


| Basic Information | |
|---|---|
| Family ID | F017743 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 239 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MDDLVAKVLANMSPEVLQAVTREILKPVVEAMVKEELKSKKS |
| Number of Associated Samples | 175 |
| Number of Associated Scaffolds | 239 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.54 % |
| % of genes near scaffold ends (potentially truncated) | 77.82 % |
| % of genes from short scaffolds (< 2000 bps) | 69.87 % |
| Associated GOLD sequencing projects | 160 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.904 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (38.912 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.749 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.259 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 239 Family Scaffolds |
|---|---|---|
| PF00133 | tRNA-synt_1 | 59.41 |
| PF10458 | Val_tRNA-synt_C | 2.51 |
| PF02517 | Rce1-like | 1.67 |
| PF08264 | Anticodon_1 | 1.26 |
| PF08279 | HTH_11 | 1.26 |
| PF01738 | DLH | 0.84 |
| PF06782 | UPF0236 | 0.84 |
| PF02749 | QRPTase_N | 0.84 |
| PF00082 | Peptidase_S8 | 0.84 |
| PF00882 | Zn_dep_PLPC | 0.84 |
| PF00106 | adh_short | 0.42 |
| PF13561 | adh_short_C2 | 0.42 |
| PF03309 | Pan_kinase | 0.42 |
| PF14622 | Ribonucleas_3_3 | 0.42 |
| PF00583 | Acetyltransf_1 | 0.42 |
| PF12695 | Abhydrolase_5 | 0.42 |
| PF13525 | YfiO | 0.42 |
| PF01627 | Hpt | 0.42 |
| PF13565 | HTH_32 | 0.42 |
| PF12623 | Hen1_L | 0.42 |
| PF03176 | MMPL | 0.42 |
| PF02221 | E1_DerP2_DerF2 | 0.42 |
| PF01075 | Glyco_transf_9 | 0.42 |
| PF13533 | Biotin_lipoyl_2 | 0.42 |
| PF13683 | rve_3 | 0.42 |
| PF02518 | HATPase_c | 0.42 |
| PF01797 | Y1_Tnp | 0.42 |
| PF12867 | DinB_2 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 239 Family Scaffolds |
|---|---|---|---|
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 59.41 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 59.41 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 59.41 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 59.41 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.67 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.67 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.84 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.84 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.42 |
| COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 0.42 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.42 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.90 % |
| All Organisms | root | All Organisms | 43.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100097105 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300001527|A3513AW1_1110706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300001593|JGI12635J15846_10886334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100774029 | Not Available | 839 | Open in IMG/M |
| 3300002908|JGI25382J43887_10128354 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300004091|Ga0062387_100254359 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300004091|Ga0062387_101794967 | Not Available | 500 | Open in IMG/M |
| 3300004092|Ga0062389_100102132 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
| 3300005167|Ga0066672_10094010 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300005167|Ga0066672_10311805 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300005187|Ga0066675_10530496 | Not Available | 882 | Open in IMG/M |
| 3300005334|Ga0068869_101529579 | Not Available | 593 | Open in IMG/M |
| 3300005529|Ga0070741_10254290 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA292 | 1671 | Open in IMG/M |
| 3300005537|Ga0070730_10040750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3425 | Open in IMG/M |
| 3300005538|Ga0070731_10499081 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300005540|Ga0066697_10003255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 7475 | Open in IMG/M |
| 3300005545|Ga0070695_101144600 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005552|Ga0066701_10585835 | Not Available | 681 | Open in IMG/M |
| 3300005554|Ga0066661_10318158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300005560|Ga0066670_10018501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3189 | Open in IMG/M |
| 3300005568|Ga0066703_10163611 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300005574|Ga0066694_10164954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
| 3300005576|Ga0066708_10046977 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
| 3300006046|Ga0066652_101389755 | Not Available | 658 | Open in IMG/M |
| 3300006052|Ga0075029_100925682 | Not Available | 599 | Open in IMG/M |
| 3300006059|Ga0075017_101371757 | Not Available | 555 | Open in IMG/M |
| 3300006086|Ga0075019_10118481 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300006086|Ga0075019_10242853 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300006102|Ga0075015_100233712 | Not Available | 990 | Open in IMG/M |
| 3300006796|Ga0066665_10855999 | Not Available | 710 | Open in IMG/M |
| 3300006800|Ga0066660_10182537 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300006804|Ga0079221_10226753 | Not Available | 1043 | Open in IMG/M |
| 3300006804|Ga0079221_11166565 | Not Available | 595 | Open in IMG/M |
| 3300007255|Ga0099791_10625948 | Not Available | 527 | Open in IMG/M |
| 3300007265|Ga0099794_10359260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300007265|Ga0099794_10406775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300007788|Ga0099795_10003910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3764 | Open in IMG/M |
| 3300009038|Ga0099829_10267125 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300009088|Ga0099830_10496313 | Not Available | 995 | Open in IMG/M |
| 3300009088|Ga0099830_10822454 | Not Available | 767 | Open in IMG/M |
| 3300009088|Ga0099830_10823929 | Not Available | 766 | Open in IMG/M |
| 3300009089|Ga0099828_10632467 | Not Available | 963 | Open in IMG/M |
| 3300009089|Ga0099828_11766352 | Not Available | 543 | Open in IMG/M |
| 3300009089|Ga0099828_11964242 | Not Available | 512 | Open in IMG/M |
| 3300009098|Ga0105245_10665366 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300009137|Ga0066709_100475164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1754 | Open in IMG/M |
| 3300009137|Ga0066709_103837035 | Not Available | 546 | Open in IMG/M |
| 3300009162|Ga0075423_12640867 | Not Available | 549 | Open in IMG/M |
| 3300010360|Ga0126372_12235149 | Not Available | 596 | Open in IMG/M |
| 3300010361|Ga0126378_10201938 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA292 | 2065 | Open in IMG/M |
| 3300010362|Ga0126377_12340623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300010398|Ga0126383_10047904 | All Organisms → cellular organisms → Bacteria | 3539 | Open in IMG/M |
| 3300010398|Ga0126383_11542631 | Not Available | 754 | Open in IMG/M |
| 3300011269|Ga0137392_10086778 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
| 3300011269|Ga0137392_10213656 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300011269|Ga0137392_10233808 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1510 | Open in IMG/M |
| 3300011269|Ga0137392_10856031 | Not Available | 749 | Open in IMG/M |
| 3300011269|Ga0137392_11234937 | Not Available | 606 | Open in IMG/M |
| 3300011270|Ga0137391_11174865 | Not Available | 615 | Open in IMG/M |
| 3300011270|Ga0137391_11330004 | Not Available | 565 | Open in IMG/M |
| 3300011271|Ga0137393_10052851 | Not Available | 3187 | Open in IMG/M |
| 3300011271|Ga0137393_11056419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300012189|Ga0137388_10863006 | Not Available | 838 | Open in IMG/M |
| 3300012189|Ga0137388_11162946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300012189|Ga0137388_11163169 | Not Available | 709 | Open in IMG/M |
| 3300012189|Ga0137388_11443344 | Not Available | 626 | Open in IMG/M |
| 3300012200|Ga0137382_10310962 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300012202|Ga0137363_10006829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7124 | Open in IMG/M |
| 3300012202|Ga0137363_10211701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1560 | Open in IMG/M |
| 3300012202|Ga0137363_11686302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300012203|Ga0137399_10105383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2189 | Open in IMG/M |
| 3300012203|Ga0137399_10257807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1431 | Open in IMG/M |
| 3300012203|Ga0137399_10476211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300012203|Ga0137399_11101764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300012203|Ga0137399_11737815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300012205|Ga0137362_10298923 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300012205|Ga0137362_11442813 | Not Available | 574 | Open in IMG/M |
| 3300012206|Ga0137380_10042409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4187 | Open in IMG/M |
| 3300012210|Ga0137378_11350495 | Not Available | 627 | Open in IMG/M |
| 3300012210|Ga0137378_11353731 | Not Available | 626 | Open in IMG/M |
| 3300012211|Ga0137377_11581241 | Not Available | 580 | Open in IMG/M |
| 3300012285|Ga0137370_10798876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300012349|Ga0137387_10262200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1247 | Open in IMG/M |
| 3300012351|Ga0137386_10343871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300012351|Ga0137386_11088030 | Not Available | 565 | Open in IMG/M |
| 3300012351|Ga0137386_11311732 | Not Available | 501 | Open in IMG/M |
| 3300012354|Ga0137366_10047098 | All Organisms → cellular organisms → Bacteria | 3317 | Open in IMG/M |
| 3300012361|Ga0137360_10003044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 10033 | Open in IMG/M |
| 3300012361|Ga0137360_10684563 | Not Available | 880 | Open in IMG/M |
| 3300012363|Ga0137390_11295134 | Not Available | 675 | Open in IMG/M |
| 3300012582|Ga0137358_10118864 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| 3300012683|Ga0137398_10014099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4154 | Open in IMG/M |
| 3300012683|Ga0137398_11161322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012685|Ga0137397_11167475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300012917|Ga0137395_10243074 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300012918|Ga0137396_10214480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1417 | Open in IMG/M |
| 3300012918|Ga0137396_10223499 | Not Available | 1387 | Open in IMG/M |
| 3300012918|Ga0137396_10444795 | Not Available | 961 | Open in IMG/M |
| 3300012918|Ga0137396_10738696 | Not Available | 725 | Open in IMG/M |
| 3300012922|Ga0137394_10517009 | Not Available | 1013 | Open in IMG/M |
| 3300012923|Ga0137359_10180550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1884 | Open in IMG/M |
| 3300012923|Ga0137359_10437845 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300012923|Ga0137359_10942487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300012925|Ga0137419_10633919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300012929|Ga0137404_10481957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
| 3300012930|Ga0137407_10063337 | Not Available | 3051 | Open in IMG/M |
| 3300012930|Ga0137407_11032952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300012930|Ga0137407_12308220 | Not Available | 514 | Open in IMG/M |
| 3300012944|Ga0137410_10241305 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300012958|Ga0164299_10889378 | Not Available | 645 | Open in IMG/M |
| 3300012977|Ga0134087_10485375 | Not Available | 619 | Open in IMG/M |
| 3300014150|Ga0134081_10014423 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300014157|Ga0134078_10575892 | Not Available | 535 | Open in IMG/M |
| 3300014166|Ga0134079_10364074 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300015054|Ga0137420_1322774 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
| 3300015245|Ga0137409_10133057 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
| 3300016341|Ga0182035_10001455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12081 | Open in IMG/M |
| 3300016422|Ga0182039_11132847 | Not Available | 705 | Open in IMG/M |
| 3300016445|Ga0182038_11158272 | Not Available | 688 | Open in IMG/M |
| 3300017823|Ga0187818_10060266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1633 | Open in IMG/M |
| 3300017955|Ga0187817_11038140 | Not Available | 525 | Open in IMG/M |
| 3300017961|Ga0187778_10868366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300017973|Ga0187780_10671564 | Not Available | 746 | Open in IMG/M |
| 3300018006|Ga0187804_10192514 | Not Available | 869 | Open in IMG/M |
| 3300018085|Ga0187772_10508329 | Not Available | 850 | Open in IMG/M |
| 3300018468|Ga0066662_10034296 | All Organisms → cellular organisms → Bacteria | 3059 | Open in IMG/M |
| 3300020170|Ga0179594_10171144 | Not Available | 808 | Open in IMG/M |
| 3300020199|Ga0179592_10086603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1437 | Open in IMG/M |
| 3300020579|Ga0210407_10002448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15934 | Open in IMG/M |
| 3300020579|Ga0210407_10543101 | Not Available | 907 | Open in IMG/M |
| 3300020581|Ga0210399_10982499 | Not Available | 681 | Open in IMG/M |
| 3300021046|Ga0215015_10459900 | Not Available | 591 | Open in IMG/M |
| 3300021046|Ga0215015_10804058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300021088|Ga0210404_10731916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300021168|Ga0210406_10400771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300021168|Ga0210406_10572805 | Not Available | 884 | Open in IMG/M |
| 3300021168|Ga0210406_10739098 | Not Available | 754 | Open in IMG/M |
| 3300021168|Ga0210406_10946195 | Not Available | 645 | Open in IMG/M |
| 3300021170|Ga0210400_10135573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1974 | Open in IMG/M |
| 3300021178|Ga0210408_11041390 | Not Available | 632 | Open in IMG/M |
| 3300021401|Ga0210393_11056436 | Not Available | 656 | Open in IMG/M |
| 3300021405|Ga0210387_11177862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300021476|Ga0187846_10255527 | Not Available | 728 | Open in IMG/M |
| 3300021479|Ga0210410_10121247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2319 | Open in IMG/M |
| 3300021479|Ga0210410_11081439 | Not Available | 692 | Open in IMG/M |
| 3300021479|Ga0210410_11464479 | Not Available | 576 | Open in IMG/M |
| 3300021559|Ga0210409_10298141 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300021560|Ga0126371_11490594 | Not Available | 805 | Open in IMG/M |
| 3300024182|Ga0247669_1002531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4519 | Open in IMG/M |
| 3300024186|Ga0247688_1066368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300024288|Ga0179589_10633378 | Not Available | 503 | Open in IMG/M |
| 3300024323|Ga0247666_1066762 | Not Available | 719 | Open in IMG/M |
| 3300024330|Ga0137417_1134673 | Not Available | 997 | Open in IMG/M |
| 3300024330|Ga0137417_1170003 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300026285|Ga0209438_1071235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
| 3300026295|Ga0209234_1146553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300026304|Ga0209240_1004591 | All Organisms → cellular organisms → Bacteria | 5214 | Open in IMG/M |
| 3300026328|Ga0209802_1174210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300026482|Ga0257172_1017767 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300026490|Ga0257153_1037376 | Not Available | 1001 | Open in IMG/M |
| 3300026547|Ga0209156_10417270 | Not Available | 558 | Open in IMG/M |
| 3300026551|Ga0209648_10436675 | Not Available | 825 | Open in IMG/M |
| 3300026552|Ga0209577_10195705 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300026555|Ga0179593_1083720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2608 | Open in IMG/M |
| 3300026999|Ga0207949_1018358 | Not Available | 639 | Open in IMG/M |
| 3300027460|Ga0207506_1002302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1372 | Open in IMG/M |
| 3300027671|Ga0209588_1118667 | Not Available | 847 | Open in IMG/M |
| 3300027729|Ga0209248_10147157 | Not Available | 703 | Open in IMG/M |
| 3300027821|Ga0209811_10140548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300027829|Ga0209773_10269063 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300027846|Ga0209180_10343591 | Not Available | 852 | Open in IMG/M |
| 3300027855|Ga0209693_10125218 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300027875|Ga0209283_10881898 | Not Available | 543 | Open in IMG/M |
| 3300027882|Ga0209590_10593097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300027894|Ga0209068_10548944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300027898|Ga0209067_10252443 | Not Available | 960 | Open in IMG/M |
| 3300028047|Ga0209526_10961311 | Not Available | 514 | Open in IMG/M |
| 3300028906|Ga0308309_11281282 | Not Available | 630 | Open in IMG/M |
| 3300029636|Ga0222749_10307046 | Not Available | 822 | Open in IMG/M |
| 3300031057|Ga0170834_102869938 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Philodinida → Philodinidae → Didymodactylos → Didymodactylos carnosus | 549 | Open in IMG/M |
| 3300031057|Ga0170834_107264776 | Not Available | 826 | Open in IMG/M |
| 3300031720|Ga0307469_12461865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300031754|Ga0307475_10535936 | Not Available | 939 | Open in IMG/M |
| 3300031768|Ga0318509_10017283 | All Organisms → cellular organisms → Bacteria | 3295 | Open in IMG/M |
| 3300031823|Ga0307478_11114069 | Not Available | 658 | Open in IMG/M |
| 3300031833|Ga0310917_10842373 | Not Available | 618 | Open in IMG/M |
| 3300031835|Ga0318517_10120909 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300031910|Ga0306923_12138585 | Not Available | 563 | Open in IMG/M |
| 3300031946|Ga0310910_11529511 | Not Available | 511 | Open in IMG/M |
| 3300031962|Ga0307479_11884294 | Not Available | 548 | Open in IMG/M |
| 3300031981|Ga0318531_10240800 | Not Available | 816 | Open in IMG/M |
| 3300032205|Ga0307472_100450750 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300032205|Ga0307472_101178330 | Not Available | 730 | Open in IMG/M |
| 3300033475|Ga0310811_10297292 | Not Available | 1862 | Open in IMG/M |
| 3300033513|Ga0316628_100966496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 38.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.09% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.84% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.42% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001527 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027460 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1000971052 | 3300000955 | Soil | AKVLARMNPEVLQAVTREILKPLVEAMINDEIRKK* |
| A3513AW1_11107061 | 3300001527 | Permafrost | DDLVARVLAKMNPDVLQAVTREILKPMVAAILAEESKRKE* |
| JGI12635J15846_108863341 | 3300001593 | Forest Soil | EELVPAPAPSMDDLVARVLANMSPEVLQAVTREILKPVVEAMVKEELKSKKS* |
| JGIcombinedJ26739_1007740292 | 3300002245 | Forest Soil | VAKVLAKMSPDVLQAVTRDILKNVVESIVRDELNAKKQ* |
| JGI25382J43887_101283541 | 3300002908 | Grasslands Soil | PAPEATPSMDDLVARVLARMSPEVLQAVTREILKPVVEAMVKEEMKSKKS* |
| Ga0062387_1002543591 | 3300004091 | Bog Forest Soil | PDPGMEDMVAKVLAKMSPEMLQAVTRDILKNVVESMVRDELNAKKQ* |
| Ga0062387_1017949672 | 3300004091 | Bog Forest Soil | DVVARVLATLSPEVMQAITRELLKPVVEAMVREELKKKE* |
| Ga0062389_1001021323 | 3300004092 | Bog Forest Soil | PEPSMEDLVAKVLANMNPDVLQAVTRDILKSVVESMVRDELNAKKQ* |
| Ga0062389_1022625542 | 3300004092 | Bog Forest Soil | SSKAPEPSMEDLVAKVLAKMNPDMLQAVTRDILKNVVESMVRDELNAKKQ* |
| Ga0062386_1013237102 | 3300004152 | Bog Forest Soil | KTAAPTANSHDDLVARVLAKMSPEMLQAVTREILRPVVEAMVKEEMNSKKP* |
| Ga0062595_1025872341 | 3300004479 | Soil | ETPQQDMDALVANVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS* |
| Ga0066672_100940101 | 3300005167 | Soil | PNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0066672_103118051 | 3300005167 | Soil | ASKNDMDDLVAKVLARMSPEVLQAVTREILKPVVEAMVKQEMNSKKS* |
| Ga0066690_104932721 | 3300005177 | Soil | DMDEIVAKVLAKMNPEVLQAVTREILKPLVEAMIKDELHKN* |
| Ga0066675_105304962 | 3300005187 | Soil | ACSTSGLILAKMSPEVLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0068869_1015295792 | 3300005334 | Miscanthus Rhizosphere | MDELVAKVLAKMNPEVLQAVTREILKPVVEALVKDELSKK* |
| Ga0066689_103462472 | 3300005447 | Soil | SALDMDEIVAKVLAKMNPEVLQAVTREILKPLVEAMIKDELNKN* |
| Ga0070741_102542902 | 3300005529 | Surface Soil | DDVVAKVLAKMSPEVLQAVTKEILKPVVEAIVRDELGKK* |
| Ga0070730_100407501 | 3300005537 | Surface Soil | VAKVLAKLSPEMLQAVTREILKPVVEAMVRDEIISKKS* |
| Ga0070731_104990812 | 3300005538 | Surface Soil | EDLVAKVLAKMNPDMLQAVTRDILKNVVESMVRDELNAKKQ* |
| Ga0066697_100032557 | 3300005540 | Soil | PAPTPSMDDLVAKVLAKLNPEVLQAVTREILKPVVEAMVQEEMKSKKS* |
| Ga0070695_1011446002 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AEPSMEDLVAKVLSKMSPDMLQAVTRDILKNVVESMVRDELNAKK* |
| Ga0066701_105858351 | 3300005552 | Soil | SMDDLVAKVLAKLNPEVLQAVTREILRPVVEAMVKEELKSKKS* |
| Ga0066661_103181583 | 3300005554 | Soil | VLARMSPEVLQAVTREILKPVVEAMVKEEMQSKKS* |
| Ga0066670_100185011 | 3300005560 | Soil | MDDLVAKVLAKLNPEVLQAVTREILKPVVEAMVQEEMKSKKP* |
| Ga0066703_101636112 | 3300005568 | Soil | DMDEIVAKVLAKMNPEVLQAVTREILKPLVEAMIKDELNKN* |
| Ga0066694_101649541 | 3300005574 | Soil | MDDLVAKVLARMSPEVLQAVTREILKPVVEAMVKEEMQSKKS* |
| Ga0066708_100469771 | 3300005576 | Soil | PAPTPSMDDLVAKVLAKLNPEVLQAVTREILKPVVEAMVQEEMKSKKP* |
| Ga0066652_1013897551 | 3300006046 | Soil | DELVARVLAKMNPEVLQAVTREILKPVVEAMVKEELRSKKS* |
| Ga0075029_1009256822 | 3300006052 | Watersheds | DVVARVLAKMSPEVLQAVTREILKPVVEAMVKEELKSKK* |
| Ga0075029_1009873072 | 3300006052 | Watersheds | PETLIETPAATPAPAAPSMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKSKKS |
| Ga0075017_1013717571 | 3300006059 | Watersheds | APAPSPSMDDLVARVLAKMSPDVLQAVTREILKPVVEAMVKEEMKSKKS* |
| Ga0075019_101184812 | 3300006086 | Watersheds | VETPVAAPAPAPSPSMDDLVARVLAKMSPDVLQAVTREILKPVVEAMVKEEMKSKKS* |
| Ga0075019_102428531 | 3300006086 | Watersheds | VNTNQSMDDVVARVLAKMSPEVLQAVTREILKPVVEAMVKEELKSKK* |
| Ga0075019_110763252 | 3300006086 | Watersheds | QANAAPAAPPAAAPNVDELVAKVLAKMSPEVLQAVTREILKPVVEAMVKDELKSKKS* |
| Ga0075015_1000999401 | 3300006102 | Watersheds | EALVETPVAAPAPAPSPSMDDLVARVLAKMSPDVLQAVTREILKPVVEAMVKEEMKSKKS |
| Ga0075015_1002337121 | 3300006102 | Watersheds | PAAVPAPSPSMDELVARVLAKMSPDVLQAVTREILKPVIEAMVKEEMKSKKS* |
| Ga0070715_104183132 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PDMDEIVAKVLARMNPEVLQAVTREILKPLVEAMIKDEIHKK* |
| Ga0070716_1000978413 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ASVPDMDEIVAKVLARMNPEILQAVTREILKPLVEAMIKDEIHKK* |
| Ga0066658_106790771 | 3300006794 | Soil | SPTPSTATPTAPNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0066665_108559992 | 3300006796 | Soil | MDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVQEELKSKKP* |
| Ga0066660_101825372 | 3300006800 | Soil | PNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKDEMKSKKS* |
| Ga0066660_108879972 | 3300006800 | Soil | SQATSTPAAPAPTMDDLVAKVLAKMNPEMLQAVTREILKPVVEAMVKEELKSKKP* |
| Ga0079221_102267531 | 3300006804 | Agricultural Soil | VLAKMNPEVLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0079221_111665651 | 3300006804 | Agricultural Soil | TAAPPAAAPTAGPNMDDLVAKVLAKMNPEMLQAVTREILKPVVEAMVKEELKSKKP* |
| Ga0099791_106259481 | 3300007255 | Vadose Zone Soil | DLVAKVLAKMNPEMLQAVTREILKPVVEAMVKEEMKSKKS* |
| Ga0099794_103592602 | 3300007265 | Vadose Zone Soil | VANVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS* |
| Ga0099794_104067751 | 3300007265 | Vadose Zone Soil | NVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS* |
| Ga0099794_107228881 | 3300007265 | Vadose Zone Soil | EAEAAASKSSMDDLVAKVLARMSPELLQAVTREILKPLVEARVKEEMKSKKS* |
| Ga0099795_100039101 | 3300007788 | Vadose Zone Soil | LVANVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS* |
| Ga0066710_1045437052 | 3300009012 | Grasslands Soil | PAVAPDIDEIVAKVLARMNPDILQAVTREILKPLVEAMIKDELHKK |
| Ga0099829_102671252 | 3300009038 | Vadose Zone Soil | APTPSMDELVAKVLAKMSPEVLQAVTREILKPVVEAMVKEEMKSK* |
| Ga0099830_104963132 | 3300009088 | Vadose Zone Soil | SMDDLVARVLARMSPEVLQAVTREILKPVVESMVKEEMKLKKS* |
| Ga0099830_108224541 | 3300009088 | Vadose Zone Soil | RVLARMSPEVLQAVTREILKPVVEAMVKEEMKLKKS* |
| Ga0099830_108239291 | 3300009088 | Vadose Zone Soil | MDDLVAKVLANMSPEVLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0099828_106324671 | 3300009089 | Vadose Zone Soil | APAPTPSMDELVAKVLAKMSPEVLQAVTREILKPVVEAMVKEEMKSK* |
| Ga0099828_117663521 | 3300009089 | Vadose Zone Soil | PSMDDLVARVLARMSPEVLQAVTREILRPVVEAMVKEEMKSKKS* |
| Ga0099828_119642421 | 3300009089 | Vadose Zone Soil | SMDELVAKVLAKMSPEVLQAVTREILKPVVEAMVKEEMKSK* |
| Ga0099827_104249221 | 3300009090 | Vadose Zone Soil | APEALVEPPATSPAPTPNMDELVARVLARMSPEVLQAVTREILKPVVEAMVKEEMKAKKS |
| Ga0105245_106653661 | 3300009098 | Miscanthus Rhizosphere | VAKVLAKMNPDVLQAVTREILKPVVEALVKDELNKK* |
| Ga0066709_1004751643 | 3300009137 | Grasslands Soil | ELVARVLAKMSPEVLQAVTREILKPVIEALVKDELSKK* |
| Ga0066709_1038370352 | 3300009137 | Grasslands Soil | YMEYVVAKVLAKMSPEVLQAVTREILKPVVEAMVKDEMKSKKS* |
| Ga0075423_126408671 | 3300009162 | Populus Rhizosphere | EPNMDELVAKILAKMNPEVLQAVTREILKPVVEALVKDELGKK* |
| Ga0126373_100294721 | 3300010048 | Tropical Forest Soil | TGSAPTPAPPAASNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKK* |
| Ga0126373_107700522 | 3300010048 | Tropical Forest Soil | MDEIVAKVLARMNPDVVQAVTREILKPLVEAMIKDELQKK* |
| Ga0134064_101301322 | 3300010325 | Grasslands Soil | AQAATPAATPAPTPNMDELVARVLAKMNPEVLQAVTREILKPVVEAMVKEELRSKKS* |
| Ga0126372_122351492 | 3300010360 | Tropical Forest Soil | NLDIDAVVEKVLARMKSDVLQEVTREILKPVVEAVVREELGSNKR* |
| Ga0126378_102019382 | 3300010361 | Tropical Forest Soil | DHLVAKVLAKMSPEVLQAVTSAILKPVVEAMVKEELKAKK* |
| Ga0126377_123406232 | 3300010362 | Tropical Forest Soil | MDDLVAKVLAKMNPDVLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0126383_100479041 | 3300010398 | Tropical Forest Soil | STDDLVAKILAKMSPEVLQAVTREILKPVVEAMVRDELNSKKS* |
| Ga0126383_115426311 | 3300010398 | Tropical Forest Soil | PAPATTSVPNMDDLVARVLAKMNPEVLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0137392_100867781 | 3300011269 | Vadose Zone Soil | KVLAKMNPEVLQAVTREILKPLVEAMVKDELTKK* |
| Ga0137392_102136561 | 3300011269 | Vadose Zone Soil | KVLAKLSPEVLQAVTREILKPVVEAMVKEEMKSKKS* |
| Ga0137392_102338081 | 3300011269 | Vadose Zone Soil | LVARVLARMSPEVLQAVTREILRPVVEAMVKEEMKSKKS* |
| Ga0137392_108560312 | 3300011269 | Vadose Zone Soil | VAKVLANLSPDVLQAITREILKPVVAAMVKEEMKSKKS* |
| Ga0137392_112349371 | 3300011269 | Vadose Zone Soil | DDLVAKVLAKLSPEVLQAVTREILKPVVEAMVKEEMKLKKS* |
| Ga0137391_111748652 | 3300011270 | Vadose Zone Soil | VAAPEATPSMDDLVARVLARMSPEVLQAVTREILKPVVEAMVKEEMKLKKS* |
| Ga0137391_113300042 | 3300011270 | Vadose Zone Soil | APEPVVEAPAPTPAPTPNMDDLVAKVLARMSPEVLQAVTREILKPVVEAMVKEEMESKKS |
| Ga0137393_100528512 | 3300011271 | Vadose Zone Soil | APASAPSMDDLVAKVLANMSPEVLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0137393_110564192 | 3300011271 | Vadose Zone Soil | ANVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS* |
| Ga0137388_108630061 | 3300012189 | Vadose Zone Soil | KVLAKMNPEALQAVTREILRPLVEAMIKDELSKK* |
| Ga0137388_111629461 | 3300012189 | Vadose Zone Soil | APEPTANLDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKSKKR* |
| Ga0137388_111631692 | 3300012189 | Vadose Zone Soil | SQSSMDDLVAKVLANLSPDVLQAITREILKPVVAAMVKEEMKSKKS* |
| Ga0137388_114433441 | 3300012189 | Vadose Zone Soil | MDELVAKVLAKMSPEVLQAVTREILKPVVEAIVKEEMKSK* |
| Ga0137383_109499391 | 3300012199 | Vadose Zone Soil | EAAASKNNMDDLVAKVLARMSPEVLQAVTREIIKPVVEAVVKEEMKLKKS* |
| Ga0137382_103109622 | 3300012200 | Vadose Zone Soil | DLVAKVLARMSPEVLQAVTREILKPVVEAVVKEEMKLKKS* |
| Ga0137382_106338762 | 3300012200 | Vadose Zone Soil | PDMDEIVAKVLARMNPEVLQAVTREILKPLVEAMIKDELHKN* |
| Ga0137363_100068296 | 3300012202 | Vadose Zone Soil | LVAKVLANLSPDVLQAVTREILKPVVAAMVKEEMKSKKS* |
| Ga0137363_102117012 | 3300012202 | Vadose Zone Soil | EELVPAPAPSMDDLVARVLANMSPEVLQAVTREILRPVVEAMVKEELKSKKS* |
| Ga0137363_116863021 | 3300012202 | Vadose Zone Soil | EPPVAAPEATPSMDDLVARVLARMSPEVLQAVTREILKPVVEAMVKEEMKLKKS* |
| Ga0137399_101053833 | 3300012203 | Vadose Zone Soil | LARMSPEVLQAVTREILKPVVEAMLKEEMQSKKS* |
| Ga0137399_102578071 | 3300012203 | Vadose Zone Soil | APNMDDLVARVLAQMSPEVLQAVTREILKPVVEAMVKEELKSKKP* |
| Ga0137399_104762111 | 3300012203 | Vadose Zone Soil | RVLANMGPEVLQAVTRGISRPVVEAMVKEELKSKKS* |
| Ga0137399_111017641 | 3300012203 | Vadose Zone Soil | TDELVAKVLAKMNPEVLQAVTREILKPLIQAMVKDELDKK* |
| Ga0137399_117378151 | 3300012203 | Vadose Zone Soil | PSMDDLVARVLANMSPEVLQAVTREILKPVVEAMVKEELRSKKS* |
| Ga0137362_102989232 | 3300012205 | Vadose Zone Soil | MDDLVAKVLAKMNPEMLQAITREILRPVVEAMVKEEMKSKKS* |
| Ga0137362_109342722 | 3300012205 | Vadose Zone Soil | MWLAKTSPEMLQSVTREILKPVVAAMIRDEINAKKS* |
| Ga0137362_113524651 | 3300012205 | Vadose Zone Soil | DMDTLVANVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS* |
| Ga0137362_114428132 | 3300012205 | Vadose Zone Soil | PAPSMDDLVARVLARMSPEVLQAVTREILKPVVEAMVKEEMKLKKS* |
| Ga0137380_100424094 | 3300012206 | Vadose Zone Soil | PSMDDLVAKVLAKLNPEVLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0137381_115390711 | 3300012207 | Vadose Zone Soil | AAAAPANPAAPTPNIDDLVAKVLAKMNPEVLQAVTREILKPVVEAMVKEELKAMKS* |
| Ga0137379_109371982 | 3300012209 | Vadose Zone Soil | PAPGAMEAPATTVAPNTNDLVAKVLAKLTPEVLQAVTREILKPVVEAMVKEELKAKKS* |
| Ga0137378_113504951 | 3300012210 | Vadose Zone Soil | SMDDLVARVLAKMSPEVLQAVTREILRPVVEAMVQEELKSKKS* |
| Ga0137378_113537311 | 3300012210 | Vadose Zone Soil | SMDDLVARVLAKMSPEVLQAVTREILRPVVEAMVQEELKSRKS* |
| Ga0137377_115812412 | 3300012211 | Vadose Zone Soil | VARVLAKMSPEVLQAVTREILRPVVEAMVQEELKSKKS* |
| Ga0137370_107988761 | 3300012285 | Vadose Zone Soil | AAASKSSMDDLVAKVLARMSPEVLQAVTREILKPVVEAMVKEEMQSKKS* |
| Ga0137387_102622002 | 3300012349 | Vadose Zone Soil | SKSSMDDLVARVLARMSPEVLQAVTREILKPVVEAMVKEEMQSKKS* |
| Ga0137386_103438712 | 3300012351 | Vadose Zone Soil | DLVAKVLAKLNPEVLQAVTREILRPVVEAMVKEELKSKKS* |
| Ga0137386_110880301 | 3300012351 | Vadose Zone Soil | VAKVLAKLNPEVLQAVTREILRPVVEAMVKEELKSKKS* |
| Ga0137386_113117321 | 3300012351 | Vadose Zone Soil | KVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKKP* |
| Ga0137366_100470981 | 3300012354 | Vadose Zone Soil | EASEAATPSMDDLVAKVLAKLNPEVLQAVTREILKPVVEAMVKEELKLKKS* |
| Ga0137360_1000304411 | 3300012361 | Vadose Zone Soil | VAKVLARMSPEVLQRVTREILKPVVEAMVKEEMKLKKS* |
| Ga0137360_106845632 | 3300012361 | Vadose Zone Soil | DDLVARVLANMSPEVLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0137390_112951341 | 3300012363 | Vadose Zone Soil | EIVAKVLAKMNPEVLQAVTREILKPLVEAMVKDELTKK* |
| Ga0137358_101188641 | 3300012582 | Vadose Zone Soil | TPSMDDLVAKVLAKLNPEVLQAVTREILKPVVEAMVQEELKSKKS* |
| Ga0137398_100140994 | 3300012683 | Vadose Zone Soil | AAASKNNMDDVVAKVLARMSPEVLQAVTREILKPVVEAMVKEEMKLKKS* |
| Ga0137398_111613222 | 3300012683 | Vadose Zone Soil | DALVANVLAKMSPEMLQAVTREILKPEVAAMIRDEINAKKS* |
| Ga0137397_111674751 | 3300012685 | Vadose Zone Soil | MDDLVARVLANMSPEVLQAVTREILRPVVEAMVKEELKSKKS* |
| Ga0137395_102430742 | 3300012917 | Vadose Zone Soil | LARMSPEVLQAVTREILKPVVEAMVKEEMKLKKS* |
| Ga0137396_102144803 | 3300012918 | Vadose Zone Soil | VAKVLARMSPEVLQAVTREILKPVVEAMVKEEMQSKKS* |
| Ga0137396_102234992 | 3300012918 | Vadose Zone Soil | VLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS* |
| Ga0137396_104447952 | 3300012918 | Vadose Zone Soil | AASKSSMDDLVAKVLARMSPELLQAVTREILKPVVEAMVKEEMKSKKS* |
| Ga0137396_107386961 | 3300012918 | Vadose Zone Soil | RVLANMSPEVLQAVTREILKPVVEAMVKEELRSKKS* |
| Ga0137396_108865651 | 3300012918 | Vadose Zone Soil | VQAREEVAPASAPSMDDLVARVLANMSPEVLQAVTREILRPVVEAMVKEELKSKKS* |
| Ga0137394_105170092 | 3300012922 | Vadose Zone Soil | YVHEELVAAPTPSMDDLVARVLANMNPEVLQAVTREILRPVVEAMVKEELKSKKS* |
| Ga0137359_100034217 | 3300012923 | Vadose Zone Soil | MWLAKTSPEMLQSVTGEILKPVVAAMIRDEINAKKS* |
| Ga0137359_101805501 | 3300012923 | Vadose Zone Soil | TLVANVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS* |
| Ga0137359_104378452 | 3300012923 | Vadose Zone Soil | VAKVLAKMNPEVLQAVTREILKPLVEAMIKDQLHKS* |
| Ga0137359_109424871 | 3300012923 | Vadose Zone Soil | APTPSMDDLVARVLANMSPEVLQAVTREILRPVVEAMVKEELKSKKS* |
| Ga0137419_106339191 | 3300012925 | Vadose Zone Soil | ELVAKVLAKMNPEVLQAVTREILKPLIQAMVKDELDKK* |
| Ga0137404_104819572 | 3300012929 | Vadose Zone Soil | DDLVARVLAQMSPEVLQAVTREILKPVVEAMVKEELKSKKP* |
| Ga0137407_100633371 | 3300012930 | Vadose Zone Soil | AKVLAKMNPEVLQAVTREILKPLVEAMIKDELHKK* |
| Ga0137407_110329521 | 3300012930 | Vadose Zone Soil | PSMDDLVARVLANMNPEVLQAVTREILRPVVEAMVKEELKSKKP* |
| Ga0137407_123082202 | 3300012930 | Vadose Zone Soil | PAAGSTPSMDDLVAKVLAKLNPEVLQAVTREILKPVVEAMVQEELKSKKS* |
| Ga0137410_102413053 | 3300012944 | Vadose Zone Soil | PSMDDLVARVLANMSPEVLQAVTREILRPVVEAMVKEELKSKK* |
| Ga0164299_108893781 | 3300012958 | Soil | KVLARMNPEVLQAVTREILKPLVEAMIKDEMQKK* |
| Ga0134087_104853751 | 3300012977 | Grasslands Soil | NNTDDLVAKVLARMSPEVLQAVTREILKPVVEAMVKEEMKLKKS* |
| Ga0134081_100144232 | 3300014150 | Grasslands Soil | LAKMNPEVLQAVTREILKPVVEAMVKEELRSKKS* |
| Ga0134078_105758921 | 3300014157 | Grasslands Soil | PAPNMDDLVAKVLARMNPEVLQAVTREILKPVVEAIVKEELKAKKS* |
| Ga0134079_103640741 | 3300014166 | Grasslands Soil | ASKNNTDDLVAKVLARMSPEVLQAVTREILKPVVEAIVKEEMKLKKS* |
| Ga0137405_14324245 | 3300015053 | Vadose Zone Soil | MDEIVAKVLARMNPEVLQAVTREILKLWSKAMIKDELSKK* |
| Ga0137420_12251451 | 3300015054 | Vadose Zone Soil | AAKSTEAAAAKSSMDDLVAKVLARMSPEVLQAVTREILKPVVEAMVKEEMQSKKS* |
| Ga0137420_13227741 | 3300015054 | Vadose Zone Soil | VLAKMNPEMLQAVTREILKPVVEAMVKEELKSKKS* |
| Ga0137418_107001252 | 3300015241 | Vadose Zone Soil | MDEIVAKVLAKMNPEVLQAVTREILKPLVEAMIKDELHKN* |
| Ga0137409_101330571 | 3300015245 | Vadose Zone Soil | PSMDDLVARVLANMNPEVLQAVTREILRPVVEAMVKEELKSKKS* |
| Ga0182035_100014551 | 3300016341 | Soil | AAPPAASNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKK |
| Ga0182034_111633651 | 3300016371 | Soil | PNGPPPTSPQPAASNMDDLVSKVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKKP |
| Ga0182039_111328472 | 3300016422 | Soil | APPAASNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKK |
| Ga0182038_111582721 | 3300016445 | Soil | PAPEPKMDDLVAKVLAKMSPDILQAVTREILKPVVEAMVRDELQSRKP |
| Ga0187818_100602662 | 3300017823 | Freshwater Sediment | VAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKGKKS |
| Ga0187817_110381401 | 3300017955 | Freshwater Sediment | APAAAPSMDDLVARVLAKMSPEVLQAVTREILKPVVEAMVKEELKSKKS |
| Ga0187778_108683662 | 3300017961 | Tropical Peatland | NMDDLVAKVLAKMSPDVLQAVTREILKPVVEAMVKEEMKGKKP |
| Ga0187780_106715641 | 3300017973 | Tropical Peatland | DLVAKVLAQMSPEVLQAVTREILKPVVEAMVRDELNARKQ |
| Ga0187804_101925141 | 3300018006 | Freshwater Sediment | DLVAKVLAKMSPDVLQAVTREILKPVIEAMVKEELKGKKS |
| Ga0187772_105083291 | 3300018085 | Tropical Peatland | APAPSMDELVAKVLSNMSPDVLQAVTREILKPVVEAMVKEELKSKKS |
| Ga0066662_100342964 | 3300018468 | Grasslands Soil | DDLVAKVLAKLNPEVLQAVTREILKPVVEAMVQEEMKSKKP |
| Ga0193734_10268451 | 3300020015 | Soil | AEAAASKSSMDDLVAKVLARMSPELLQAVTREILKPVVEAMVKEEMKSKKS |
| Ga0179594_101711441 | 3300020170 | Vadose Zone Soil | LVARVLANMNPEVLQAVTREILRPVVEAMVKEELKSKK |
| Ga0179592_100866032 | 3300020199 | Vadose Zone Soil | NMDDLVARVLAQMSPEVLQAVTREILKPVVEAMVKEELKSKKS |
| Ga0210407_1000244816 | 3300020579 | Soil | VAKVLAKMSPDMLQAVTRDILKNVVESMVRDELNAKKQ |
| Ga0210407_105431012 | 3300020579 | Soil | EDLVTKVLAKMSPDMLQAVTRDILKNVVESMVRDELNAKKQ |
| Ga0210399_109824991 | 3300020581 | Soil | VLAKLSPDVLQAVTREILKPVIESMVKEEMNSKKS |
| Ga0215015_104599002 | 3300021046 | Soil | MDDLVAKVLAKMSPDVLQAVTREILKPVVEAMVKEELKSKKS |
| Ga0215015_108040582 | 3300021046 | Soil | MDDLVARILAKMSPEVLQAVTREILKTVVEAMVNEELKSKKS |
| Ga0210404_107319161 | 3300021088 | Soil | NVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS |
| Ga0210406_104007711 | 3300021168 | Soil | LVARVLAKMSPEVLQAVTREILKPVVEALVKEEMKSKKS |
| Ga0210406_105728052 | 3300021168 | Soil | DDLVARVLANLSPEVLQAVTRQILKPVVEAMVREELNKKP |
| Ga0210406_107390981 | 3300021168 | Soil | KVLARMSPDMMHAVTRDILKNVVESMVRDELNAKKQ |
| Ga0210406_109461952 | 3300021168 | Soil | ATAVSAPEEKAPSMDDMVAKVLAKMSPDVLQAVTREILKPVIEAMVKEEMQSKKS |
| Ga0210400_101355731 | 3300021170 | Soil | LVANVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS |
| Ga0210408_110413901 | 3300021178 | Soil | SMDDLVAKVLAKMSPDMLQAVTRDILKNVVESMVRDELNAKKQ |
| Ga0210393_110564362 | 3300021401 | Soil | VEDLVAKVLAKMSPDMLQAVTRDILKNVVESMVRDELNAKKQ |
| Ga0210387_111778621 | 3300021405 | Soil | MVAKVLAKMNPEMLQAVTRDILKNVVESMVRDELNAKKQ |
| Ga0187846_102555272 | 3300021476 | Biofilm | APEPSMDDLVAKVLSKMSPDVLQAVTREILKPVVEAMVRDELNSKK |
| Ga0210410_101212471 | 3300021479 | Soil | VLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS |
| Ga0210410_110814392 | 3300021479 | Soil | LVAKVLAKISPDMLQAVTRDILKNVVESMVRDELNAKKQ |
| Ga0210410_113398442 | 3300021479 | Soil | ELIDVPATIPAAAPNASMDDLVARVLAKMSPEVLQAVTREILKPVVEAMVKEEMKSKKS |
| Ga0210410_114644792 | 3300021479 | Soil | MVAKVLAKMSPDMLQAVTRDILKNVVESMVRDELNAKKQ |
| Ga0210409_102981411 | 3300021559 | Soil | VAKVLARMSPDMLQAVTRDILKNVVESMVRDELNNKKQ |
| Ga0126371_114905941 | 3300021560 | Tropical Forest Soil | TAAVEPKMDDLVAKVLAKMSPDVLQAVTREILKPVVEAMVRDELNSKKS |
| Ga0247669_10025315 | 3300024182 | Soil | VAKVLSKMSPEMLQAVTREILKPVVEAMVREELNAKKE |
| Ga0247688_10663681 | 3300024186 | Soil | DLVAKVLSKMSPEMLQAVTREILKPVVEAMVREELNAKKE |
| Ga0179589_106333781 | 3300024288 | Vadose Zone Soil | NMDDLVARVLAQMSPEVLQAVTREILKPVVEAMVKEELKSKKP |
| Ga0247666_10667622 | 3300024323 | Soil | TALAPLDVDELVAKVLAKMNPEALQAVTREILKPVVEALVRDELYKK |
| Ga0137417_11346732 | 3300024330 | Vadose Zone Soil | DLVARVLAKMSPEVLQAVTREILKPVVEAMVKEEMKSKKS |
| Ga0137417_11700031 | 3300024330 | Vadose Zone Soil | LVARVLAKMSPEVLQAVTREILKPVVEAMVKEEMKSKKS |
| Ga0207663_101320812 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AAQPYLDEIVAKVLAKMNPDVMEAVTREILRPLVEAMIKNELQKK |
| Ga0207665_100492161 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SVPDMDEIVAKVLARMNPEILQAVTREILKPLVEAMIKDEIHKK |
| Ga0209438_10712351 | 3300026285 | Grasslands Soil | VEAPAAAPAAAPNMDDLVARVLAQMSPEVLQAVTREILKPVVEAMVKEELKSKKS |
| Ga0209234_11465532 | 3300026295 | Grasslands Soil | MDDLVAKVLAKMNPEVLQAVTREILKPVVEAMVQEELKSKKS |
| Ga0209240_10045915 | 3300026304 | Grasslands Soil | MDDLVAKVLARMSPEVLQAVTREILKPVVEAMVKEEMQSKKS |
| Ga0209802_11742102 | 3300026328 | Soil | RVLANMSPEVLQAVTREILRPVVEAMVKEELKSKKS |
| Ga0257172_10177672 | 3300026482 | Soil | AAAAKSSMDDLVAKVLARMSPEVLQAVTREILKPVVEAMVKEEMQSKKS |
| Ga0257153_10373761 | 3300026490 | Soil | EIVAKVLAKMNPEVLQAVTREILKPLVEAMVKDELTKK |
| Ga0209156_104172701 | 3300026547 | Soil | SGLILAKMSPEVLQAVTREILKPVVEAMVKEELKSKKS |
| Ga0209648_104366752 | 3300026551 | Grasslands Soil | KVLARMSPEVLQAVTREILKPVVEAMVKEEMESKKS |
| Ga0209577_101957052 | 3300026552 | Soil | TAPNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKDEMKSKKS |
| Ga0179593_10837201 | 3300026555 | Vadose Zone Soil | PAAPNMDDLVARVLAQMSPEVLQAVTREILKPVVEAMVKEELKSKKS |
| Ga0207949_10183581 | 3300026999 | Forest Soil | VEAPAAEPAAAPSASMDDLVARVLARMSPEVLQAVTREILKPVVEAMVKEEMKLKKS |
| Ga0208365_10293102 | 3300027070 | Forest Soil | EAAVAEAAQSSMDDLVAKVLANLSPDVLQAVTREILKPVVAAMVKEEMKSKKS |
| Ga0207506_10023021 | 3300027460 | Soil | KTAEPSMEDLVAKVLSKMSPEMLQAVTREILKPVVEAMVREELNAKKE |
| Ga0209588_11186671 | 3300027671 | Vadose Zone Soil | APTPTPSMDDLVAKVLARMSPEVLQAVTREILKPVVEAMVKEEMESKKS |
| Ga0209248_101471571 | 3300027729 | Bog Forest Soil | KVLSNMSPDMLQAVTRDILKNVVESMVRDEMNAKKK |
| Ga0209655_100473343 | 3300027767 | Bog Forest Soil | AAESKLASEDLVARVLASLSPEVMQAVTRELLKPVVEAMVRDELNKKK |
| Ga0209811_101405481 | 3300027821 | Surface Soil | MDVLVANVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS |
| Ga0209773_102690631 | 3300027829 | Bog Forest Soil | DMVAKVLAKMSPEMLQAVTRDILKNVVESMVRDELNAKKQ |
| Ga0209180_103435912 | 3300027846 | Vadose Zone Soil | VAKVLAKLNPEVLQAVTREILRPVVEAMVKEELKSKKS |
| Ga0209693_101252181 | 3300027855 | Soil | SSKAPETSMEDMVAKVLAKMSPEMLQAVTREILKPVVEAMVKEEMNSKKS |
| Ga0209283_107636501 | 3300027875 | Vadose Zone Soil | ASQPDMDTLVAKVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS |
| Ga0209283_108818981 | 3300027875 | Vadose Zone Soil | LVAKVLAKMSPEVLQAVTREILKPVVEAMVKEEMKSK |
| Ga0209590_105930972 | 3300027882 | Vadose Zone Soil | VANVLAKMSPEMLQAVTREILKPVVAAMIRDEINAKKS |
| Ga0209068_105489441 | 3300027894 | Watersheds | MDDLVARVLAKMSPEVLQAVTREILKPVVEAMVKEEMKSKKS |
| Ga0209067_102524431 | 3300027898 | Watersheds | LSHPCWDSAPAPSPSMDDLVARVLAKMSPDVLQAVTREILKPVVEAMVKEEMKSKKS |
| Ga0209526_109613111 | 3300028047 | Forest Soil | IAPAPQQAGETASPSMDDLVARVLANLSPDVLQAVTREILKPVIAAMVNEEMKSKKS |
| Ga0308309_112812821 | 3300028906 | Soil | AKVLARMSPDMLQAVTRDILKNVVESMVRDELNAKKQ |
| Ga0222749_103070462 | 3300029636 | Soil | DLVAKVLANLSPDVLQAVTREILKPVVAAMVKEEMKSKKS |
| Ga0311371_123837782 | 3300029951 | Palsa | TQGAPANSVDADLVARVLASLSPEVMQAVTRELLKPVVEAMVREELNKKK |
| Ga0170834_1028699381 | 3300031057 | Forest Soil | RVLARMSPEVLQAVTREILKPVVEAMVKEEMKLKKS |
| Ga0170834_1072647762 | 3300031057 | Forest Soil | KVLSKLSPEVLQAVTRELLKPVIAALVADELKSKK |
| Ga0318534_102500721 | 3300031544 | Soil | SPAAPPEPDMDELVAKVLAKMNPEVLQAVTREILKPVVEALVKDELGKK |
| Ga0318561_106964781 | 3300031679 | Soil | LVARVLAKMDPEVLQAVTREILKPVVEALVKDELNKN |
| Ga0307469_124618651 | 3300031720 | Hardwood Forest Soil | LVANVLAKMSPEMLQAVTREILKPVVAAMIRDEINVKKS |
| Ga0318494_104871862 | 3300031751 | Soil | EPNGSAPAAAPPAASNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKK |
| Ga0307475_105359361 | 3300031754 | Hardwood Forest Soil | AVPGSMDEVVAKVMANLSPDVLQAVTREILKPVIEAMVKEEMKSKKS |
| Ga0318509_100172832 | 3300031768 | Soil | MDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKK |
| Ga0307478_111140692 | 3300031823 | Hardwood Forest Soil | VLAKMSPDVLQAVTREILKPVVEAMVKEEMNSKKP |
| Ga0310917_108423731 | 3300031833 | Soil | VAKVLAKMNPEVLQAVTREILKPVVEALVKDELGKK |
| Ga0318517_101209091 | 3300031835 | Soil | KVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKK |
| Ga0318544_100276302 | 3300031880 | Soil | NGSAPTAAPPAASNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKK |
| Ga0306923_121385851 | 3300031910 | Soil | AKVLAKMNPEVLQAVTREILKPVIEALVKDELNKK |
| Ga0310910_115295111 | 3300031946 | Soil | LVARVLAKMNPEVLQAVTREILKPVVEALVKDELHRK |
| Ga0307479_118842941 | 3300031962 | Hardwood Forest Soil | ATPAPAPSMDDLVARVLARMSPEVLQAVTREILKPVVEAMVKEEMNSRKS |
| Ga0318531_102408002 | 3300031981 | Soil | ALAAAPPAASNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKK |
| Ga0318575_106581881 | 3300032055 | Soil | ASPEPDMDELVAKVLAKMNLEVLQAVTREILKPVVEALVKDELGKK |
| Ga0318504_100491062 | 3300032063 | Soil | VEPNGSAPTAAPPAASNMDDLVAKVLAKMSPEVLQAVTREILKPVVEAMVKEELKAKK |
| Ga0307472_1004507501 | 3300032205 | Hardwood Forest Soil | VAKVLARMSPDVLQAVTREILKPVVEAMVKEEMKSKKS |
| Ga0307472_1011783301 | 3300032205 | Hardwood Forest Soil | PPAAPNTDDLVARVLARMNPEVLQAVTREILKPVVEAMVKEELKSKKS |
| Ga0310811_102972922 | 3300033475 | Soil | AEPSMEDLVAKVLSKMSPEMLQAVTREILKPVVEAMVREELNAKKE |
| Ga0316628_1009664961 | 3300033513 | Soil | VAKVLSKMSPDMLQAVTREILKPVVEAMVREELNAKK |
| ⦗Top⦘ |