


| Basic Information | |
|---|---|
| Family ID | F017564 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 240 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSADPAGVRSV |
| Number of Associated Samples | 206 |
| Number of Associated Scaffolds | 240 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 97.08 % |
| Associated GOLD sequencing projects | 203 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.833 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.417 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 240 Family Scaffolds |
|---|---|---|
| PF09851 | SHOCT | 91.25 |
| PF13396 | PLDc_N | 0.83 |
| PF08241 | Methyltransf_11 | 0.42 |
| PF03724 | META | 0.42 |
| PF01804 | Penicil_amidase | 0.42 |
| PF00081 | Sod_Fe_N | 0.42 |
| PF01494 | FAD_binding_3 | 0.42 |
| PF00884 | Sulfatase | 0.42 |
| PF01740 | STAS | 0.42 |
| PF07366 | SnoaL | 0.42 |
| PF13581 | HATPase_c_2 | 0.42 |
| PF13483 | Lactamase_B_3 | 0.42 |
| PF07394 | DUF1501 | 0.42 |
| PF01957 | NfeD | 0.42 |
| PF00274 | Glycolytic | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 240 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.83 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.42 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.42 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.42 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.42 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.42 |
| COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.83 % |
| Unclassified | root | N/A | 39.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_81454 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300000955|JGI1027J12803_103325580 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300003369|JGI24140J50213_10248445 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300004633|Ga0066395_11033877 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300004643|Ga0062591_100855093 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300004798|Ga0058859_11589978 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300004801|Ga0058860_10004491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1022 | Open in IMG/M |
| 3300004803|Ga0058862_12289173 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300005338|Ga0068868_101906004 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005356|Ga0070674_100369500 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300005526|Ga0073909_10112829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1091 | Open in IMG/M |
| 3300005530|Ga0070679_101498823 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005535|Ga0070684_100870666 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300005535|Ga0070684_101001888 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005545|Ga0070695_100618994 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300005546|Ga0070696_101490793 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005547|Ga0070693_100911302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300005564|Ga0070664_100840887 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005614|Ga0068856_100465544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1285 | Open in IMG/M |
| 3300005615|Ga0070702_100870002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300005713|Ga0066905_100273885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1311 | Open in IMG/M |
| 3300005718|Ga0068866_10333541 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300005764|Ga0066903_103013747 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005764|Ga0066903_106815301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 593 | Open in IMG/M |
| 3300006049|Ga0075417_10347826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 726 | Open in IMG/M |
| 3300006059|Ga0075017_100411307 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300006163|Ga0070715_10865466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300006175|Ga0070712_101632982 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006196|Ga0075422_10039396 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300006576|Ga0074047_12000294 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006846|Ga0075430_100017119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6172 | Open in IMG/M |
| 3300006876|Ga0079217_11300480 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006881|Ga0068865_100975584 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300006904|Ga0075424_101912645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 627 | Open in IMG/M |
| 3300009093|Ga0105240_11003583 | Not Available | 892 | Open in IMG/M |
| 3300009098|Ga0105245_11271947 | Not Available | 784 | Open in IMG/M |
| 3300009100|Ga0075418_10779472 | Not Available | 1032 | Open in IMG/M |
| 3300009101|Ga0105247_10808144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300009147|Ga0114129_11339649 | Not Available | 886 | Open in IMG/M |
| 3300009147|Ga0114129_13256190 | Not Available | 526 | Open in IMG/M |
| 3300009147|Ga0114129_13466990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300009148|Ga0105243_12204361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300009176|Ga0105242_11159153 | Not Available | 790 | Open in IMG/M |
| 3300009792|Ga0126374_11163586 | Not Available | 615 | Open in IMG/M |
| 3300009840|Ga0126313_10078967 | Not Available | 2382 | Open in IMG/M |
| 3300010038|Ga0126315_10730978 | Not Available | 648 | Open in IMG/M |
| 3300010041|Ga0126312_10021029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4360 | Open in IMG/M |
| 3300010043|Ga0126380_11576479 | Not Available | 585 | Open in IMG/M |
| 3300010045|Ga0126311_11599657 | Not Available | 548 | Open in IMG/M |
| 3300010047|Ga0126382_10241285 | Not Available | 1317 | Open in IMG/M |
| 3300010146|Ga0126320_1099574 | Not Available | 734 | Open in IMG/M |
| 3300010146|Ga0126320_1270089 | Not Available | 533 | Open in IMG/M |
| 3300010147|Ga0126319_1335060 | Not Available | 948 | Open in IMG/M |
| 3300010154|Ga0127503_10027668 | Not Available | 957 | Open in IMG/M |
| 3300010154|Ga0127503_10855610 | Not Available | 944 | Open in IMG/M |
| 3300010154|Ga0127503_10931311 | Not Available | 845 | Open in IMG/M |
| 3300010166|Ga0126306_10107795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2022 | Open in IMG/M |
| 3300010166|Ga0126306_11200824 | Not Available | 623 | Open in IMG/M |
| 3300010166|Ga0126306_11352411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300010359|Ga0126376_11719012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300010360|Ga0126372_12100123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300010361|Ga0126378_13152994 | Not Available | 525 | Open in IMG/M |
| 3300010371|Ga0134125_10968819 | Not Available | 933 | Open in IMG/M |
| 3300010371|Ga0134125_11626003 | Not Available | 703 | Open in IMG/M |
| 3300010396|Ga0134126_11905676 | Not Available | 651 | Open in IMG/M |
| 3300010399|Ga0134127_13300873 | Not Available | 528 | Open in IMG/M |
| 3300010400|Ga0134122_10393533 | Not Available | 1221 | Open in IMG/M |
| 3300010400|Ga0134122_11649080 | Not Available | 667 | Open in IMG/M |
| 3300010403|Ga0134123_10729139 | Not Available | 974 | Open in IMG/M |
| 3300011119|Ga0105246_10328119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita → Nakamurella multipartita DSM 44233 | 1246 | Open in IMG/M |
| 3300011398|Ga0137348_1032651 | Not Available | 851 | Open in IMG/M |
| 3300011415|Ga0137325_1010964 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300012212|Ga0150985_107753651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300012378|Ga0134025_1107701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 626 | Open in IMG/M |
| 3300012469|Ga0150984_107274000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1116 | Open in IMG/M |
| 3300012469|Ga0150984_112872045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300012481|Ga0157320_1035637 | Not Available | 520 | Open in IMG/M |
| 3300012496|Ga0157353_1031422 | Not Available | 568 | Open in IMG/M |
| 3300012519|Ga0157352_1081067 | Not Available | 543 | Open in IMG/M |
| 3300012905|Ga0157296_10185241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300012907|Ga0157283_10294902 | Not Available | 560 | Open in IMG/M |
| 3300012908|Ga0157286_10474833 | Not Available | 502 | Open in IMG/M |
| 3300012911|Ga0157301_10348950 | Not Available | 557 | Open in IMG/M |
| 3300012914|Ga0157297_10328065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 587 | Open in IMG/M |
| 3300012948|Ga0126375_10585781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300012960|Ga0164301_10876492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 694 | Open in IMG/M |
| 3300012961|Ga0164302_11747353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300012987|Ga0164307_10191133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 1386 | Open in IMG/M |
| 3300012987|Ga0164307_10326098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
| 3300012987|Ga0164307_10368227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 1049 | Open in IMG/M |
| 3300013096|Ga0157307_1104171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300013296|Ga0157374_10229520 | Not Available | 1823 | Open in IMG/M |
| 3300013297|Ga0157378_10668162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1056 | Open in IMG/M |
| 3300014259|Ga0075311_1100746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 617 | Open in IMG/M |
| 3300014267|Ga0075313_1021145 | Not Available | 1477 | Open in IMG/M |
| 3300014271|Ga0075326_1192542 | Not Available | 610 | Open in IMG/M |
| 3300014272|Ga0075327_1102808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 866 | Open in IMG/M |
| 3300014310|Ga0075331_1193029 | Not Available | 514 | Open in IMG/M |
| 3300014745|Ga0157377_10854392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300015077|Ga0173483_10104672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1185 | Open in IMG/M |
| 3300015200|Ga0173480_10044076 | Not Available | 1981 | Open in IMG/M |
| 3300015201|Ga0173478_10148380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 929 | Open in IMG/M |
| 3300015371|Ga0132258_12718302 | Not Available | 1234 | Open in IMG/M |
| 3300015372|Ga0132256_101274280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
| 3300015373|Ga0132257_101186093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300015374|Ga0132255_102070256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300016319|Ga0182033_11844147 | Not Available | 549 | Open in IMG/M |
| 3300017792|Ga0163161_11145087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300017947|Ga0187785_10459097 | Not Available | 626 | Open in IMG/M |
| 3300017965|Ga0190266_10130938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 1092 | Open in IMG/M |
| 3300017965|Ga0190266_11184050 | Not Available | 528 | Open in IMG/M |
| 3300018032|Ga0187788_10372296 | Not Available | 595 | Open in IMG/M |
| 3300018054|Ga0184621_10144108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 857 | Open in IMG/M |
| 3300018054|Ga0184621_10261788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 615 | Open in IMG/M |
| 3300018073|Ga0184624_10185184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 925 | Open in IMG/M |
| 3300018073|Ga0184624_10377998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 632 | Open in IMG/M |
| 3300018075|Ga0184632_10228099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 817 | Open in IMG/M |
| 3300018076|Ga0184609_10300624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300018078|Ga0184612_10191080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1066 | Open in IMG/M |
| 3300018432|Ga0190275_10610080 | Not Available | 1140 | Open in IMG/M |
| 3300018469|Ga0190270_12686194 | Not Available | 560 | Open in IMG/M |
| 3300018476|Ga0190274_10771355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
| 3300018476|Ga0190274_13721376 | Not Available | 516 | Open in IMG/M |
| 3300018481|Ga0190271_11906095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300019233|Ga0184645_1146566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300019263|Ga0184647_1280119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 915 | Open in IMG/M |
| 3300019361|Ga0173482_10282740 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300019869|Ga0193705_1089371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300020002|Ga0193730_1175606 | Not Available | 544 | Open in IMG/M |
| 3300020069|Ga0197907_11212273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
| 3300021073|Ga0210378_10162101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2 | 861 | Open in IMG/M |
| 3300021560|Ga0126371_13918037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300022195|Ga0222625_1782206 | Not Available | 633 | Open in IMG/M |
| 3300022756|Ga0222622_10420982 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300022756|Ga0222622_11441086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300022883|Ga0247786_1150069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300024331|Ga0247668_1040477 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300025386|Ga0208585_1001385 | Not Available | 1930 | Open in IMG/M |
| 3300025898|Ga0207692_10205639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 1160 | Open in IMG/M |
| 3300025926|Ga0207659_11668036 | Not Available | 543 | Open in IMG/M |
| 3300025927|Ga0207687_10418520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
| 3300025927|Ga0207687_10858128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 776 | Open in IMG/M |
| 3300025931|Ga0207644_10831461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300025944|Ga0207661_10450988 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300025949|Ga0207667_11826751 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300025960|Ga0207651_10467010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1085 | Open in IMG/M |
| 3300025961|Ga0207712_11455509 | Not Available | 613 | Open in IMG/M |
| 3300026035|Ga0207703_12281575 | Not Available | 517 | Open in IMG/M |
| 3300026075|Ga0207708_10244762 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300026089|Ga0207648_11103883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300026121|Ga0207683_10285084 | Not Available | 1510 | Open in IMG/M |
| 3300026121|Ga0207683_10412849 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300027209|Ga0209875_1002703 | All Organisms → cellular organisms → Bacteria | 2239 | Open in IMG/M |
| 3300027909|Ga0209382_10843021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 971 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1149758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300028587|Ga0247828_10292762 | Not Available | 894 | Open in IMG/M |
| 3300028592|Ga0247822_11714474 | Not Available | 535 | Open in IMG/M |
| 3300028592|Ga0247822_11889556 | Not Available | 511 | Open in IMG/M |
| 3300028679|Ga0302169_10130335 | Not Available | 623 | Open in IMG/M |
| 3300028715|Ga0307313_10111910 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300028721|Ga0307315_10006919 | Not Available | 2772 | Open in IMG/M |
| 3300028722|Ga0307319_10254991 | Not Available | 578 | Open in IMG/M |
| 3300028722|Ga0307319_10274061 | Not Available | 557 | Open in IMG/M |
| 3300028732|Ga0302264_1023331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1424 | Open in IMG/M |
| 3300028733|Ga0302261_1097177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 696 | Open in IMG/M |
| 3300028744|Ga0307318_10299616 | Not Available | 563 | Open in IMG/M |
| 3300028754|Ga0307297_10130549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300028755|Ga0307316_10268093 | Not Available | 622 | Open in IMG/M |
| 3300028764|Ga0302260_1043817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
| 3300028771|Ga0307320_10035751 | Not Available | 1815 | Open in IMG/M |
| 3300028771|Ga0307320_10133592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
| 3300028778|Ga0307288_10051364 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300028782|Ga0307306_10018666 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300028784|Ga0307282_10188201 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300028802|Ga0307503_10595420 | Not Available | 609 | Open in IMG/M |
| 3300028809|Ga0247824_10307199 | Not Available | 894 | Open in IMG/M |
| 3300028828|Ga0307312_11007563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300028870|Ga0302254_10122036 | Not Available | 954 | Open in IMG/M |
| 3300028870|Ga0302254_10127504 | Not Available | 933 | Open in IMG/M |
| 3300028872|Ga0307314_10316610 | Not Available | 501 | Open in IMG/M |
| 3300028876|Ga0307286_10098027 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300028880|Ga0307300_10132442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300028880|Ga0307300_10332221 | Not Available | 520 | Open in IMG/M |
| 3300028889|Ga0247827_10142815 | Not Available | 1261 | Open in IMG/M |
| 3300030052|Ga0302217_10040187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
| 3300030336|Ga0247826_10091760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1860 | Open in IMG/M |
| 3300030339|Ga0311360_11032185 | Not Available | 649 | Open in IMG/M |
| 3300030552|Ga0247654_1021324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 872 | Open in IMG/M |
| 3300030620|Ga0302046_11131203 | Not Available | 618 | Open in IMG/M |
| 3300030829|Ga0308203_1025481 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300030838|Ga0311335_10155018 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300030902|Ga0308202_1061964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
| 3300030902|Ga0308202_1117659 | Not Available | 565 | Open in IMG/M |
| 3300030903|Ga0308206_1131211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300030905|Ga0308200_1092525 | Not Available | 633 | Open in IMG/M |
| 3300030905|Ga0308200_1184218 | Not Available | 501 | Open in IMG/M |
| 3300030988|Ga0308183_1035905 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300030990|Ga0308178_1026353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
| 3300030993|Ga0308190_1038454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
| 3300030993|Ga0308190_1084901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
| 3300031094|Ga0308199_1038566 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300031094|Ga0308199_1054720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300031100|Ga0308180_1022788 | Not Available | 618 | Open in IMG/M |
| 3300031114|Ga0308187_10037632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1263 | Open in IMG/M |
| 3300031123|Ga0308195_1014293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300031124|Ga0308151_1020966 | Not Available | 675 | Open in IMG/M |
| 3300031170|Ga0307498_10124613 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300031422|Ga0308186_1020554 | Not Available | 635 | Open in IMG/M |
| 3300031548|Ga0307408_102450950 | Not Available | 507 | Open in IMG/M |
| 3300031564|Ga0318573_10632342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300031720|Ga0307469_12528988 | Not Available | 502 | Open in IMG/M |
| 3300031781|Ga0318547_10527944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300031852|Ga0307410_10978972 | Not Available | 728 | Open in IMG/M |
| 3300031903|Ga0307407_11205509 | Not Available | 591 | Open in IMG/M |
| 3300031908|Ga0310900_11486926 | Not Available | 571 | Open in IMG/M |
| 3300031911|Ga0307412_10241128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1398 | Open in IMG/M |
| 3300031912|Ga0306921_11591331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300031918|Ga0311367_10311487 | Not Available | 1632 | Open in IMG/M |
| 3300031995|Ga0307409_101123595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300032004|Ga0307414_10836446 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300032043|Ga0318556_10335414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
| 3300032126|Ga0307415_100747392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300032164|Ga0315283_11037809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
| 3300032177|Ga0315276_11114293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 835 | Open in IMG/M |
| 3300032276|Ga0316188_10353734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300032783|Ga0335079_10604519 | Not Available | 1156 | Open in IMG/M |
| 3300033408|Ga0316605_11539617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300033433|Ga0326726_11894063 | Not Available | 581 | Open in IMG/M |
| 3300033550|Ga0247829_10013198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4943 | Open in IMG/M |
| 3300033551|Ga0247830_10432615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300034659|Ga0314780_041319 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300034659|Ga0314780_076509 | Not Available | 723 | Open in IMG/M |
| 3300034660|Ga0314781_148090 | Not Available | 507 | Open in IMG/M |
| 3300034662|Ga0314783_031808 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300034664|Ga0314786_015185 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300034664|Ga0314786_147737 | Not Available | 547 | Open in IMG/M |
| 3300034666|Ga0314788_032338 | Not Available | 948 | Open in IMG/M |
| 3300034666|Ga0314788_089221 | Not Available | 677 | Open in IMG/M |
| 3300034678|Ga0314803_024037 | Not Available | 927 | Open in IMG/M |
| 3300034678|Ga0314803_079601 | Not Available | 614 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.92% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.92% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.08% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.08% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.25% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.25% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.83% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.42% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.42% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.42% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.42% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.42% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025386 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028732 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028733 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028764 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030052 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030552 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031100 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031124 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_01170200 | 2199352025 | Soil | MAEPYSRLAGVYDEIVVDPCHEAWASYLHDRWRGDPDGVHTVLDLCCG |
| JGI1027J12803_1033255801 | 3300000955 | Soil | VDEAEPYARLADVYDEVVVDPCYDRWAAYLHELWSSDHDGVQTVLDVCCGTG |
| JGI24140J50213_102484451 | 3300003369 | Arctic Peat Soil | VTAVEAYSRLAGIYNEIVVDPCYDRWATFLHELWHSDDAGVHDVLDVCC |
| Ga0066395_110338771 | 3300004633 | Tropical Forest Soil | VIPVEAYSRLAGVYDEIVVDPCHGAWASFLHELWRDDENGVHRVLDVCCGTGLL |
| Ga0062591_1008550931 | 3300004643 | Soil | VRPVDAYTRLAGVYDEAVVDPCHGALARFLDELFAADDEAVAGVLDV |
| Ga0058859_115899781 | 3300004798 | Host-Associated | VKPVEAYSRLAGIYDEVVIDPCHGQWASYLHALWSADPEGVRTVLDVCCGTGLLAS |
| Ga0058860_100044913 | 3300004801 | Host-Associated | VKPVEAYSRLAGIYDEVVIDPCHGQWASYLHALWSADPEGVR |
| Ga0058862_122891731 | 3300004803 | Host-Associated | MTVDEAEPYTRLAAVYDEIVVDPCHRAWASYLHELWAGDPAHVRCVLDLGCGTGLMA |
| Ga0068868_1019060042 | 3300005338 | Miscanthus Rhizosphere | VTVDGAEPYTRLAAVYDEIVVDPCHRAWASYLHELWAGDPAHVHCVLDLGCG |
| Ga0070674_1003695004 | 3300005356 | Miscanthus Rhizosphere | VRPVDAYTRLAGVYDEVVVDPCHADWAGFLDGLFEGDEDGVSDVLDVCCGTGLLAAELAARG |
| Ga0073909_101128293 | 3300005526 | Surface Soil | VRPVDAYTRLAGVYDEAVVDPCHGALAGFLDELFAAGEEAVAFVLD |
| Ga0070679_1014988231 | 3300005530 | Corn Rhizosphere | VKPVEAYSRLAGIYDEVVIDPCHGQWASYLHALWSADPEGVRTVLDVCCG |
| Ga0070684_1008706663 | 3300005535 | Corn Rhizosphere | VSEAAEHEAAPYSRLAGVYDEMVVDSCHGRWAAHLDELWRADSHSVRTVLDLCCGT |
| Ga0070684_1010018883 | 3300005535 | Corn Rhizosphere | VRPVDAYTRLAGVYDEVVVDPCHADWAGFLDGLFEGDEEGVSDVLDVCCGTGLLAAE |
| Ga0070695_1006189943 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPDGVRSVL |
| Ga0070696_1014907931 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPVENYTRLAGVYDEVVVDPCHGAWAEFLDELFGTDEAGVTDVLDVCCGTGLLAAELTA |
| Ga0070693_1009113023 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VKPVEAYSRLAGIYDEVVIDPCHGQWASYLHALWSADPEGV |
| Ga0070664_1008408873 | 3300005564 | Corn Rhizosphere | VDEAEPYARLAAVYDEIVVDPCHRVWATYLHELWVDDPAQVHSVLDLGC |
| Ga0068856_1004655444 | 3300005614 | Corn Rhizosphere | VRPVEAYTRLAGVYDEAVVDPCHDALAAFLDELFGADE |
| Ga0070702_1008700021 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEAEPYARLAAVYDEIVVDPCHRVWASYLHELWVSDPAQVH |
| Ga0066905_1002738851 | 3300005713 | Tropical Forest Soil | VRQVEAYTRLAGVYDEIVVDPCHGAWASFLHELWSEDGHGVQTVLDVCCGTGLL |
| Ga0068866_103335413 | 3300005718 | Miscanthus Rhizosphere | VRQVEAYSRLAGVYDEIVVDPCHGRLASYFEELWGADPAGVR |
| Ga0066903_1030137471 | 3300005764 | Tropical Forest Soil | VSEVEAYTRLAGVYDEIVIDPCHGAWASFLDRLWGEGDDVHDVLDVCCG |
| Ga0066903_1068153013 | 3300005764 | Tropical Forest Soil | VGQVDAYTSLAGVYDELVVDPCHGAWAAFLDELWSDDEHGVHDVLDVCCGTGLLAGEL |
| Ga0075417_103478263 | 3300006049 | Populus Rhizosphere | VRQVEAYSRLAGLYDEIVIDPCHDRCASYLDELWSDDADGVRSVLD |
| Ga0075017_1004113073 | 3300006059 | Watersheds | VSAAEAYSRLAGVYDEIVVDPCHRSWAGFLDELWSSDESGVRSVLDVCCGTGLLAAELV |
| Ga0070715_108654661 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPVDAYTRLAGVYDEAVVDPCHDALAAFLDELFGADEEAVAGVLDVCCGTGLL |
| Ga0070712_1016329822 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VRANEAEPYARLAAVYDEIVVDPCHRAWASYLHDLWTSDQAGVRRVLDLGCGTG |
| Ga0075422_100393961 | 3300006196 | Populus Rhizosphere | VAQVEAYTRLAGVYDEIVVDPCHGAWASFLHELWSDDEHGVH |
| Ga0074047_120002942 | 3300006576 | Soil | VRANEAEPYARLAGVYDEIVVDPCHRVWASYLHDLWTSDPAEVHSVLDLGWGLP* |
| Ga0075430_1000171191 | 3300006846 | Populus Rhizosphere | VRHAEAYSRLAGVYDEIVVDPCHGRCAAFLHDLWSA |
| Ga0079217_113004802 | 3300006876 | Agricultural Soil | VRHVEAYSRLAGVYDEIVVDPCHGHWASFLDELWNTDRDGVRAVLDLCCGTGLLAE |
| Ga0068865_1009755843 | 3300006881 | Miscanthus Rhizosphere | VRPVDVYTRLAGVYDEVVVDPCHSALAEFLDELFDADNEKVADVLDVCCGTGLLA |
| Ga0075424_1019126453 | 3300006904 | Populus Rhizosphere | VRHAEAYSRLAGVYDEIVVDPCHDRWASFLDDLWSADPEGVCSVLDLCCGTG |
| Ga0105240_110035831 | 3300009093 | Corn Rhizosphere | VRHAEAYSRLAGVYDELVIDPCHDRWASFLDDLWSADPAGVHSV |
| Ga0105245_112719471 | 3300009098 | Miscanthus Rhizosphere | VRPVDAYTRLAGVYDEAVVDPCHGALARFLDELFAADDEAVAGVLDVCCGTG |
| Ga0075418_107794721 | 3300009100 | Populus Rhizosphere | VRQVEAYSRLAGLYDEIVIDPCHDRCASYLHELWSDDADGVRS |
| Ga0105247_108081441 | 3300009101 | Switchgrass Rhizosphere | VRPVDAYTRLAGVYDEFVVDPCHDAIAAFLDLLWAGDVHDVLDVA |
| Ga0114129_113396491 | 3300009147 | Populus Rhizosphere | VSHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVL |
| Ga0114129_132561903 | 3300009147 | Populus Rhizosphere | VGHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTD |
| Ga0114129_134669901 | 3300009147 | Populus Rhizosphere | VTQVEAYSRLAGVYDEMVVDPCHGRLASYFDELWGADTAGVRSVLDLG |
| Ga0105243_122043613 | 3300009148 | Miscanthus Rhizosphere | MRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSADADGVRSVLDL |
| Ga0105242_111591533 | 3300009176 | Miscanthus Rhizosphere | VRPVEAYTRLAGVYDEAVVDPCHEALAAFLDQLFGADE |
| Ga0126374_111635863 | 3300009792 | Tropical Forest Soil | LGQFEAYTRLAGVYDEIVVDPYHGAWASFLHDLWSDDERGVHT |
| Ga0126313_100789671 | 3300009840 | Serpentine Soil | VTQVEPYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPQGVRS |
| Ga0126315_107309781 | 3300010038 | Serpentine Soil | VQHVEAYSRLAEVYDEIVIDPCHDRWASFLHELWSTDP |
| Ga0126312_100210298 | 3300010041 | Serpentine Soil | VRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDP |
| Ga0126380_115764791 | 3300010043 | Tropical Forest Soil | VRTDDAYTRLAGVYDEVVVDPCHGALAGFLDELFRADEQAVAEVLDVCCGT |
| Ga0126311_115996571 | 3300010045 | Serpentine Soil | VRRAEAYSQLAGVYDEIVIDPCHDRWASFLDELWSADAAGVRSVLDLCCGT |
| Ga0126382_102412854 | 3300010047 | Tropical Forest Soil | VRQVEAYTRLAGVYDEIVIDPCHDRCATYLHELWSDDEDGVRSVLDLCCG |
| Ga0126320_10995741 | 3300010146 | Soil | VRVNEAEPYTRLAAVYDEIVVDPCHREWASFLHELWVSDPAQVHTV |
| Ga0126320_12700891 | 3300010146 | Soil | VPHAEAYSRLAGVYDEIVIDPCHDRWASYLHELWSTDPEGVRSVL |
| Ga0126319_13350603 | 3300010147 | Soil | VSQVEAYTRLAGVYDEIVVDPCHGAWASFLDELWSDDEHGVHDVLDVCCG |
| Ga0127503_100276683 | 3300010154 | Soil | VKPVEAYSRLASVYDEVVIDPCHGNWAGFLDEIWRADPQGVSSVLDLCCGT |
| Ga0127503_108556101 | 3300010154 | Soil | VRRVEAYSRLAGLYDEIVIDPCHDRWASFLHELWSADADGVRSVLDLCCGTG |
| Ga0127503_109313113 | 3300010154 | Soil | VRTVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSA |
| Ga0126306_101077951 | 3300010166 | Serpentine Soil | VGQVEAYTRLAGVYDEIVVDPCHGAWASFLHELWRDDEHGVRNVLDVCCGTGLLAGELAALG |
| Ga0126306_112008241 | 3300010166 | Serpentine Soil | MRNVAAYSRLAGIYDEIVIDPCHDRWASFLHEVWSADPVGVRS |
| Ga0126306_113524113 | 3300010166 | Serpentine Soil | MSNVAAYSRLAGVYDEIVIDPCHDRWASFLHDLWSADPEGVRSVLDL |
| Ga0126376_117190123 | 3300010359 | Tropical Forest Soil | VSQVEAYTRLAGVYDEIVVDPCHGAWAAFLDDLWRDDDVRDVLDVCCGTGLLAAELLALG |
| Ga0126372_121001233 | 3300010360 | Tropical Forest Soil | VDQAEAYTRLAGVYDEIVVDPCHGAWASFLHELWSGDGYGVHDVFDVCCGTGLLAGELV |
| Ga0126378_131529941 | 3300010361 | Tropical Forest Soil | VRPVEAYTQLAGVYDEVVVDPCHGALAGFLHELFAADEEVVAGVVDV |
| Ga0134125_109688191 | 3300010371 | Terrestrial Soil | VRQVEAYTRLAGVYDEVVVDPCHGAWAGFLDELFGTDETGVTDVLDVCCGTGLL |
| Ga0134125_116260033 | 3300010371 | Terrestrial Soil | VRPVEAYTRLAGVYDEAVVDPCHGALAAFLDELFGA |
| Ga0134126_119056763 | 3300010396 | Terrestrial Soil | VTVDGAEPYTRLAAVYDEIVVDPCHRAWASYLHELWAGDPAHVLCVL |
| Ga0134127_133008731 | 3300010399 | Terrestrial Soil | VGQVDAYTRLAGVYDEIVVDPCHGAWASFLHELWSADERGVQNVLDVCCGT |
| Ga0134122_103935333 | 3300010400 | Terrestrial Soil | VRHVEAYSRLAGIYDEVVIDPCHERWASFLDGLWSADP |
| Ga0134122_116490801 | 3300010400 | Terrestrial Soil | VSHVEAYSRLAGVYDEIVVDPCHGRWASFLHELWSADPEGVRSVLDL |
| Ga0134123_107291393 | 3300010403 | Terrestrial Soil | VSQVEAYSRLAGVYDEIVVDPCHDRWASFLDELWSADAEGVRSVLDLCCGT |
| Ga0105246_103281191 | 3300011119 | Miscanthus Rhizosphere | VDEAEPYARLAAVYDEIVVDPCHRVWATYLHELWVDDPAQVHSVLDLG |
| Ga0137348_10326511 | 3300011398 | Soil | VSHVAAYSRLAGVYDEIVIDPCHDRWASFLHEVWSADPAGVRS |
| Ga0137325_10109644 | 3300011415 | Soil | VNQFEAYTRLAGVYDEIVVDPCHDRLAAFLHELWSSDEEGVRSVLDLCCGSG |
| Ga0150985_1077536513 | 3300012212 | Avena Fatua Rhizosphere | MAQVEAYSRLAGVYDEVVADPCHDAWASFLDELWSDDEDGVRDVLDVCCGTGLLA |
| Ga0134025_11077013 | 3300012378 | Grasslands Soil | VRQVEAYSRLAGVYDEIVIDPCHDRWAAFLHELWSTD |
| Ga0150984_1072740001 | 3300012469 | Avena Fatua Rhizosphere | VRPVEAYSRLAGVYDEVVIDPCHGTWASFLHEFWSADPQGGRSGLDPCFGTRLPARGLVEGGERLRGARGPPAN |
| Ga0150984_1128720451 | 3300012469 | Avena Fatua Rhizosphere | VRQVEAYSRLAGIYDEIVIDPCHGTWAAFLDALWSADPEGVHAVLDVCCG |
| Ga0157320_10356373 | 3300012481 | Arabidopsis Rhizosphere | VRPVDAYTRLAGVYDEAVVDPCHGALAGFLAELFGADE |
| Ga0157353_10314223 | 3300012496 | Unplanted Soil | VDAYTRLAGVYDEVVVDPCHGALAGFLDELFGAGDEGVADVLDVGCG |
| Ga0157352_10810672 | 3300012519 | Unplanted Soil | VDAYTRLAGVYDEVVVDPCHGAVAEFLEELFGAGEEAVARVLDVCCGTGLLAAELVARGY |
| Ga0157296_101852411 | 3300012905 | Soil | VRPVDAYTRLAGVYDEVVVDPCHADWAGFLDGLFEGD |
| Ga0157283_102949023 | 3300012907 | Soil | VTHVEAYSRLARVYDEIVIDPCHDRWASFLHELWSTD |
| Ga0157286_104748331 | 3300012908 | Soil | VRHVEAYSRLAGVYDEIVVDPCHDRWASFLDELWNGDSE |
| Ga0157301_103489501 | 3300012911 | Soil | VRQVEAYSRLAGVYDEIVIDPCHDRSASFLHELWGADPVGVR |
| Ga0157297_103280651 | 3300012914 | Soil | VRQVEAYSRLAGVYDEIVIDPCHDRPASFLHELWSADPVG |
| Ga0126375_105857811 | 3300012948 | Tropical Forest Soil | VRPVDAYTRLAGVYDEAVVDPCHGDLAGFLDELFGVDEGAVADV |
| Ga0164301_108764921 | 3300012960 | Soil | VRSVEAYSRLAAVYDEIVIDPGHDQWASFLHGQWR |
| Ga0164302_117473531 | 3300012961 | Soil | MTVEAYSRLAGVYDQIVVDPCHGRWAGFLDELWRKDEHDVHSV |
| Ga0164307_101911333 | 3300012987 | Soil | VTVDEAEPYTRLAAVYDEIVVDPCHRAWASYLHELWAGDPAHVRCVLDLGCG |
| Ga0164307_103260983 | 3300012987 | Soil | VTQVEAYTRLAGVYDEIVIDPCHDRWASFLHELWSTDPQGVRSVL |
| Ga0164307_103682271 | 3300012987 | Soil | VTEVEAYSRLAGVYDEIVVDPCYDRWACFLHERWQSDKAGVNAVMDVCCGTG |
| Ga0157307_11041711 | 3300013096 | Soil | VRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSADPAGVRSV |
| Ga0157374_102295201 | 3300013296 | Miscanthus Rhizosphere | VRTVEAYSRLAAVYDEIVTDPCHDRWASFLQEQWRTDPAGVRLVLDLCCGT |
| Ga0157378_106681621 | 3300013297 | Miscanthus Rhizosphere | VSQVEAYSRLAGVYDEIVVDPCHDRWASFLDELWSA |
| Ga0075311_11007461 | 3300014259 | Natural And Restored Wetlands | MGHVEAYSRLAGVYDEIVVDPCHDRWASFLHELWSADAEGVCS |
| Ga0075313_10211451 | 3300014267 | Natural And Restored Wetlands | VRHVEAYSRLAGVYDDIVVDPCHAHWASFLHELWSADPEGVRSVLD |
| Ga0075326_11925421 | 3300014271 | Natural And Restored Wetlands | VRHVEAYSRLAGVYDEIVVDPCHDRYASFLHELWNADAKGVCSVLDLCC |
| Ga0075327_11028083 | 3300014272 | Natural And Restored Wetlands | MRHVEAYSRLAGVYDEIVVDPCHDRYASFLHGLWSADAAGVCSVLDLCCGT |
| Ga0075331_11930291 | 3300014310 | Natural And Restored Wetlands | VRDVEAYSRLAGVYDDIVVDPCHAHWAWFLDELWRADPEGVR |
| Ga0157377_108543921 | 3300014745 | Miscanthus Rhizosphere | VAHVEAYSRLAGVYDEIVIDPCHESWASFLHELWSADSVGVRSVLDLGCGTG |
| Ga0173483_101046724 | 3300015077 | Soil | VRHVEAYSELAGVYDEIVIDPCHDRWASFLHELWSADEEGVESVLD |
| Ga0173480_100440761 | 3300015200 | Soil | VNVAAYSRLAGVYDEIVIDPCHDRWASFLDELWSAD |
| Ga0173478_101483803 | 3300015201 | Soil | VNVAAYSRLAGVYDEIVIDPCHDRWASFLDELWSADPGGVRSVLDL |
| Ga0132258_127183021 | 3300015371 | Arabidopsis Rhizosphere | VSQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWGAAPKGVRSVLDLWCGTGLLAGEL |
| Ga0132256_1012742801 | 3300015372 | Arabidopsis Rhizosphere | VRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPDG |
| Ga0132257_1011860933 | 3300015373 | Arabidopsis Rhizosphere | VSEVEAYTRLAGVYDEIVVDPCHGAWASFLDDLWAADE |
| Ga0132255_1020702561 | 3300015374 | Arabidopsis Rhizosphere | VRPVEAYTRLAAVYDEVVVDACHGTWASFLDELWSADPQGVRSVLDVCCGTGLLARELID |
| Ga0182033_118441471 | 3300016319 | Soil | VRPVEAYSRLAGVYDEIVVDPCHGALAGFLDELFAADEEAVAGVL |
| Ga0163161_111450873 | 3300017792 | Switchgrass Rhizosphere | VRPVDAYTRLAGVYDEAVVDPCHGALAGFLAELFGADEE |
| Ga0187785_104590971 | 3300017947 | Tropical Peatland | VRPVDAYTRLAGVYDEIVVDPCHDAVAGFLDELFGGDETAVSEVLDV |
| Ga0190266_101309381 | 3300017965 | Soil | MRHVEAYSQLAGVYDEIVVDPCHDRWASFLHELWAPTRRA |
| Ga0190266_111840502 | 3300017965 | Soil | VRHAEAYSRLAGVYDEIVVDPCHDRWAAVLHDLWSA |
| Ga0187788_103722963 | 3300018032 | Tropical Peatland | VRPVDAYTRLAEIYDSVVVDPCHAAVAGFLDELFGADEESV |
| Ga0184621_101441083 | 3300018054 | Groundwater Sediment | VRHVEAYSRLAGLYDEIVIDPCHDRRASYLHELWSADADGV |
| Ga0184621_102617883 | 3300018054 | Groundwater Sediment | VRPVEAYSRLAAVYDEIVVDPCHGRWAAFLDELWTADPAGV |
| Ga0184624_101851841 | 3300018073 | Groundwater Sediment | VRPVEAYSRLAAVYDEIVVDPCHGRWAKFLDELWTADPAGVRSIL |
| Ga0184624_103779981 | 3300018073 | Groundwater Sediment | VRHVEAYSRLAEVYDEIVVDPCHDRWASFLHEHWSAD |
| Ga0184632_102280991 | 3300018075 | Groundwater Sediment | VGQVEAYSRLAGVYDEIVIDPCHDHWASFLDELWSADPVGVRSVL |
| Ga0184609_103006241 | 3300018076 | Groundwater Sediment | VAHVEAYSRLAGVYDEIVVDPCHDRWASFLHELWSADPEGVGSV |
| Ga0184612_101910801 | 3300018078 | Groundwater Sediment | VRHVEAYSRLAGIYDEIVIDPCHDQWASFLHELWGADPEGVRC |
| Ga0190275_106100804 | 3300018432 | Soil | VRHVEAYSRLAGVYDEIVVDPCYDRWASFLHELWSTDANGVHSVLDLCCGTGLLAD |
| Ga0190270_126861941 | 3300018469 | Soil | VRHAEAYSRLAGVYDEIVVDPCHDRWAAFFHDLWSADPEGVRSVLDLCCGTG |
| Ga0190274_107713553 | 3300018476 | Soil | VRHVEAYSRLAGVYDEVVIDPCHGRWASFLHELWSTDPEGVRTVLDLGCGT |
| Ga0190274_137213763 | 3300018476 | Soil | VRQAEPYSRLAGVYDEIVTDPCHDRLAAFLHELWS |
| Ga0190271_119060951 | 3300018481 | Soil | VRQVEAYTGLAGLYDEIVVDPCHDRWAAFLDQLWSADPDGVTSVLDLCCGTGLLAGEL |
| Ga0184645_11465661 | 3300019233 | Groundwater Sediment | VRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWG |
| Ga0184647_12801193 | 3300019263 | Groundwater Sediment | VRNVAAYSRLAGVYDEIVVDPCFALWATYLDAAWAGDPRRVHRVLDVCCGTGLMAAELL |
| Ga0173482_102827403 | 3300019361 | Soil | VTHVESYSRLAAVYDEMVVDDAYPQWASFLHELWRHDERGVEDVLDVCCGTGLMAYELM |
| Ga0193705_10893713 | 3300019869 | Soil | VRDVEAYSRLAGFYDEIVIDPCHDRWASFLHELWSADPEGVRFVLDLCC |
| Ga0193730_11756063 | 3300020002 | Soil | VRPVEAYSRLAAVYDEIVVDPCHGRWAAFLDELWTADPAGVRSVLDLCC |
| Ga0197907_112122733 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | LGSVAAYSRLAGVYDEIVVDPCHGRWAAFLEELWQADDPGVHSVL |
| Ga0210378_101621011 | 3300021073 | Groundwater Sediment | VQHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWRADPAG |
| Ga0126371_139180372 | 3300021560 | Tropical Forest Soil | VRPVEAYSRLAGVYDEIVVDPCHGRWAAFLDELWDVSVRTVLDLCCGTGLLAAELVALGYRV |
| Ga0222625_17822061 | 3300022195 | Groundwater Sediment | VRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPE |
| Ga0222622_104209821 | 3300022756 | Groundwater Sediment | VRQVKAYSRLAGLYDEIVIDPCHDRRASYLHELWSADADGVRSVLDLCCGTGLLAGE |
| Ga0222622_114410861 | 3300022756 | Groundwater Sediment | VRQVESYSRLAGLYDEIVVDPCHDRWASFLHELWSADAEGVRSVLDLCCGTGLLAGELI |
| Ga0247786_11500693 | 3300022883 | Soil | VRHVEAYSRLAGVYDEIVIDPCHGRWASFLHERWSTDPDGVRSVLDLCCGTG |
| Ga0247668_10404771 | 3300024331 | Soil | VIQVEAYTRLAGVYDEIVVDPCHGAWASFLDDLWRDDEPGVRDVLDVC |
| Ga0208585_10013851 | 3300025386 | Arctic Peat Soil | VTAVEAYSRLAGIYNEVVVDPCYDRWATFLHELWHSDDAGVHAVL |
| Ga0207692_102056391 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VRANEAEPYARLAAVYDEIVVDPCHRAWASYLHDLWTSDQAGVRRVL |
| Ga0207659_116680361 | 3300025926 | Miscanthus Rhizosphere | VRHVEAYSRLAGVYDEIVVDPCHDRWASFLHELWSSD |
| Ga0207687_104185201 | 3300025927 | Miscanthus Rhizosphere | VKPVEAYSRLAGIYDEVVIDPCHGQWASYLHALWSADPEGVRTVLDVCCGTG |
| Ga0207687_108581283 | 3300025927 | Miscanthus Rhizosphere | VDEAEPYARLAAVYDEIVVDPCHRVWASYLHELWVSDPAQVHNVLDL |
| Ga0207644_108314613 | 3300025931 | Switchgrass Rhizosphere | VRPVGAYTRLAGVYDEAVVDPCHGALARFLDELFAADDEAVAG |
| Ga0207661_104509883 | 3300025944 | Corn Rhizosphere | VAHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVIRLLGLWPETSNTEVR |
| Ga0207667_118267511 | 3300025949 | Corn Rhizosphere | VRPVENYTRLAGVYDEVVVDPCHDAWASFLDELFRADDDAVRDVLDVCCGTGLLAAQLV |
| Ga0207651_104670101 | 3300025960 | Switchgrass Rhizosphere | VRTVEAYSRLAAVYDEIVIDPCHERWASFLQEQWRTDPAGV |
| Ga0207712_114555093 | 3300025961 | Switchgrass Rhizosphere | VRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSADAEGVRSVLDLCCGTGLLAGELIQ |
| Ga0207703_122815751 | 3300026035 | Switchgrass Rhizosphere | VRPVDVYTRLAGVYDEVVVDPCHSALAGFLDELFDADEEKVADVLDV |
| Ga0207708_102447624 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPVEAYSRLAGVYDEIVIDPCHDQWASFLPELWSADPDGV |
| Ga0207648_111038833 | 3300026089 | Miscanthus Rhizosphere | VRHVEAYSRLAGVYDEIVVDPCHDRWASFLHELWSSDPESVGSVLDLGCGTGLL |
| Ga0207683_102850841 | 3300026121 | Miscanthus Rhizosphere | VRTVEAYSRLAAVYDEIVIDPCHDRWASFLQEQWRTDPAGVRLVL |
| Ga0207683_104128493 | 3300026121 | Miscanthus Rhizosphere | VRPVDAYTRLAGVYDEVVVDPCHADWAGFLDGLFEDDEDGVRDVLDVCCGTGLLA |
| Ga0209875_10027035 | 3300027209 | Groundwater Sand | VRHVEAYTRLAEVYDEIVIDPCHDRWASFLHELWSTDPEG |
| Ga0209382_108430211 | 3300027909 | Populus Rhizosphere | MREVAAYSRLAGIYDEIVIDPCHDRWASFLDELWSADPGGVRSVLDLCCGT |
| (restricted) Ga0247837_11497583 | 3300027970 | Freshwater | VTPYSRLAGVYDEIVVDPCFSDWAQFLVDLWSGDHVSSVLDVC |
| Ga0247828_102927621 | 3300028587 | Soil | VRHVEAYSQLAGVYDEIVVDPCHDRWAAFLHELWTPD |
| Ga0247822_117144741 | 3300028592 | Soil | MRHVEAYSQLAGVYDEIVVDPCHGRWASFLHELWSADPEGVRSVLDLGCGTG |
| Ga0247822_118895563 | 3300028592 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTD |
| Ga0302169_101303353 | 3300028679 | Fen | VSGADPYTRLAAVYDEIVVDPCHGQWAGFLHEVWAADTEGVRTVLDVCCG |
| Ga0307313_101119101 | 3300028715 | Soil | VRDVEAYSRLAGFYDEIVIDPCHDRWASFLHELWSAD |
| Ga0307315_100069194 | 3300028721 | Soil | VRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSSDPEGVRS |
| Ga0307319_102549913 | 3300028722 | Soil | VAHVEPYSRLAGIYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDLCC |
| Ga0307319_102740613 | 3300028722 | Soil | VSHVAAYSRLAEVYDEIVIDPCHDRWASFLDELWSADPMGV |
| Ga0302264_10233313 | 3300028732 | Fen | VTAVEAYSRLAGIYDEIVVDLPSYDRWAAFLHELWHSDAAAVHAVLDVCC |
| Ga0302261_10971771 | 3300028733 | Fen | MVEAEAYSRLAGVYDEIVVDPSYRRWAQYLHELWSSD |
| Ga0307318_102996163 | 3300028744 | Soil | VQHVEPYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPQ |
| Ga0307297_101305491 | 3300028754 | Soil | VRVDEAEPYTRLAAVYDEIVVDPCHRAWASYLHELWISDPAQVRCVLDLGC |
| Ga0307316_102680931 | 3300028755 | Soil | VKQVEPYSRLAGVYDEIVIDPCHDRWASFLHELWSTDP |
| Ga0302260_10438171 | 3300028764 | Fen | VPAVRVTAVEAYSRLAGIYDEIVVDLPSYDRWAAFLHELWHSDAAAVHAVLDVCCGTG |
| Ga0307320_100357514 | 3300028771 | Soil | VRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVL |
| Ga0307320_101335921 | 3300028771 | Soil | VRQVEAYSRLAGLYDEIVVDPCHDRWASFLHQLWSAYAE |
| Ga0307288_100513641 | 3300028778 | Soil | VRDVEAYSRLAGFYDEIVIDPCHDRWASFLHELWSADPEGVRFVLDLCCG |
| Ga0307306_100186664 | 3300028782 | Soil | VAHVEAYSRLAGVYDEIVIDACHDRWASFLHELWSTDPEGVRSVLDLCC |
| Ga0307282_101882013 | 3300028784 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPD |
| Ga0307503_105954201 | 3300028802 | Soil | VRQVEAYSRLAGLYDEIVIDPCHDRRASYLHELWSADADGVRSVLDLCCGTGLLAGE |
| Ga0247824_103071991 | 3300028809 | Soil | MRHVEAYSQLAGVYDEIVVDPCHGRWASFLHELWSADPEGVRS |
| Ga0307312_110075633 | 3300028828 | Soil | VRHAEAYSRLAGVYDELVVDPCHDRWASFLHDLWSDDPEGVRSVLDLCCGT |
| Ga0302254_101220361 | 3300028870 | Fen | VSGADPYTRLAAVYDEIVVDPCHGQWAGFLHEVWAADTEGVRTVLDVC |
| Ga0302254_101275041 | 3300028870 | Fen | MVEAEAYSRLAGVYDEIVVDPSYRRWARFLHELWSSDERPV |
| Ga0307314_103166102 | 3300028872 | Soil | VRQVEAYSRLAGLYDEIVIDPCHDRRASYLHELWSADAD |
| Ga0307286_100980271 | 3300028876 | Soil | VRQVEAYSRLAGLYDEIVIDPCHDRRASYLHELWSADADGVRSVLDLCCGTGLLAG |
| Ga0307300_101324421 | 3300028880 | Soil | VSHVAAYSRLAEVYDEIVIDPCHDRWASFLHEHWSADPVGVRSVLDLCC |
| Ga0307300_103322213 | 3300028880 | Soil | VRQVEAYSRLAGLYDEIVIDPCHDRRASYLHELWS |
| Ga0247827_101428154 | 3300028889 | Soil | VRQVEAYSRLAGLYDEIVIDPCHDRSASYLDELWSDDADGVRSVLDLC |
| Ga0302217_100401871 | 3300030052 | Fen | VPAVRVTAVEAYSRLAGIYDEIVVDLPSYDRWAAFLHELWHSDAAAVHAVL |
| Ga0247826_100917605 | 3300030336 | Soil | VRHVEAYSQLAGVYDEIVVDPCHDRWASFLHELWSAD |
| Ga0311360_110321853 | 3300030339 | Bog | VTAAEPYTRLAGVYDEIVVDPCYARWAAYLHELWRADDAGVRTVLDVCCG |
| Ga0247654_10213241 | 3300030552 | Soil | VRHAEAYSRLAGVYDEIVVDPCHDHCAAFLHDLWSADPEGVRSVLDLCCGTG |
| Ga0302046_111312031 | 3300030620 | Soil | VRHVEAYSRLAGFYDEIVIDPCHDAWASFLHELWSADPEGVRSVLD |
| Ga0308203_10254813 | 3300030829 | Soil | VRQVEAYSRLAGLYDEIVIDPCHDRRASYLHELWSADA |
| Ga0311335_101550184 | 3300030838 | Fen | MVEEEAYSRLAGVYDEIVVDPSYRRWAQYLHELWS |
| Ga0308202_10619641 | 3300030902 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDL |
| Ga0308202_11176593 | 3300030902 | Soil | VKQVEPYSRLAGVYDEIVIDPCHDRWASFLHELWST |
| Ga0308206_11312111 | 3300030903 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDRWASFLDELWSADP |
| Ga0308200_10925253 | 3300030905 | Soil | VRQVEAYSRLAEVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDLCCG |
| Ga0308200_11842181 | 3300030905 | Soil | VNEAEPYARLAAVYDEIVVDPCHRAWASHLHDLWTGDPAEVHSVLDL |
| Ga0308183_10359053 | 3300030988 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPDGVRSVLDVCCGTGLLAGELI |
| Ga0308178_10263531 | 3300030990 | Soil | VAHVEAYSRLAGVYDQIDIDPCHDRWASFLHELWSTDAEGVRWVLDLCCGTGLLASEL |
| Ga0308190_10384541 | 3300030993 | Soil | VRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSV |
| Ga0308190_10849013 | 3300030993 | Soil | VRPVEAYSRLAAVYDEIVIDPCHDHWASFLHERWR |
| Ga0308199_10385661 | 3300031094 | Soil | VQHVEPYSRLAGVYDEIVIDPCHDRRASYLHEVWSADADGVRSVLDLCCGTGLLA |
| Ga0308199_10547201 | 3300031094 | Soil | VRQVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSGDPDGVRS |
| Ga0308180_10227881 | 3300031100 | Soil | VKQVEPYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPESVRA |
| Ga0308187_100376321 | 3300031114 | Soil | VRDVEAYSRLAGFYDEIVIDPCHDRWASFLHELWS |
| Ga0308195_10142933 | 3300031123 | Soil | VRVDEAEPYTRLAAVYDEIVVDPCHRAWASYLHELWISDPAQVRC |
| Ga0308151_10209661 | 3300031124 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADP |
| Ga0307498_101246131 | 3300031170 | Soil | VSQVEAYTRLAGVYDEIVVDPCHGAWASFLDDVWRADVPGVR |
| Ga0308186_10205543 | 3300031422 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDLCC |
| Ga0307408_1024509501 | 3300031548 | Rhizosphere | VQHVEAYSRLAGVYDEIVIDPCHDRWASFLHALWSTDPQGVRSVLDLCCGTGLLAGELIA |
| Ga0318573_106323423 | 3300031564 | Soil | VSQVEAYTNLAGVYDQIVVDPCHGVIASFLDDLWSTGGDGVRE |
| Ga0307469_125289882 | 3300031720 | Hardwood Forest Soil | VDKSEPYARLADVYDDVVVDPCHDRWAAYLHELWSSDHDSVQAVLDVCCGTGL |
| Ga0318547_105279441 | 3300031781 | Soil | VRPVEAYSRLAGVYDEIVVDPCHGRWARFLDELWERGVHAVLDLCCGTG |
| Ga0307410_109789721 | 3300031852 | Rhizosphere | VRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWST |
| Ga0307407_112055091 | 3300031903 | Rhizosphere | VRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWS |
| Ga0310900_114869261 | 3300031908 | Soil | VGQVEAYTRLAGVYDEIVVDPCHGALASFLHELWSDDARGVHDVLDVCCGTGLL |
| Ga0307412_102411281 | 3300031911 | Rhizosphere | VQHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDLCC |
| Ga0306921_115913313 | 3300031912 | Soil | VKPVEAYSRLAGVYDEIVVDPCHGAWAAFLDGLWRADEQRVQEVLDVCCGT |
| Ga0311367_103114871 | 3300031918 | Fen | VTDAEAYSLLAGVYDEIVVDPCHALWAGYLDGLWRADEAGVHDVLDVCCG |
| Ga0307409_1011235951 | 3300031995 | Rhizosphere | VRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDVC |
| Ga0307414_108364461 | 3300032004 | Rhizosphere | VRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWST |
| Ga0318556_103354143 | 3300032043 | Soil | VRPVEAYSRLAGVYDEIVVDPCHGRWAAFLDELWDGGVGAVLDVCCGTGLLAAEL |
| Ga0307415_1007473923 | 3300032126 | Rhizosphere | VRQVEPYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPQGV |
| Ga0315283_110378091 | 3300032164 | Sediment | VSGADPYARLAGVYDEIVVDPCYGRWAAHLHELWEGDTTG |
| Ga0315276_111142931 | 3300032177 | Sediment | VSGADPYARLAGVYDEIVVDPCYGRWAAHLHELWEGDTTGVRAVLDVCCGTGLMASELIA |
| Ga0316188_103537343 | 3300032276 | Worm Burrow | MSVAEPYSRLAGVYDEIVVDPCYPLWAEFLLDLWDDDPQ |
| Ga0335079_106045191 | 3300032783 | Soil | VLKRVEAYSRLAEVYDEIVVDPCHGEWASFLDELWSADAGG |
| Ga0316605_115396173 | 3300033408 | Soil | VREADPYARLAGVYDEIVVDPCYGRWAAFLHDLWRADGGGVRTVLDVCCGTGLMAFELVA |
| Ga0326726_118940631 | 3300033433 | Peat Soil | VGAAEAYSRLAGVYDEIVVDPCYDRWAAYLHELWSSD |
| Ga0247829_100131981 | 3300033550 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRS |
| Ga0247830_104326153 | 3300033551 | Soil | VRHVEAYSRLAGVYDEIVADPCHGQWASFLDELWSADPQGVGTVL |
| Ga0314780_041319_2_124 | 3300034659 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWEADPDGV |
| Ga0314780_076509_572_721 | 3300034659 | Soil | MDEAEPYARLAGVYDEIVVDPCHRAWASHLHDLWTGDPAEVHSVLDLGCG |
| Ga0314781_148090_1_126 | 3300034660 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPDGVR |
| Ga0314783_031808_801_914 | 3300034662 | Soil | MRQVEAYSRLAGLYDEIVIDPCHGLWASFLDELWSADR |
| Ga0314786_015185_2_136 | 3300034664 | Soil | VRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPDGVRSVL |
| Ga0314786_147737_1_171 | 3300034664 | Soil | VRHVEAYSRLAGVYDEIVVDPCHDRWAAFLHELWTPDPEGVRSVLDLCCGTGLLAGE |
| Ga0314788_032338_797_946 | 3300034666 | Soil | VRHVDAYSRLAGVYDEIVVDPCHDRWASFLHQLWSSDPESVRSVLDLGCG |
| Ga0314788_089221_3_143 | 3300034666 | Soil | VRHVEAYSRLAGVYDEIVADPCHGQWASFLDELWSADPQGVGTVLDL |
| Ga0314803_024037_793_927 | 3300034678 | Soil | MRVDEAEPYARLAGVYDEIVVDPCYRAWASHLHDLWTGDPAEVHS |
| Ga0314803_079601_1_135 | 3300034678 | Soil | MRHVEAYSQLAGVYDEIVVDPCHGRWASFLHELWSADPEGVRSVL |
| ⦗Top⦘ |