 | 3300001356 | Peatlands Soil | MPMLIGSATVVCTLLSMILGQVAMGTEAIGVLLAAIVLMSVQRE* |
| C688J35102_1195639541 | 3300002568 | Soil | MPMLLGSTTMACTLFSMMLGQVALGMESLGVLLAALVLMSLQRE* |
| C688J35102_1207975223 | 3300002568 | Soil | MPMLLGSTTLACTLFSIMLGQVAFGMESLGVLLASLVLMSLQRE* |
| C688J35102_1209504533 | 3300002568 | Soil | MPLLIGSATVISTLLSISLGQVAMGTEALGVLLAAFVVMSLQRE* |
| Ga0055437_101175721 | 3300004009 | Natural And Restored Wetlands | MPMLMGSAIVVCTLVSMMLGQIAIGMEAIGVLLAALVLMSLQRE* |
| Ga0063454_1002131421 | 3300004081 | Soil | MPMLLGSATMACTLFSMMLGQVALGMESLGVLLAALVLMSLQRE* |
| Ga0062384_1009349851 | 3300004082 | Bog Forest Soil | MPMLIGSATVVCTLLSMMLGQIAMGTEAIGVLLAALVLMSVQRE* |
| Ga0062387_1008036962 | 3300004091 | Bog Forest Soil | MPMLIGSATVVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0062389_1048826811 | 3300004092 | Bog Forest Soil | MPMLLGSTIVVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0062589_1001887152 | 3300004156 | Soil | MPMLLGSATMACTLFGMMLGQVALGMESLGVLLAALVLMSLQRE* |
| Ga0063356_1001130644 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPMLIGSTTAAVTLLSMMLGQITMGMEALGVLLAAFVLMSLQRE* |
| Ga0063356_1030624771 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPMLLGSTTVVCTLLSMMLGQITVGVEALGVLLAAGVLMSLQRE* |
| Ga0062591_1015157472 | 3300004643 | Soil | ELLSFGAPAMPMLLGSTTVVCTLLSMMLGQITVGVEALGVLLAAGVLMSLQRE* |
| Ga0066684_107329742 | 3300005179 | Soil | MPLLIGSATVVSTLLSISLGQVAMGTEALGVLLAAFVVMSLQRE* |
| Ga0066685_107005102 | 3300005180 | Soil | MPMLLGSMTVICTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE* |
| Ga0070690_1008377051 | 3300005330 | Switchgrass Rhizosphere | LLSFGAPAMPMLLGSTTVVCTLLSMMLGQITVGVEALGVLLAAGVLMSLQRE* |
| Ga0070680_1004702312 | 3300005336 | Corn Rhizosphere | MPMLLGATTIFCTLLSIMLGQITMGAEALGVMLAAFVLMSVQRE* |
| Ga0068868_1006220582 | 3300005338 | Miscanthus Rhizosphere | MPMLLGSTTAVCTLLSMMLGQINVGVEALGVLLAAGLLMSLQRE* |
| Ga0070659_1013528681 | 3300005366 | Corn Rhizosphere | MPMLLGSATMACTLFSMILGQVALGMESLGVLLAALVLMSLQRE* |
| Ga0070714_1002100373 | 3300005435 | Agricultural Soil | MPLLLGAATLASTLLSISLGQVAMGTEALGVMLAALVLMSLQRE* |
| Ga0070714_1018511262 | 3300005435 | Agricultural Soil | MPMLLGSATVACTLLSLMLGQITMGMEALGVLLAAFVLMSVQRE* |
| Ga0070713_1001800051 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFAAMPLLLGSTIVVCTLFSMMLGQIAMSMEAVGVLLAACVLMTVQRE* |
| Ga0066681_103071532 | 3300005451 | Soil | MPMLIGSTIVVCTLFSMMLGQIAMSMEAVGVLLAAFVLMTVQRE* |
| Ga0066687_108948862 | 3300005454 | Soil | AVNRIAPMPLLIGSATVVSTLLSISLGQVAMGTEALGVLLAAFVVMSLQRE* |
| Ga0070678_1009249592 | 3300005456 | Miscanthus Rhizosphere | MPMLLGSTTVICTLLSMMLGQITVGVEALGVLLAAGVLMSLQRE* |
| Ga0070681_101320913 | 3300005458 | Corn Rhizosphere | MPMLIGSTTVVCTLLSMMLGQITVGIEALGVLLAAGVLMSLQRE* |
| Ga0070685_106554972 | 3300005466 | Switchgrass Rhizosphere | MPMLLGSTTVVCTLLSMMLGQINVGVEALGVLLAAGLLMSLQRE* |
| Ga0070741_108616811 | 3300005529 | Surface Soil | MPMLLGSATLACTLFSMLLGQIAVGMESLGVLLAALVLMSLQPE* |
| Ga0070739_101077751 | 3300005532 | Surface Soil | MPLLLGSTTVVCTLLGLLLGQVTMGMEAAGVLLAACVVMSLQRE* |
| Ga0070684_1009879261 | 3300005535 | Corn Rhizosphere | LIGSTTVVCTLLSMMLGQITMGIEALGVLLAAFVLMSLQRE* |
| Ga0070731_100224464 | 3300005538 | Surface Soil | MPMLLGSAIVFCTLLSMILGQVTLGMEAIGVLLAALVLMSVQRE* |
| Ga0070733_102361322 | 3300005541 | Surface Soil | MPMLLGSAIVVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0070732_100421632 | 3300005542 | Surface Soil | MPMLLGSTIVVCTLLSMMLGQIAMGMEAIGVLLAALVLMTVQRE* |
| Ga0070732_102410722 | 3300005542 | Surface Soil | MPMLIGATTVFCVLLSMMLGQIAVGMESLGVLLAAFVLMSLQRE* |
| Ga0070732_109246402 | 3300005542 | Surface Soil | MPMLIGSTIVICTLFSMMLGQIAMSMEAIGVLLAALVLMSVQRE* |
| Ga0070686_1004526861 | 3300005544 | Switchgrass Rhizosphere | GSATMACTLFGMMLGQVALGMESLGVLLAALVLMSLQRE* |
| Ga0066692_104509952 | 3300005555 | Soil | VVCTLLSMMLGQITMGMEAVGVLLAALVLMSVQRE* |
| Ga0066670_105152502 | 3300005560 | Soil | MPMLLGSTTFVCTLLSMMLGQITMGVEALGVLLAAVVLMSLQRE* |
| Ga0066670_110030182 | 3300005560 | Soil | MPLLIGSATLACTLLSLSLGQVTMGMQALGVMLASVVVMTLRRE* |
| Ga0068855_1015280552 | 3300005563 | Corn Rhizosphere | MPMLIGSTTVVCTLLSMMLGQITMGIEALGVLLAAFVLMSLQRE* |
| Ga0066693_102362232 | 3300005566 | Soil | LACTLLSMALGQIAVGMEGVGVLLASLVLMSLQRE* |
| Ga0066708_100408384 | 3300005576 | Soil | TLACTLLSMALGQIAVGMEGVGVLLASLVLMSLQRE* |
| Ga0070762_102082942 | 3300005602 | Soil | MPLLIGSATVVSMLLSLSLGQVTMGMEAVGVLLAAIVVMSLQRE* |
| Ga0070740_100701352 | 3300005607 | Surface Soil | MPMLIGATTAACTLLSMMLGQITLGMESLGVLLAALVLMSLQPE* |
| Ga0066903_1006140502 | 3300005764 | Tropical Forest Soil | MPLLLGAATVVSTLLSISLGQVAMGTEALGVLLAALVLMSLQRE* |
| Ga0068858_1007737453 | 3300005842 | Switchgrass Rhizosphere | MPMLIGSTTVVCTLLSMMLGQITVGIEALGVLLAA |
| Ga0075283_10319762 | 3300005891 | Rice Paddy Soil | MPMLIGSATVACTLGSMMLGQIAVGMEAIGVVLAGLVLMSLQRE* |
| Ga0075280_100623192 | 3300005904 | Rice Paddy Soil | LGSATVACTLVSMLVGQVAVGMEAIGVVLAGLVLMSVQRE* |
| Ga0066696_103757783 | 3300006032 | Soil | MPLLIGSATLVSTLLSLSLGQVAMGTEALGVMLAALVVMSLQRE* |
| Ga0066652_1009431442 | 3300006046 | Soil | MPMLLGSTTVICTLLSMMLGQITMGMEAIGALLAALVLMSVQRE* |
| Ga0066658_106772591 | 3300006794 | Soil | TLPPTLLTISLGQVAMGTEALGVMLAALVLMSLQRE* |
| Ga0066665_116834552 | 3300006796 | Soil | MPMLLGSTTVVCTLLSMMLGQIAMSMEAIGVLLAALVLMSVQ |
| Ga0066659_111275272 | 3300006797 | Soil | MPYGTAAMPMLLGSTTVVCTLLSMMLGQIAMSMEAIGVLLAALVLMSVQRE* |
| Ga0066659_112260642 | 3300006797 | Soil | MPMLLGSATFLCTLLSMMLGQITIGVEPLGVLLASVVVMSLQRE* |
| Ga0066659_113720271 | 3300006797 | Soil | NAASSPAVNRIAPMPLLIGSATVVSTLLSISLGQVAMGTEALGVLLAAFVVMSLQRE* |
| Ga0066660_112743962 | 3300006800 | Soil | MPMLLGSTTVFCTLLSMMLGQIAVGMEAIGVVLAALVLMSVQRE* |
| Ga0075434_1012024152 | 3300006871 | Populus Rhizosphere | MPMLIGSTIVVCTLLSMMLGQIAMSMEAIGVLLAALVLMTVQRE* |
| Ga0073928_10000054130 | 3300006893 | Iron-Sulfur Acid Spring | MPMLIGSTIVVCTLFSMMLGQIAMGMEAAGVLLAAVVLMSVQHE* |
| Ga0104323_1311065 | 3300007821 | Soil | MPMLIGSTIVVCTLLSMMLGQIAMGTEAIGVLLAALVLMSVQRE* |
| Ga0102924_10832702 | 3300007982 | Iron-Sulfur Acid Spring | MPMLIGSLTVFCTLFSAALGEITPGIQTLGVLLAAGVLMSLQRE* |
| Ga0066710_1015507681 | 3300009012 | Grasslands Soil | MPMLLGSTTVVCTLLSMMLGQIAMSMEAIGVLLAALVLMSVQRE |
| Ga0099829_106538912 | 3300009038 | Vadose Zone Soil | MPMLLGSTTVICTLLSMMLGQITIGMEAIGVLLAALVLMSVQRE* |
| Ga0099829_107155042 | 3300009038 | Vadose Zone Soil | MPMLLGSTTVVCTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE* |
| Ga0099829_111137202 | 3300009038 | Vadose Zone Soil | MPMLIGSTTVACTLLSMMLGQIAMGMEAIGVVLAALVLMSVQRE* |
| Ga0099828_117663602 | 3300009089 | Vadose Zone Soil | VCTLLSMMLGQITMGMEALGVLLAAFVLMSVQRE* |
| Ga0099827_100353105 | 3300009090 | Vadose Zone Soil | MPMLLGSTTVICTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE* |
| Ga0099827_103568253 | 3300009090 | Vadose Zone Soil | MPMLLGSTTFVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0099827_114454102 | 3300009090 | Vadose Zone Soil | MPMLLGSTTVVCILLSMMLGQITMGMEAIGVLLAALVLMSVQRE* |
| Ga0105240_102837264 | 3300009093 | Corn Rhizosphere | MPMLIGSTTAACTLLCIITGQIALGVEALGVLIGAGVLMSLRRD* |
| Ga0111539_112075652 | 3300009094 | Populus Rhizosphere | MPMLIGSTTVICTLLSMMLGQITVGIEALGVLLAAGVLMSLQRE* |
| Ga0066709_1005351202 | 3300009137 | Grasslands Soil | MPMLLGSTTVVCTLLSMMLGQIAMSMEAIGVLLAALVLMSVQRE* |
| Ga0066709_1022081481 | 3300009137 | Grasslands Soil | MPMLLGSTTFVCTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE* |
| Ga0066709_1032145432 | 3300009137 | Grasslands Soil | MPMLLGSTTVICTLLSMMLGQITMGMEAVGVLLAALVLMSVQRE* |
| Ga0114129_110942903 | 3300009147 | Populus Rhizosphere | MPMLIGSTTMVCTLLSMMLGQITVGMEALGVLLASAVVM |
| Ga0111538_117305782 | 3300009156 | Populus Rhizosphere | MPLLLGSATLACTLFSMLLGQVALGMESLGVLLASIVLMSL |
| Ga0075423_130095142 | 3300009162 | Populus Rhizosphere | MPMLIGSTIVVCTLFSMMLGQIAMSMEAIGVLLAALVLMTVQRE* |
| Ga0114945_102761651 | 3300009444 | Thermal Springs | MPMLMGSAIVVCTLVSMVLGQIAIGMEAIGVLLAALVLMSFQRE* |
| Ga0105340_10713822 | 3300009610 | Soil | MPMLIGSTVVVCTLFSMMLGQIAMSMEAIGVLLAALVLMTVQRE* |
| Ga0105164_101583102 | 3300009777 | Wastewater | MPMLIGSTIVVCTLLSMILGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0126307_101372572 | 3300009789 | Serpentine Soil | MPMLIGSTTMVCTLLSMMLGQITVGMEAAGVLLASAVLMSLQRE* |
| Ga0126304_103053602 | 3300010037 | Serpentine Soil | MPMLIGSTTMVCTLLSMMLGQITVGMEALGVLLASAVLMSLQRE* |
| Ga0126315_101816222 | 3300010038 | Serpentine Soil | MPMLIGSTTMVCTVLSMMLGQITVGMEALGVLLASAVLMSLQRE* |
| Ga0126308_112500431 | 3300010040 | Serpentine Soil | LSPAVNRIAPMPLLIGSATVVSTLLSISLGQVAMGTEALGVLLAAFVVMSLQRE* |
| Ga0126311_105761821 | 3300010045 | Serpentine Soil | MLLGSTMLACTLFSMLLGQIALGMESLGVLIASLVLMSLQRE* |
| Ga0099796_101125353 | 3300010159 | Vadose Zone Soil | LSLSVNFRITPMPLLIGSTTLACTLLSRAIGQIAVGMEGVGVVLASLVLMSLQRE* |
| Ga0099796_103088592 | 3300010159 | Vadose Zone Soil | MPMLLGSTTVVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0126376_111469982 | 3300010359 | Tropical Forest Soil | MPLLLGSATFACTLLSLALGEVTMGIQALGVLLAALVLMSLQRE* |
| Ga0134128_106933631 | 3300010373 | Terrestrial Soil | MPMLLGSTTVICTLISMMLGQINMGMETIGVLLAAGVLMSVQRE* |
| Ga0136847_109196942 | 3300010391 | Freshwater Sediment | MPMLIGSTIVVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0134124_129975441 | 3300010397 | Terrestrial Soil | MPMLLGSATMACTLFGMMLGQVALGMESLGVLLAALVLMSLQPE* |
| Ga0134127_120395911 | 3300010399 | Terrestrial Soil | MPMLLGSTTVICTLLSMMLGQITVGVEALGVLLAAGVLMRLQRE* |
| Ga0134121_102708932 | 3300010401 | Terrestrial Soil | MPMLLGSTTLVCTLLSMALGEVAMGLQVPGEALGALVVMSLQRE* |
| Ga0137392_107207642 | 3300011269 | Vadose Zone Soil | MPMLLGSTTLVCTLFSMMLGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0137392_107468042 | 3300011269 | Vadose Zone Soil | MPMLLGSTTVVCTLLSMMLGQITMGMEAIGVLLAALVLMSV |
| Ga0137463_12057692 | 3300011444 | Soil | VCTLFSMMLGQIAMGMEAIGVLLAALVLMTVQRE* |
| Ga0137388_107265522 | 3300012189 | Vadose Zone Soil | MPLLLGSTILLSTLLSMALGQIALRMDAIGVMLAALVLMSLQRE* |
| Ga0137363_101551783 | 3300012202 | Vadose Zone Soil | MPMLLGSTTVVCTLLSVMLGQISMGMEAIGVLLAALVLMTVQRE* |
| Ga0137363_102379092 | 3300012202 | Vadose Zone Soil | LGTAAMPMLLGSTTVVCTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE* |
| Ga0137380_106684442 | 3300012206 | Vadose Zone Soil | MPMLLGSTTFVCTLLSMMLGQIAMSMEAIGVLLAALVLMSVQRE* |
| Ga0137381_114506522 | 3300012207 | Vadose Zone Soil | MPMLIGSTIVVCTLLSMMLGQITMGMEAIGVLLAAFVLMSVQRE* |
| Ga0137377_111989092 | 3300012211 | Vadose Zone Soil | MPMLLGSTIVVCTLLSMILGQIAMSMEAIGVLLAALVLMSVQRE* |
| Ga0150985_1050952771 | 3300012212 | Avena Fatua Rhizosphere | PVNPAQKNGRRAMPMLLGSTTLACTLFSMMLGQVAFGMESLGVLLASLVLMSLQRE* |
| Ga0150985_1079488651 | 3300012212 | Avena Fatua Rhizosphere | TAQKNGRRAMPMLLGSTTLACTLFSMMLGQVALGMESLGVLLASLVLMSLQRE* |
| Ga0150985_1093744362 | 3300012212 | Avena Fatua Rhizosphere | MPMLLGSTTIFCTLLSLMLGQITMGAEALGVLLAAFVLMSVQRE* |
| Ga0150985_1137257102 | 3300012212 | Avena Fatua Rhizosphere | MPLLLGSTTLACTLFGMVLGQVALGMESAGVLLASLVLMSLQRE* |
| Ga0150985_1142640162 | 3300012212 | Avena Fatua Rhizosphere | MPLLLGSTTLACTLFGMILGQVALGMESAGVLLASLVLMSLQHE* |
| Ga0150985_1157026711 | 3300012212 | Avena Fatua Rhizosphere | PARKKGRRAMPMLLGSTTLACTMFSIMLGQVALGMESLGVLLASLVLMSLQRE* |
| Ga0150985_1174661091 | 3300012212 | Avena Fatua Rhizosphere | KRRRLMPMLLGSATMACTLFSMMLGQVTLGMESLGVLLAALVLMSLQRE* |
| Ga0150985_1175327732 | 3300012212 | Avena Fatua Rhizosphere | MPMLLGSTTVVCTLLSMMLGQITVGIEALGVLLAAFVLMSLQRE* |
| Ga0137385_105124832 | 3300012359 | Vadose Zone Soil | MPILLRSTTVICTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE* |
| Ga0137385_111347401 | 3300012359 | Vadose Zone Soil | MPMLIGSTIVVCTLFRMMLGQIAMSMEAMGVLLAAFVLMTVQRE* |
| Ga0137390_111514602 | 3300012363 | Vadose Zone Soil | MPMLLGSTTVACTLLSMMLGQIAMGMEAIGVVLAALVLMSVQRE* |
| Ga0137390_118528551 | 3300012363 | Vadose Zone Soil | MPMLLGSTTLVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0150984_1031610221 | 3300012469 | Avena Fatua Rhizosphere | VNPRIAPMPMLLGSTTIFCTLLSIMLGQVAMGMEALGVLLAAFVLMSVQRE* |
| Ga0150984_1084107531 | 3300012469 | Avena Fatua Rhizosphere | AMPMLIGSTTVVCTLLSMMLGQITVGIEALGVLLAAGVLMSLQRE* |
| Ga0150984_1087048631 | 3300012469 | Avena Fatua Rhizosphere | YPPMPMLLGSTTIFCTLLSLMLGQITMGAEALGVLLAAFVLMSVQRE* |
| Ga0150984_1088889671 | 3300012469 | Avena Fatua Rhizosphere | MPMLLGSTTLACTLFSMMLGQVALGMESLGVLLASLVLMSLQHE* |
| Ga0150984_1108766252 | 3300012469 | Avena Fatua Rhizosphere | MPMLLGSTTMACTLFSMMLGQVALGMESLGVLLASLVLMSLQRE* |
| Ga0150984_1215107191 | 3300012469 | Avena Fatua Rhizosphere | LGIAAMPMLIGSTIVVCTLFSMMLGQIAMSMEAIGVLLAALVLMTVQRE* |
| Ga0137398_106384002 | 3300012683 | Vadose Zone Soil | MPMLLGSATFACTLLSIALGEIAMGIQALGVLLAALVLMSLQRE* |
| Ga0137398_110357162 | 3300012683 | Vadose Zone Soil | GSTTVVCTLLSMMLGQIAMSMEAIGVLLAALVLMSVQRE* |
| Ga0137397_103613891 | 3300012685 | Vadose Zone Soil | TILLSTLLSMALGQIALGMEAIGVMLAALVLMSLQRE* |
| Ga0157309_102096972 | 3300012895 | Soil | VVCTLLSMMLGQITVGIEAFGVLLAAGVLMSLQRE* |
| Ga0137395_108440572 | 3300012917 | Vadose Zone Soil | ACTLLSMALGQVTMGIQALGVLLAAAVLMSLQRE* |
| Ga0137359_106940782 | 3300012923 | Vadose Zone Soil | GSTTVVCTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE* |
| Ga0137359_111464111 | 3300012923 | Vadose Zone Soil | MPMLIGSTIVGCTLLSMMLGQIAMGMEAVGVLLAALVLMSVQRE* |
| Ga0137416_104364081 | 3300012927 | Vadose Zone Soil | LLIGSTILLSTLLSMALGQIALGMEAIGVMLAALALMSLQRE* |
| Ga0137407_101551902 | 3300012930 | Vadose Zone Soil | MLLGSATFACTLLSIALGEIAMGIQALGVLLAALVLMSLQRE* |
| Ga0153915_129564082 | 3300012931 | Freshwater Wetlands | MPMLLGSAIVVCTLLSMMLGQITVGMEAIGVVLAALVLMSLQRE* |
| Ga0164298_111310652 | 3300012955 | Soil | MPMLLGSTTLVCTLLSMMLGQITVGIEALGVLLAAGVLMSLQRE* |
| Ga0157374_106030913 | 3300013296 | Miscanthus Rhizosphere | MLLGSTTVVCTLLSMMLGQINVGVEALGVLLAAGLLMSLQRE* |
| Ga0157378_115944122 | 3300013297 | Miscanthus Rhizosphere | MPLLIGSTTVVCTLLSMMLGQITVGIEALGVLLAAGVLMSLQRE* |
| Ga0157378_118310452 | 3300013297 | Miscanthus Rhizosphere | MPMLLGSTIVVCTLLSMMLGQIAIGMEAIGVLLAALVLMSVQRE* |
| Ga0120111_11181332 | 3300013764 | Permafrost | MPMLIGSTIVICTLFSMMLGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0134079_104861952 | 3300014166 | Grasslands Soil | TVVSTLLSISLGQVAMGTEALGVLLAAFVVMSLQRE* |
| Ga0182024_1000372624 | 3300014501 | Permafrost | MPMLIGSTIVVCTLFSMMLGQIAMGMEAIGVLLAALVLMSVQRE* |
| Ga0137418_107369192 | 3300015241 | Vadose Zone Soil | MPMLLGSTTVVCTLLSMMLGQIAMGMEAMGVLLAALVLMSVQRE* |
| Ga0182007_104397132 | 3300015262 | Rhizosphere | MPMLLGSATMACTLFSMILGQIALGMESLGVLLAALVLMSLQRE* |
| Ga0132257_1037792881 | 3300015373 | Arabidopsis Rhizosphere | MPMLLGSATMACTLFSMILGQVALGMESLGVLLAALVVMSLQRE* |
| Ga0181505_103342401 | 3300016750 | Peatland | MPMLIGSAILVCTLLSMMLGQIAVGMEAIGVLLAAVVLMSVQRE |
| Ga0187818_100007616 | 3300017823 | Freshwater Sediment | MPMLLGSTIVVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE |
| Ga0187783_104706822 | 3300017970 | Tropical Peatland | MPMLIGSAIVVCTLLSMMLGQVAMGTEAIGVLLAAFVLMSMQRE |
| Ga0187783_105473302 | 3300017970 | Tropical Peatland | MPMLIGSAIVVCTLLSMVLGQVAMGTEAIGVLLAAFVLMSMQRE |
| Ga0187781_103295192 | 3300017972 | Tropical Peatland | MPMLIGSAIVVCTLFSMMLGQVAMGTEAIGVLLAAFVLMSLQRE |
| Ga0187782_101551853 | 3300017975 | Tropical Peatland | MPMLIGSAIVVCTLLSMLLGQVAIGTEAIGVLLAAFVLMSLQRE |
| Ga0187782_108166851 | 3300017975 | Tropical Peatland | PNPLQRRFQGFVNPRFIRGIAAMPMLIGSAIVVCTLFSMMLGQVAMGTEAIGVLLAAFVLMSLQRE |
| Ga0187782_111192261 | 3300017975 | Tropical Peatland | MPMLIGSTIVVCTLLSMMLGQIAMGAEAIGVLLAAVVLMSLQRQ |
| Ga0190272_117647512 | 3300018429 | Soil | MACTLLSMMLGQISMGMEALGVLLASIVLMSLQREEL |
| Ga0066667_122789551 | 3300018433 | Grasslands Soil | MPMLLGSTTVVCTLLSMMLGQIAMSMEAIGVLLAALVLMSVQR |
| Ga0190268_120188892 | 3300018466 | Soil | MPMLIGSTTMACTLLSMMLGQISMGMEALGVLLASIVLMSLQREEL |
| Ga0066669_108818992 | 3300018482 | Grasslands Soil | MPLLIGSATVVSTLLSISLGQVAMGTEALGVLLAAFVVMSLQRE |
| Ga0190267_110926931 | 3300019767 | Soil | MPMLLGSATMACTLFSMMLGQVALGMESLGVLLAALVLMSLQRE |
| Ga0182025_11516663 | 3300019786 | Permafrost | MPMLIGSTIVVCTLFSMMLGQIAMGMEAIGVLLAALVLMSVQRE |
| Ga0193723_10410583 | 3300019879 | Soil | MPMLLGSTTVFCTLLSMMLGQIAVGMEAIGVVLAALVLMSVQRE |
| Ga0193751_12506432 | 3300019888 | Soil | MLIGSTTVACTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE |
| Ga0193738_10748862 | 3300020020 | Soil | MPMLIGSTTMACTLLSMMLGQISMGMEELGVLLASIVLMSLQREEL |
| Ga0206355_11690612 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | ATSTPDCPLMPMLLGATTIFCTLLSIMLGQITMGAEALGVMLAAFVLMSVQRE |
| Ga0210403_106958501 | 3300020580 | Soil | PGSQHGIAAMPMLIGSTIVICTLFSMMLGQIAMSMEAIGVLLAALVLMSVQRE |
| Ga0210395_113238581 | 3300020582 | Soil | MPMLIGSTIVVCTLLSMMLGQIAMGTEAIGVLLAAVVLMSVQRE |
| Ga0179596_101145012 | 3300021086 | Vadose Zone Soil | MPMLLGSTTLVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE |
| Ga0196959_101139552 | 3300021184 | Soil | MPMLLGSTTLACTLFSMMLGQVALGMEALGVLLASLVLMSLQRE |
| Ga0213875_100023197 | 3300021388 | Plant Roots | MPLLLGSTTIFCTLLSIMLGQVAMGAEALGVMLGAFVLMSLQRE |
| Ga0213875_100148333 | 3300021388 | Plant Roots | MPLLIGSATLGCTLLGMALGQVTPGFQAIGVLLAALVVMSFQHE |
| Ga0213875_103747331 | 3300021388 | Plant Roots | MPLLLGSTTMICTLLSLALGEVTMGVQALGVLIGAGVLMSLQRE |
| Ga0210394_100069761 | 3300021420 | Soil | MPMLIGSTIVICTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE |
| Ga0213853_107934812 | 3300021861 | Watersheds | RQPPGPAMPLLIGSATLVCTLMSMAFGQINTGVQALGVLLGALVLMSVQRE |
| Ga0224712_105634411 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | PDCPLMPMLLGATTIFCTLLSIMLGQITMGAEALGVMLAAFVLMSVQRE |
| Ga0212123_10000129117 | 3300022557 | Iron-Sulfur Acid Spring | MPMLIGSTIVVCTLFSMMLGQIAMGMEAAGVLLAAVVLMSVQHE |
| Ga0212123_102251482 | 3300022557 | Iron-Sulfur Acid Spring | MPMLIGSLTVFCTLFSAALGEITPGIQTLGVLLAAGVLMSLQRE |
| Ga0212128_104006092 | 3300022563 | Thermal Springs | MPMLMGSAIVVCTLVSMVLGQIAIGMEAIGVLLAALVLMSFQRE |
| Ga0242665_102300892 | 3300022724 | Soil | QPPGSPDGIAAMPMLIGSTTVVCTLLSMMLGQIAMGTEAIGVLLAAVVLMSVQRE |
| Ga0137417_15069842 | 3300024330 | Vadose Zone Soil | MPMLIGSTIVVCTLFSMMLGQIAMSMEAMGVLLAAFVLMTVQRE |
| Ga0209824_102508951 | 3300025173 | Wastewater | PHGIAAMPMLIGSTIVVCTLLSMILGQIAMGMEAIGVLLAALVLMSVQRE |
| Ga0207642_110803112 | 3300025899 | Miscanthus Rhizosphere | MPMLLGSTTLACTLFSMMLGQVALGMESLGVLLASLVLMSLQRE |
| Ga0207688_103770262 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMLLGSATMACTLFGMMLGQVALGMESLGVLLAALVLMSLQRE |
| Ga0207680_109495632 | 3300025903 | Switchgrass Rhizosphere | MPMLLGSTTAVCTLLSMMLGQITVGVEALGVLLAAGVLMSLQRE |
| Ga0207707_100733853 | 3300025912 | Corn Rhizosphere | MPMLIGSTTVVCTLLSMMLGQITVGIEALGVLLAAGVLMSLQRE |
| Ga0207707_103075721 | 3300025912 | Corn Rhizosphere | TVMCTLLSMMLGQITVGIEALGVLLAAGVLMSLQRE |
| Ga0207707_115523792 | 3300025912 | Corn Rhizosphere | LMPMLLGATTIFCTLLSIMLGQITMGAEALGVMLAAFVLMSVQRE |
| Ga0207660_108413162 | 3300025917 | Corn Rhizosphere | MPMLLGATTIFCTLLSIMLGQITMGAEALGVMLAAFVLMSVQRE |
| Ga0207700_105861672 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMLLGSTIVVCTLFSMMLGQIAMSMEAIGVLLAALVLMTVQRE |
| Ga0207701_109595092 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMLIGSTTVVCTLLSMMLGQITAGIEALGVLLAAFVLMSVQRE |
| Ga0207644_106941182 | 3300025931 | Switchgrass Rhizosphere | MPMLLGSTTMACTLFSMMLGQVALGMESLGVLLAALVLMSLQRE |
| Ga0207644_112480952 | 3300025931 | Switchgrass Rhizosphere | MPMLLGSTTMACTLFSMMLGQVALGMESLGVLLAALVLIS |
| Ga0207690_113992662 | 3300025932 | Corn Rhizosphere | MPMLIGSTTAAVTLLSMMLGQITMGMEALGVLLAAFVLMSLQRE |
| Ga0207691_105407462 | 3300025940 | Miscanthus Rhizosphere | MPMLLGSTTVVCTLLSMMLGQITVGIEAFGVVLAAGVL |
| Ga0207667_102976661 | 3300025949 | Corn Rhizosphere | GPAMPMLIGSTTVVCTLLSMMLGQITVGIEALGVLLAAGVLMSLQRE |
| Ga0207667_115324192 | 3300025949 | Corn Rhizosphere | MPMLIGSTTVVCTLLSMMLGQITMGIEALGVLLAAFVLMSLQRE |
| Ga0207677_110257211 | 3300026023 | Miscanthus Rhizosphere | MPMLLGSTTAVCTLLSMMLGQINVGVEALGVLLAAGLLMSLQRE |
| Ga0207703_106128262 | 3300026035 | Switchgrass Rhizosphere | MPMLLGSTTVVCTLLSMMLGQITVGVEALGVLLAAGVLMSLQRE |
| Ga0209153_12455002 | 3300026312 | Soil | GSTTLACTLLSMALGQIAVGMEGVGVLLASLVLMSLQRE |
| Ga0209647_10682502 | 3300026319 | Grasslands Soil | MPLLIGSATLVSTLLSISLGQVAMGTEALGVMLAALVVMSLQRE |
| Ga0209472_10169742 | 3300026323 | Soil | MPLLIGSTTFACTLLSMTLGQIAVGMEAMGVMLASLVLMSLQRE |
| Ga0257163_10788401 | 3300026359 | Soil | GSTTLACTLLSMAIGQIAIGMEGVGVVLASLVLMSLQRE |
| Ga0209736_10489462 | 3300027660 | Forest Soil | MPMLIGSTTVACTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE |
| Ga0209009_10659901 | 3300027667 | Forest Soil | MPLLIGSATVVSMLLSLSLGQVTMGMEVVGVLLAALVVMSL |
| Ga0209073_103769731 | 3300027765 | Agricultural Soil | MPMLLGSAIVVCTLLSMMLGQIAVGMEAIGVVLAALVLMSLQRE |
| Ga0209810_11084191 | 3300027773 | Surface Soil | MPLLLGSTTVVCTLLGLLLGQVTMGMEAAGVLLAACVVMSLQRE |
| Ga0209580_100142104 | 3300027842 | Surface Soil | MPMLLGSTIVVCTLLSMMLGQIAMGMEAIGVLLAALVLMTVQRE |
| Ga0209180_102727002 | 3300027846 | Vadose Zone Soil | MPMLLGSTTVICTLLSMMLGQITIGMEAIGVLLAALVLMSVQRE |
| Ga0209180_104970191 | 3300027846 | Vadose Zone Soil | MPMLLGSTTVVCTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE |
| Ga0209693_102610073 | 3300027855 | Soil | MPLLIGSATVVSMLLSLSLGQVTMGMEAVGVLLAAIVVMSLQRE |
| Ga0209167_101217502 | 3300027867 | Surface Soil | MPMLIGSTIVVCTLISMMLGQIAMGTEAIGVLLAALVLMSVQRE |
| Ga0209167_101559932 | 3300027867 | Surface Soil | MPMLLGSAIVVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE |
| Ga0209579_100030898 | 3300027869 | Surface Soil | MPMLLGSAIVFCTLLSMILGQVTLGMEAIGVLLAALVLMSVQRE |
| Ga0209579_105360632 | 3300027869 | Surface Soil | MPMLIGSTIVICTLFSMMLGQIAMGMEAIGVLLAALVLMSVQRE |
| Ga0209283_107358311 | 3300027875 | Vadose Zone Soil | MPMLIGSTTVACTLLSMMLGQIAMGMEAIGVVLAALVLMSVQRE |
| Ga0209590_104074391 | 3300027882 | Vadose Zone Soil | MPMLLGSTTFVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE |
| Ga0209415_100325884 | 3300027905 | Peatlands Soil | MPMLIGSATVVCTLLSMILGQVAMGTEAIGVLLAAIVLMSVQRE |
| Ga0268265_107968222 | 3300028380 | Switchgrass Rhizosphere | MPMLLGSTTVVCTLLSMMLGQINVGVEALGVLLAAGLLMSLQRE |
| Ga0137415_105757382 | 3300028536 | Vadose Zone Soil | MPMLLGSTTVICTLLSMMLGQITMGMEAIGVLLAALVLMSVQRE |
| Ga0307482_10711452 | 3300030730 | Hardwood Forest Soil | IAAMPMLIGATTVFCVLLSMMLGQIAVGMESLGVLLAAFVLMSLQRE |
| Ga0138302_18304922 | 3300030937 | Soil | GSTIVVCTLLSMMLGQIAMGMEAIGVLLAALVLMSVQRE |
| Ga0102770_112593342 | 3300030981 | Soil | SATVISTLLSISLGQVAMGTEALGVLLAAFVVMSLRRE |
| Ga0308183_10760871 | 3300030988 | Soil | GQPRSEQKRRRSMPMLLGSATMACTLFSMILGQVALGMESLGVLLAALVLMSLQRE |
| Ga0102760_109378294 | 3300031039 | Soil | PFLIGSATLACTLLSLSLGQVTMGMQALGVILASIVVMSLGANS |
| Ga0308189_102164951 | 3300031058 | Soil | TPVNPTLVNPARKRSRSMPMLLGSTTLACTLFSMMLGQVALGMESLGVLLASLVLMSLQQ |
| Ga0308201_102930582 | 3300031091 | Soil | RKRSRSMPMLLGSTTLACTLFSMMLGQVALGMESLGVLLASLVLMSLQRE |
| Ga0307374_100475363 | 3300031670 | Soil | MPLLIGSTTVVCTLISMMLGQITMGMEAAGVLLAAVVLMSLQRE |
| Ga0307374_100837654 | 3300031670 | Soil | MPMLLGSTIVVCTLISMMLGQITLGMEAIGVLLAAFVLMSVQHE |
| Ga0307468_1012390702 | 3300031740 | Hardwood Forest Soil | MPMLIGSTTMVCTLLSMMLGQITVGMEALGVLLASAVLMSLQRE |
| Ga0318520_108713261 | 3300031897 | Soil | TLTVTLLSMASGQITAGAEAFGVLLASVVLMTLREQ |
| Ga0308175_1011478651 | 3300031938 | Soil | MPMLLGSTMLACTLFSMMLGQVALGMESVGVLLAALVLMSLQRE |
| Ga0308175_1032707731 | 3300031938 | Soil | TTLACTLFSMILGQIALGMESLGVLIAALVLMSLQRE |
| Ga0307479_102631782 | 3300031962 | Hardwood Forest Soil | MPMLIGATIVVCTLLSMMLGQIAMSMEAVGVLLAALVLMSVQRE |
| Ga0326597_100203143 | 3300031965 | Soil | MPMLLGSTTMLCTLLSMMLGQIALGMEALGVLLAALVLMSLQRE |
| Ga0326597_100433156 | 3300031965 | Soil | MPMLMGSAIAFCTLLSMMLGQIAVGMEAIGVVLAAFVLMSLQRE |
| Ga0326597_103740092 | 3300031965 | Soil | MPMLIGSAIVVCTLLSMVLGQIAMSMEAIGVLLAALVLMTVQRE |
| Ga0308176_109064263 | 3300031996 | Soil | MPMLLGSTMLACTLFSMMLGQVALGMESLGVLLAALVLMSLQPE |
| Ga0308173_111642652 | 3300032074 | Soil | MLACTLFSMMLGQVALGMESLGVLLASLVLMSLQRE |
| Ga0307471_1035687442 | 3300032180 | Hardwood Forest Soil | MPMLIGSAIVVCTLFSMMLGQVAMGMEAIGVLLAAI |
| Ga0335081_101713314 | 3300032892 | Soil | MPMLLGSATVVCTLLSMMLGQIAVGMEAIGVVLAALVLMSLQRE |
| Ga0335081_104668062 | 3300032892 | Soil | MPMLIGSTTVVCTLFSMMVGQIAVGMEAIGVLLAALVLMSLQRE |
| Ga0335077_121176272 | 3300033158 | Soil | MPMLIGSAIVVCTLLSMMLGQIAMGTEAIGVLLAAFVLMSLQRQ |
| Ga0214472_117862321 | 3300033407 | Soil | GYPHGIAAMPMLIGSTIVVCTLFSMMLGQVPMGMEAIGVLLAAGVLMSVQRE |
| Ga0316624_105172982 | 3300033486 | Soil | MPMLLGSAIVVCTLLSMMLGQITVGMEAIGVVLAAFVLMSLQRE |
| ⦗Top⦘ |