


| Basic Information | |
|---|---|
| Family ID | F017019 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 243 |
| Average Sequence Length | 39 residues |
| Representative Sequence | DYEVYAQFNGHKSDTKSVSQFDDRSQVYVDLKIDTR |
| Number of Associated Samples | 212 |
| Number of Associated Scaffolds | 243 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.41 % |
| % of genes near scaffold ends (potentially truncated) | 98.77 % |
| % of genes from short scaffolds (< 2000 bps) | 90.53 % |
| Associated GOLD sequencing projects | 198 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.597 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.346 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.576 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.202 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.62% Coil/Unstructured: 84.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 243 Family Scaffolds |
|---|---|---|
| PF04011 | LemA | 12.76 |
| PF00575 | S1 | 12.35 |
| PF13561 | adh_short_C2 | 2.88 |
| PF03544 | TonB_C | 2.06 |
| PF01261 | AP_endonuc_2 | 2.06 |
| PF00490 | ALAD | 1.65 |
| PF01189 | Methyltr_RsmB-F | 1.23 |
| PF00586 | AIRS | 1.23 |
| PF05050 | Methyltransf_21 | 1.23 |
| PF13360 | PQQ_2 | 0.82 |
| PF03992 | ABM | 0.82 |
| PF12483 | GIDE | 0.82 |
| PF01757 | Acyl_transf_3 | 0.82 |
| PF02769 | AIRS_C | 0.82 |
| PF00311 | PEPcase | 0.82 |
| PF00072 | Response_reg | 0.41 |
| PF00106 | adh_short | 0.41 |
| PF02604 | PhdYeFM_antitox | 0.41 |
| PF00092 | VWA | 0.41 |
| PF00155 | Aminotran_1_2 | 0.41 |
| PF12732 | YtxH | 0.41 |
| PF01243 | Putative_PNPOx | 0.41 |
| PF13603 | tRNA-synt_1_2 | 0.41 |
| PF01850 | PIN | 0.41 |
| PF01011 | PQQ | 0.41 |
| PF01551 | Peptidase_M23 | 0.41 |
| PF14748 | P5CR_dimer | 0.41 |
| PF02517 | Rce1-like | 0.41 |
| PF01944 | SpoIIM | 0.41 |
| PF07676 | PD40 | 0.41 |
| PF00069 | Pkinase | 0.41 |
| PF06739 | SBBP | 0.41 |
| PF08240 | ADH_N | 0.41 |
| PF03641 | Lysine_decarbox | 0.41 |
| PF09195 | Endonuc-BglII | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 243 Family Scaffolds |
|---|---|---|---|
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 12.76 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.06 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 1.65 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.65 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 1.23 |
| COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 0.82 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
| COG1300 | Stage II sporulation protein SpoIIM, component of the engulfment complex | Cell cycle control, cell division, chromosome partitioning [D] | 0.41 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.41 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.41 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.41 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.60 % |
| Unclassified | root | N/A | 14.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0340270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 589 | Open in IMG/M |
| 3300000789|JGI1027J11758_11989182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 722 | Open in IMG/M |
| 3300001180|JGI12695J13573_1007921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 717 | Open in IMG/M |
| 3300001593|JGI12635J15846_10481215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101554120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 558 | Open in IMG/M |
| 3300003351|JGI26346J50198_1031608 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300004080|Ga0062385_10023828 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
| 3300004080|Ga0062385_10103577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1383 | Open in IMG/M |
| 3300004091|Ga0062387_101741873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 507 | Open in IMG/M |
| 3300004635|Ga0062388_102411245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
| 3300005171|Ga0066677_10652750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300005174|Ga0066680_10274496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1074 | Open in IMG/M |
| 3300005530|Ga0070679_100966609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 795 | Open in IMG/M |
| 3300005542|Ga0070732_10374697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 857 | Open in IMG/M |
| 3300005556|Ga0066707_10433729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 853 | Open in IMG/M |
| 3300005563|Ga0068855_100019024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8256 | Open in IMG/M |
| 3300005575|Ga0066702_10248743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300005577|Ga0068857_100579943 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300005602|Ga0070762_10047472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2358 | Open in IMG/M |
| 3300005610|Ga0070763_10291974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 894 | Open in IMG/M |
| 3300005618|Ga0068864_102375003 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005712|Ga0070764_10864595 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005841|Ga0068863_100203973 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
| 3300005844|Ga0068862_100150915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2068 | Open in IMG/M |
| 3300005889|Ga0075290_1070374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 503 | Open in IMG/M |
| 3300005921|Ga0070766_10064590 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
| 3300005921|Ga0070766_11163226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300005993|Ga0080027_10223910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 738 | Open in IMG/M |
| 3300005995|Ga0066790_10406172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 582 | Open in IMG/M |
| 3300006047|Ga0075024_100406526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 694 | Open in IMG/M |
| 3300006162|Ga0075030_100170295 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300006162|Ga0075030_100775880 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300006174|Ga0075014_100089063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300006354|Ga0075021_11003232 | Not Available | 545 | Open in IMG/M |
| 3300006794|Ga0066658_10909619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300006797|Ga0066659_10214574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1418 | Open in IMG/M |
| 3300006800|Ga0066660_11056753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 647 | Open in IMG/M |
| 3300006804|Ga0079221_11727739 | Not Available | 510 | Open in IMG/M |
| 3300006806|Ga0079220_10508974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300009029|Ga0066793_10901829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300009088|Ga0099830_10202366 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300009137|Ga0066709_100100867 | All Organisms → cellular organisms → Bacteria | 3536 | Open in IMG/M |
| 3300009518|Ga0116128_1147432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300009520|Ga0116214_1142574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 890 | Open in IMG/M |
| 3300009522|Ga0116218_1069266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1605 | Open in IMG/M |
| 3300009524|Ga0116225_1452457 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009551|Ga0105238_11138711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300009551|Ga0105238_11487514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300009623|Ga0116133_1067370 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300009628|Ga0116125_1124698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300009628|Ga0116125_1139864 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300009631|Ga0116115_1082012 | Not Available | 835 | Open in IMG/M |
| 3300009638|Ga0116113_1064609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300009639|Ga0116122_1133889 | Not Available | 793 | Open in IMG/M |
| 3300009644|Ga0116121_1069965 | Not Available | 1097 | Open in IMG/M |
| 3300009646|Ga0116132_1202396 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009698|Ga0116216_10792565 | Not Available | 568 | Open in IMG/M |
| 3300009760|Ga0116131_1127301 | Not Available | 745 | Open in IMG/M |
| 3300009824|Ga0116219_10218196 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300009824|Ga0116219_10688569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300009839|Ga0116223_10650217 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300010043|Ga0126380_10970150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300010046|Ga0126384_11850567 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010048|Ga0126373_11431477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300010301|Ga0134070_10038409 | Not Available | 1597 | Open in IMG/M |
| 3300010341|Ga0074045_11054896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300010343|Ga0074044_10090574 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300010358|Ga0126370_11781377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300010359|Ga0126376_13049933 | Not Available | 518 | Open in IMG/M |
| 3300010371|Ga0134125_10329401 | Not Available | 1695 | Open in IMG/M |
| 3300010376|Ga0126381_101096765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300010376|Ga0126381_104593563 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010379|Ga0136449_102251452 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300010401|Ga0134121_10420922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
| 3300011120|Ga0150983_12714235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300012096|Ga0137389_11839232 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012189|Ga0137388_10405168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300012200|Ga0137382_10958792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300012202|Ga0137363_11447664 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300012203|Ga0137399_10982518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300012361|Ga0137360_10671048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300012362|Ga0137361_10312785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1438 | Open in IMG/M |
| 3300012363|Ga0137390_10463759 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300012683|Ga0137398_10295845 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300012927|Ga0137416_10427066 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300012930|Ga0137407_10315239 | Not Available | 1433 | Open in IMG/M |
| 3300012961|Ga0164302_11060459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300012971|Ga0126369_10502642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1270 | Open in IMG/M |
| 3300012987|Ga0164307_11473078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300014153|Ga0181527_1264990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300014490|Ga0182010_10037754 | Not Available | 2260 | Open in IMG/M |
| 3300014497|Ga0182008_10151695 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300014498|Ga0182019_10368237 | Not Available | 973 | Open in IMG/M |
| 3300014969|Ga0157376_10077952 | All Organisms → cellular organisms → Bacteria | 2836 | Open in IMG/M |
| 3300015195|Ga0167658_1113310 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300015241|Ga0137418_10614791 | Not Available | 850 | Open in IMG/M |
| 3300015264|Ga0137403_10779458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300016728|Ga0181500_1330236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300017823|Ga0187818_10418043 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300017930|Ga0187825_10338870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300017933|Ga0187801_10119767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300017941|Ga0187850_10064060 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
| 3300017943|Ga0187819_10056825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2323 | Open in IMG/M |
| 3300017943|Ga0187819_10585410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300017946|Ga0187879_10766863 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300017955|Ga0187817_10592195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300017972|Ga0187781_11321852 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300017995|Ga0187816_10112019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300017995|Ga0187816_10519111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300018004|Ga0187865_1169436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300018006|Ga0187804_10287244 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300018021|Ga0187882_1337733 | Not Available | 575 | Open in IMG/M |
| 3300018034|Ga0187863_10286695 | Not Available | 915 | Open in IMG/M |
| 3300018034|Ga0187863_10722123 | Not Available | 563 | Open in IMG/M |
| 3300018037|Ga0187883_10593781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300018042|Ga0187871_10145603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1340 | Open in IMG/M |
| 3300018047|Ga0187859_10738123 | Not Available | 562 | Open in IMG/M |
| 3300018085|Ga0187772_10967172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300018086|Ga0187769_10806945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300018088|Ga0187771_10359826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
| 3300018088|Ga0187771_11049083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300018088|Ga0187771_11711202 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300018090|Ga0187770_10601543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300018090|Ga0187770_11355862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300019278|Ga0187800_1057879 | Not Available | 2311 | Open in IMG/M |
| 3300019786|Ga0182025_1365995 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300019787|Ga0182031_1493489 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300019787|Ga0182031_1545810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300019879|Ga0193723_1186111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300019890|Ga0193728_1046266 | All Organisms → cellular organisms → Bacteria | 2126 | Open in IMG/M |
| 3300020580|Ga0210403_11051787 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300020581|Ga0210399_10318718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300020581|Ga0210399_10421250 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300020582|Ga0210395_10220474 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300020582|Ga0210395_11123947 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300020583|Ga0210401_10264200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1580 | Open in IMG/M |
| 3300021181|Ga0210388_10342307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1315 | Open in IMG/M |
| 3300021384|Ga0213876_10323853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300021401|Ga0210393_10502011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300021402|Ga0210385_10104353 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300021402|Ga0210385_11307225 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300021403|Ga0210397_10226099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1348 | Open in IMG/M |
| 3300021403|Ga0210397_10551809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300021403|Ga0210397_11020713 | Not Available | 642 | Open in IMG/M |
| 3300021404|Ga0210389_10961682 | Not Available | 663 | Open in IMG/M |
| 3300021407|Ga0210383_11727573 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021432|Ga0210384_10007193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11749 | Open in IMG/M |
| 3300021432|Ga0210384_10350237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300021432|Ga0210384_10614198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300021432|Ga0210384_10985493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300021433|Ga0210391_10114971 | Not Available | 2119 | Open in IMG/M |
| 3300021474|Ga0210390_10480976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300021476|Ga0187846_10024110 | All Organisms → cellular organisms → Bacteria | 2798 | Open in IMG/M |
| 3300021476|Ga0187846_10296105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300021477|Ga0210398_10738707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300021479|Ga0210410_11584945 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300021560|Ga0126371_12423579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300021560|Ga0126371_12634068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300021861|Ga0213853_11606299 | Not Available | 533 | Open in IMG/M |
| 3300022521|Ga0224541_1001199 | Not Available | 2542 | Open in IMG/M |
| 3300022557|Ga0212123_10210455 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300022714|Ga0242671_1056979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300022724|Ga0242665_10060118 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300022724|Ga0242665_10074493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300023660|Ga0247550_100527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300025320|Ga0209171_10263091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300025473|Ga0208190_1093196 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300025505|Ga0207929_1039901 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300025533|Ga0208584_1149346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 531 | Open in IMG/M |
| 3300025913|Ga0207695_10079986 | All Organisms → cellular organisms → Bacteria | 3311 | Open in IMG/M |
| 3300025921|Ga0207652_10989900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300025929|Ga0207664_10566684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300026281|Ga0209863_10119995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300026322|Ga0209687_1009041 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
| 3300026330|Ga0209473_1086442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1318 | Open in IMG/M |
| 3300026481|Ga0257155_1044421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300026482|Ga0257172_1024503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1074 | Open in IMG/M |
| 3300026547|Ga0209156_10337342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300027076|Ga0208860_1040959 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027521|Ga0209524_1039459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 993 | Open in IMG/M |
| 3300027604|Ga0208324_1170045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300027652|Ga0209007_1167604 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300027698|Ga0209446_1115171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300027701|Ga0209447_10198931 | Not Available | 548 | Open in IMG/M |
| 3300027727|Ga0209328_10137346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 745 | Open in IMG/M |
| 3300027729|Ga0209248_10177958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300027795|Ga0209139_10245599 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300027825|Ga0209039_10385183 | Not Available | 538 | Open in IMG/M |
| 3300027842|Ga0209580_10407592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300027869|Ga0209579_10341774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300027869|Ga0209579_10392508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300027879|Ga0209169_10051239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2148 | Open in IMG/M |
| 3300027884|Ga0209275_10001947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8534 | Open in IMG/M |
| 3300027905|Ga0209415_10275931 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300027915|Ga0209069_10919019 | Not Available | 531 | Open in IMG/M |
| 3300027986|Ga0209168_10083572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1662 | Open in IMG/M |
| 3300028015|Ga0265353_1018303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300028017|Ga0265356_1027619 | Not Available | 615 | Open in IMG/M |
| 3300028047|Ga0209526_10986925 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300028380|Ga0268265_10431616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1226 | Open in IMG/M |
| 3300028572|Ga0302152_10211394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 629 | Open in IMG/M |
| 3300028747|Ga0302219_10391210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300028762|Ga0302202_10119175 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300028780|Ga0302225_10068740 | Not Available | 1742 | Open in IMG/M |
| 3300028789|Ga0302232_10344951 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 733 | Open in IMG/M |
| 3300028866|Ga0302278_10176333 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300028906|Ga0308309_11057961 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300028909|Ga0302200_10324007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 732 | Open in IMG/M |
| 3300029939|Ga0311328_10197148 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300029953|Ga0311343_10558072 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300029999|Ga0311339_11173061 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300030044|Ga0302281_10091305 | Not Available | 1427 | Open in IMG/M |
| 3300030520|Ga0311372_12484489 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300030617|Ga0311356_11526486 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300030659|Ga0316363_10316225 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300030737|Ga0302310_10312461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300031247|Ga0265340_10090884 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300031446|Ga0170820_10242193 | Not Available | 592 | Open in IMG/M |
| 3300031446|Ga0170820_15137659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300031708|Ga0310686_104873228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1705 | Open in IMG/M |
| 3300031718|Ga0307474_11142055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300031718|Ga0307474_11619582 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031754|Ga0307475_11539277 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031820|Ga0307473_10515005 | Not Available | 810 | Open in IMG/M |
| 3300031823|Ga0307478_11414564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300031902|Ga0302322_101625145 | Not Available | 790 | Open in IMG/M |
| 3300031941|Ga0310912_10802134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300031946|Ga0310910_11272357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300031954|Ga0306926_11108063 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300031962|Ga0307479_10068477 | All Organisms → cellular organisms → Bacteria | 3425 | Open in IMG/M |
| 3300031962|Ga0307479_10725420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300032074|Ga0308173_12085790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300032261|Ga0306920_102914462 | Not Available | 648 | Open in IMG/M |
| 3300032770|Ga0335085_10012430 | All Organisms → cellular organisms → Bacteria | 12541 | Open in IMG/M |
| 3300032782|Ga0335082_11669163 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300032783|Ga0335079_11640707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300032829|Ga0335070_10036544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5526 | Open in IMG/M |
| 3300032892|Ga0335081_11168522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300032892|Ga0335081_11456606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300032895|Ga0335074_11191884 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300033004|Ga0335084_11709391 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300033004|Ga0335084_11922029 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300033158|Ga0335077_10759928 | Not Available | 991 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.53% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.53% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.12% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.12% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.70% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.47% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.47% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.06% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.23% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.41% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.41% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.41% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.41% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.41% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.41% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.41% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.82% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.82% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.82% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.82% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.82% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_03402701 | 2228664022 | Soil | FPALSTAVDYEVYAQYHGKKSDTKGVSQFDDRSQVYMDLKVD |
| JGI1027J11758_119891822 | 3300000789 | Soil | DYEVYAQYHGKKSDTKGVSQFDDRSQVYMDLKVDVRE* |
| JGI12695J13573_10079212 | 3300001180 | Forest Soil | YRFPGLSTVDYEVYAQYNGHKSETKSVSQFDERSQVYVDLRITGQ* |
| JGI12635J15846_104812152 | 3300001593 | Forest Soil | FPALTTSVDYEVYAQYEGHKSDVKSVSQFDDRSQVYIDLKTNTK* |
| JGIcombinedJ26739_1015541201 | 3300002245 | Forest Soil | LSTVDYEVYAQYNNIKSDTRSVSQFDDRSQVYIDLRIDKH* |
| JGI26346J50198_10316082 | 3300003351 | Bog Forest Soil | TIDYEVYAQYNNRKSGTKTVSQFDDRSQVYISLKVDTKAETK* |
| Ga0062385_100238283 | 3300004080 | Bog Forest Soil | ALQPSIDYEVYAQFNNRKSHTKTVSQFDDRQQVEIILKLDTKADAK* |
| Ga0062385_101035773 | 3300004080 | Bog Forest Soil | NIDYEVYAQFNNRKSHTKTVSQFDNRQAVYIDLKIDSNSKDTKDGK* |
| Ga0062387_1017418732 | 3300004091 | Bog Forest Soil | ALSTAVDYEVYAQYKGRKSETKSVSQFDDRSQVYLDLKVSIQ* |
| Ga0062388_1024112451 | 3300004635 | Bog Forest Soil | SATVDYEVYAQHNKGKSDTKSVSQFDDRSQVYIDLKIDTR* |
| Ga0066677_106527502 | 3300005171 | Soil | LAANVEYEIYAQSNGKASDTKRMSQFDDRKVVSIVLRIDTK* |
| Ga0066680_102744961 | 3300005174 | Soil | PALAANVEYEIYAQSNGKASDTKRMSQFDDRKVVSIVLRIDTK* |
| Ga0070679_1009666092 | 3300005530 | Corn Rhizosphere | ASVDYEVYAQFNGKTSDTKRISQFDDRKVLNVVLKIDTK* |
| Ga0070732_103746971 | 3300005542 | Surface Soil | DYEVYAQYKGHKSDTKAVSQFDDRPQVYLDLKIDTR* |
| Ga0066707_104337292 | 3300005556 | Soil | LASNVDYEIYAQMNGKSSDTKKMSQFDDRKVVSIVLKIDTK* |
| Ga0068855_1000190241 | 3300005563 | Corn Rhizosphere | RFPALSASVDYEVYAQFNGKTSDTKRISQFDDRKVLNVVLKIDTK* |
| Ga0066702_102487433 | 3300005575 | Soil | ALATNVDYEVYAQSNGKSSDTKRMSQFDDRKVVDIVLRIDIR* |
| Ga0068857_1005799431 | 3300005577 | Corn Rhizosphere | EVYAQYKGSKSDTKTVSQFDTRPTVNINLKIDTK* |
| Ga0070762_100474723 | 3300005602 | Soil | FEIYAQYKGQKSDSKAVSQFDDHKQINIVLRIDIK* |
| Ga0070763_102919741 | 3300005610 | Soil | VDYEVYAQYNNIKSDTRSVSQFDDRSQVYIDLRIDKH* |
| Ga0068864_1023750031 | 3300005618 | Switchgrass Rhizosphere | EVYALFNGKKSDTKTVSQFDTRSTLNINLRIDVK* |
| Ga0070764_108645951 | 3300005712 | Soil | ELSPDIDYEVYAQYKGQKSETKTVSQFDDRKTANIILRIDTK* |
| Ga0068863_1002039731 | 3300005841 | Switchgrass Rhizosphere | VDYEVYAQFKDHKSDTKTVSQFDTRPTVNINLKIDTK* |
| Ga0068862_1001509153 | 3300005844 | Switchgrass Rhizosphere | YEVYAQFNGKTSDTKRISQFDDRKVLNVVLKIDTK* |
| Ga0075290_10703741 | 3300005889 | Rice Paddy Soil | TAVDYEVYAQINGKKSDTKSVSQFDDRSQVYLVLKLDAH* |
| Ga0070766_100645901 | 3300005921 | Soil | DYEIYAQYKGHKSETKSVSQFDDRSQVYVDLKVDTR* |
| Ga0070766_111632262 | 3300005921 | Soil | TIDYEVYAQFDKHRSHTKTVSQFDDRQQVYIDLKIETK* |
| Ga0080027_102239102 | 3300005993 | Prmafrost Soil | AANVDYEIYAQLNGKNSDTKKMSQFDDRKQVKIDLRLDVK* |
| Ga0066790_104061722 | 3300005995 | Soil | DYEVYAQYNNHKSGTKTVSQFDDRPQVYISLKIDTK* |
| Ga0075024_1004065261 | 3300006047 | Watersheds | DYEVYAQFQGHKSDTKSVSQFDARATVTVNLKIDAK* |
| Ga0075030_1001702951 | 3300006162 | Watersheds | IDYEVYAQYKGTKSDNKSLSQFDDRSQVYMILKVPTH* |
| Ga0075030_1007758802 | 3300006162 | Watersheds | QPTIDYEVYAQYNTRKSGTKTVSQFDDRQQVYISLKIDTKAEPK* |
| Ga0075014_1000890634 | 3300006174 | Watersheds | LYTAVDYEVYAQFNNHKSDTKSVSQFDDRSQVYLVLKVDTH* |
| Ga0075021_110032321 | 3300006354 | Watersheds | QYNSRKSSTKSVSQFDDRPEVYISLKVDAKADSK* |
| Ga0066658_109096192 | 3300006794 | Soil | TGVDYEVYAQYNGHKSDVKSVSQFDDRSQVSINLRIDTH* |
| Ga0066659_102145741 | 3300006797 | Soil | YEVYAQYEGRKSDVKSVSQFDDRSQVYIDLKITTK* |
| Ga0066660_110567532 | 3300006800 | Soil | LATNVDYEIYAQSNGKASDTKHMSQFDDRKVVDILLRIDTR* |
| Ga0079221_117277391 | 3300006804 | Agricultural Soil | IDYEVYAQYKGKKSAAKSVSQFDDRSQVYIDLKVDTR* |
| Ga0079220_105089742 | 3300006806 | Agricultural Soil | PALAPNIDYEIYAQFNGRKSDSKTVSQFDNREQLAITLRIDTK* |
| Ga0066793_109018291 | 3300009029 | Prmafrost Soil | YEVYAQYNNRKSGTKTVSQFDDRPQVYISLKIDAKADTK* |
| Ga0099830_102023661 | 3300009088 | Vadose Zone Soil | VDYEVYAQYNGHKSDTKSVGQFDDRPQVYLDLKVDTH* |
| Ga0066709_1001008671 | 3300009137 | Grasslands Soil | ANVEYEIYAQSNGKASDTKRMSQFDDRKVVSIVLRIDTK* |
| Ga0116128_11474322 | 3300009518 | Peatland | EVYAQYNGHKSDTKSVSQFDDRPQVYIDLRIDSH* |
| Ga0116214_11425742 | 3300009520 | Peatlands Soil | DIDYEVYAQYKGQKSETKTVSQFDDRKTANIILRIDTK* |
| Ga0116218_10692663 | 3300009522 | Peatlands Soil | DYEVYAQYKGHKSDTKSVSQFDDRSQVYLDLRVDAK* |
| Ga0116225_14524572 | 3300009524 | Peatlands Soil | STAVDYEVYAQYKGRKSDTKSLSQFDDRSQIYLDLRVDTR* |
| Ga0105238_111387111 | 3300009551 | Corn Rhizosphere | DYEVYAQYKGSKSDTKTVSQFDTRPTVNINLKIDMK* |
| Ga0105238_114875142 | 3300009551 | Corn Rhizosphere | EVYAQFNGKSSDTKRISQFDDRKVLSVILKIDTK* |
| Ga0116133_10673701 | 3300009623 | Peatland | AQYNNRKSGTKTVSQFDDRTQVYITLKINIKADAK* |
| Ga0116125_11246982 | 3300009628 | Peatland | DYEVYAQFNGHKSDTKSVSQFDDRSQVYVDLKIDTR* |
| Ga0116125_11398642 | 3300009628 | Peatland | DYEVYAQYNNRKSGTKTVSQFDDRTQVYITLKINIKADAK* |
| Ga0116115_10820122 | 3300009631 | Peatland | QYNNRKSGTKTVSQFDDRTEVYISLKINAKADAK* |
| Ga0116113_10646091 | 3300009638 | Peatland | SAVDYEVYAQYNGHKSDTKSVSQFDDRSEVYIDLRIGSR* |
| Ga0116122_11338891 | 3300009639 | Peatland | EVYAQYNNRKSSTKTVSQFDDRAQVYISLKINSK* |
| Ga0116121_10699652 | 3300009644 | Peatland | AQYNNRKSHTKTVSQFDDRSQVYISLKIDTKSETK* |
| Ga0116132_12023962 | 3300009646 | Peatland | PGLSTVDYEVYAQYNNHKSDTRSVSQFDDRPQVYIDLRIDTR* |
| Ga0116216_107925651 | 3300009698 | Peatlands Soil | NDYEVYAQYNNPKSSTQSVSQFDDRAEVYISLRVNTKAETK* |
| Ga0116131_11273011 | 3300009760 | Peatland | YEVYAQYNNRKSGTKTVSQFDDRSQVYISLKINTKADTK* |
| Ga0116219_102181961 | 3300009824 | Peatlands Soil | AQYNNRKSGTKTVSQFDDRTQVYITLKINTKADAK* |
| Ga0116219_106885692 | 3300009824 | Peatlands Soil | EVYAQYNNRKSHTKTVSQFDDRSQVYISLKIDTK* |
| Ga0116223_106502171 | 3300009839 | Peatlands Soil | SIDYEVYAQYNNRKSGTKTVSQFDNRSQVYISLKIDTKAETK* |
| Ga0126380_109701501 | 3300010043 | Tropical Forest Soil | AVDYEVYAQFNNHKSDTKSVSQFDDRPQVYMVLKIDTH* |
| Ga0126384_118505672 | 3300010046 | Tropical Forest Soil | FPALSSAVDYEVYAQYKGRKSDTKAVSQFDDRSQVYMDLKVNTQ* |
| Ga0126373_114314772 | 3300010048 | Tropical Forest Soil | ALSSAVDYEVYAQYKGRKSDTKAVSQFDDRSQVYMDLKVNTQ* |
| Ga0134070_100384091 | 3300010301 | Grasslands Soil | EVYAQFDGHKSDTKTVSQFDTRPTVNINLRIDTK* |
| Ga0074045_110548961 | 3300010341 | Bog Forest Soil | EVYAQYNNRKSHTKTVSQFDDRSQVYISLKINAKAESK* |
| Ga0074044_100905743 | 3300010343 | Bog Forest Soil | PALQPSIDYEVYAQYNNRKSHTKTVSQFDDRSQVYISLKIDTK* |
| Ga0126370_117813771 | 3300010358 | Tropical Forest Soil | LSANVDYEVYAQLDGKTSDTKRVSQFDDRKVVTVVLKIDTR* |
| Ga0126376_130499331 | 3300010359 | Tropical Forest Soil | EVYAQYQGKKSETKGVSQFDDRSQVYMDLRVDIR* |
| Ga0134125_103294011 | 3300010371 | Terrestrial Soil | EVYAQYKGLKSETKTLSQFDDRPVVSINLKIDMR* |
| Ga0126381_1010967651 | 3300010376 | Tropical Forest Soil | VDYEVYAQFRNHKSDSKAVLQFDDRSQVYLVLRINTR* |
| Ga0126381_1045935631 | 3300010376 | Tropical Forest Soil | PALSTVVDYEVYAQYNGRKSDTKSVSQFDERTEVYLDLKVNTR* |
| Ga0136449_1022514521 | 3300010379 | Peatlands Soil | EVYAQYNGQKSDTKTVSQFDDRKTANIILRIDAK* |
| Ga0134121_104209222 | 3300010401 | Terrestrial Soil | AANVDYEVYAQLNGKSSDTKRVSQFDDRKVVNLVLKIDTK* |
| Ga0150983_127142351 | 3300011120 | Forest Soil | DYEVYAQYKDHKSDTKTVSQFDTRPTVNINLKIDTK* |
| Ga0137389_118392322 | 3300012096 | Vadose Zone Soil | EVYAQHNDRKSDTKSVSQFDDRSQVYIDLKINTQ* |
| Ga0137388_104051681 | 3300012189 | Vadose Zone Soil | RFPALSTAADYEVYAQYNGRKGDTKSVGQFDDRPQVYLDLKVDAR* |
| Ga0137382_109587921 | 3300012200 | Vadose Zone Soil | RFPALAANVDYEVYAQSNGKASDTKKMSQFDDRKVVSIVLRIDTK* |
| Ga0137363_114476641 | 3300012202 | Vadose Zone Soil | PALQPSIDYEVYAQYNNRKSGSKTVSQFDDRGQVYISLKIDTK* |
| Ga0137399_109825182 | 3300012203 | Vadose Zone Soil | YEIYAQLEGKTSDTKRMSQFDDRKTVNIVLRIDTK* |
| Ga0137360_106710482 | 3300012361 | Vadose Zone Soil | YRFPGLTTVDCEVYAQHNDRKSDTKSVSQFDDRSQVYIDLKINTQ* |
| Ga0137361_103127853 | 3300012362 | Vadose Zone Soil | EVYAQYQTRKSDTKTVSQFDTRPTVNINLKIDTK* |
| Ga0137390_104637591 | 3300012363 | Vadose Zone Soil | LTTSVDYEVYAQYEGHKSEVKSVSQFDDRSQVYIDLKINTK* |
| Ga0137398_102958453 | 3300012683 | Vadose Zone Soil | QPTLDYEVYAQYDNRKSGTKTLSQFDDRTQVYISLKINKAETH* |
| Ga0137416_104270663 | 3300012927 | Vadose Zone Soil | GTYRFPGLSTVDYEVYAQYNDRKSDTKSVSQFDDRSQVYVDLKINTR* |
| Ga0137407_103152392 | 3300012930 | Vadose Zone Soil | DYEIYAQYQGHKSDTKSVSQFDSRATVSVNLKIDAK* |
| Ga0164302_110604591 | 3300012961 | Soil | DYEVYAQYQGHKSDTKTVSQFDSRAQVNINLRIDTK* |
| Ga0126369_105026423 | 3300012971 | Tropical Forest Soil | SNAVDYEVYAQLKTHKSDTKSLSQFDDRTQVYMVLKIDAK* |
| Ga0164307_114730781 | 3300012987 | Soil | DYEVYAQFNGKKSDTKSVSQFDDRSQVYLVLKVDPRK* |
| Ga0181527_12649901 | 3300014153 | Bog | PSIDYEVYAQYNKRKSGTKTVSQFDDRTQVYITLKVETN* |
| Ga0182010_100377541 | 3300014490 | Fen | DYEVYAQYNNRKSGTKTVSQFDDRSQVYISLKINPKAETK* |
| Ga0182008_101516951 | 3300014497 | Rhizosphere | AVDYEVYAQINGKKSDTKSVSQFDDRSQVYLVLKLDAH* |
| Ga0182019_103682372 | 3300014498 | Fen | DYEIYAQCNGHKTDTKTMSQFDSRKQVQINFKIDTK* |
| Ga0157376_100779521 | 3300014969 | Miscanthus Rhizosphere | ASVDYEIYAQFNGKTSDTKRISQFDDRKVLNVVLRIDTK* |
| Ga0167658_11133101 | 3300015195 | Glacier Forefield Soil | STATDYEVYAQYKGQKSDTKSVSQFDDRSQVYLDLKVNTH* |
| Ga0137418_106147912 | 3300015241 | Vadose Zone Soil | VYAQLNGRKSDVKSVSQFNDNSQVSINLKIDTSK* |
| Ga0137403_107794582 | 3300015264 | Vadose Zone Soil | EVYAQYKGLKSDTKSVSQFDDRSQVYLDLRVNTH* |
| Ga0181500_13302362 | 3300016728 | Peatland | DYEVYAQYKGHKSETKSVSQFDDRSQVYLDLKIDIR |
| Ga0187818_104180432 | 3300017823 | Freshwater Sediment | LQPSVDYEVYAQYNGHKSDTKSVSQFDNRQQVYITLKIDTR |
| Ga0187825_103388701 | 3300017930 | Freshwater Sediment | AIDYEIYAQYKGKKSDTKSVSQFDDRSQVYLDLKIDIR |
| Ga0187801_101197671 | 3300017933 | Freshwater Sediment | PALSTAVDYEVYAQYKGRKSDTKAVSQFDDRTQVYLDLKIDIR |
| Ga0187850_100640601 | 3300017941 | Peatland | YEVYAQYNNRKSGTKTVSQFDDRSQVYISLKITTK |
| Ga0187819_100568254 | 3300017943 | Freshwater Sediment | AVDYEVYAQYNGHKSDTKSVSQFDDRSQVYLDLKVDTR |
| Ga0187819_105854102 | 3300017943 | Freshwater Sediment | VDYEVYAQYNGQKSDTKTVSQFDDRKQVNIVLRIDVK |
| Ga0187879_107668632 | 3300017946 | Peatland | SPNIDYEVYAQYKGQKSETKTVSQFDDRKIVNIVLRIDTK |
| Ga0187817_105921951 | 3300017955 | Freshwater Sediment | DYEVYAQYKGIKSETKSVSQFDDRSQVYLDLRVNTH |
| Ga0187781_113218522 | 3300017972 | Tropical Peatland | FPALSTAIDYEIYAQFRGRRSDTKSLSQFDDRSEVYMDLKIDTR |
| Ga0187816_101120192 | 3300017995 | Freshwater Sediment | VDYEVYAQYKGRKSDTKAVSQFDDRTQVYLDLKIDIR |
| Ga0187816_105191111 | 3300017995 | Freshwater Sediment | NIDYEVYAQYRGKKSDTKTVSQFDDRKNVNIILRIDAN |
| Ga0187865_11694362 | 3300018004 | Peatland | PGLSTVDYEVYAQYNNHKSDTRSVSQFDDRPQVYIDLRIDTR |
| Ga0187804_102872441 | 3300018006 | Freshwater Sediment | FPALTTAVDYEVYAQFNSHKSDTKSVSQFDDRSQDYRVLKINTH |
| Ga0187882_13377332 | 3300018021 | Peatland | IDYEVYAQYDNRKSHTKTVSQFDDRSQVYISLKINTK |
| Ga0187863_102866951 | 3300018034 | Peatland | SIDYEVYAQYNNRKSGTKTVSQFDNRTQVYISLKINTKADAK |
| Ga0187863_107221232 | 3300018034 | Peatland | YEVYAQYNNRKSHTKTVSQFDDRQQVYISLKINSKAEGK |
| Ga0187883_105937812 | 3300018037 | Peatland | YEVYAQYNNHKSDTRSVSQFDDRPQVYIDLRIDAH |
| Ga0187871_101456032 | 3300018042 | Peatland | YEVYAQYKGQKSDTKAVSQFDDRKIVNIVLRIDTK |
| Ga0187859_107381231 | 3300018047 | Peatland | LLANVDYEVYAQLDKRKSHTKTVSQFDNRTQVYIDLKIDAK |
| Ga0187772_109671721 | 3300018085 | Tropical Peatland | NTDYEVYAQYKGRKSETRTVSQFDDRKSVNLILRIDAQ |
| Ga0187769_108069451 | 3300018086 | Tropical Peatland | YEVYAQYEKHKSHTKSVSQFDDRTQVYIDLRIDTK |
| Ga0187771_103598264 | 3300018088 | Tropical Peatland | STAIDYEVYAQYKGRKSDTKSVSQFDDRSQVYLDLRIDTR |
| Ga0187771_110490831 | 3300018088 | Tropical Peatland | PTVDYEVYAQYEKHKSHTKSVSQFDDRTQVYIDLKIDTK |
| Ga0187771_117112021 | 3300018088 | Tropical Peatland | ALSTSIDYEIYAQYNGHKSDTKSVSQFDDRSQVYLDLRVDTR |
| Ga0187770_106015432 | 3300018090 | Tropical Peatland | DYEIYAQYKGRKSDTKSVSQFDDRSQVYLDLKIDTR |
| Ga0187770_113558621 | 3300018090 | Tropical Peatland | QATVDYEVYAQYEKHKSHTKSVSQFDDRTQVYIDLKIDTK |
| Ga0187800_10578792 | 3300019278 | Peatland | FPALQPTIDYDVYAQYDKRRSHTKTVSQFDNRTQVYIDLKIDVK |
| Ga0182025_13659952 | 3300019786 | Permafrost | LWDRTAPTASPALSTAIDYEVYAQYKGRKSDTKSVSQFDEPSQVYVDLKVNTR |
| Ga0182031_14934894 | 3300019787 | Bog | AQYNNHKSGTKTVSQFDDRTQVYISLKINAKGESK |
| Ga0182031_15458103 | 3300019787 | Bog | MNVDYEVSAQYKGHKSDTKTVSQFDNRQQLNLNLRIDTN |
| Ga0193723_11861111 | 3300019879 | Soil | FPALAANVDYEIYAQVAGKTSDTKKMSQFDDRKQVKIDLRIDTK |
| Ga0193728_10462662 | 3300019890 | Soil | PALAANVDYEIYAQLAGKTSDTKKMSQFDDRKQVKIDLRIDTK |
| Ga0210403_110517872 | 3300020580 | Soil | QPSIDYEVYAQYNNRKSGTKSVSQFDDRSQVYISLKVDTKADPK |
| Ga0210399_103187181 | 3300020581 | Soil | TDYEVYAQFKGKKSETKSVSQFDDRSQVYLDLKVDLH |
| Ga0210399_104212502 | 3300020581 | Soil | NIDYEVYAQYKGQKSDTKTVSQFDDRKIANIILRIDVK |
| Ga0210395_102204741 | 3300020582 | Soil | YEVYAQYNGHKSDTKSVSQFDDRSEVYIDLRIGSR |
| Ga0210395_111239472 | 3300020582 | Soil | FPSLSSAIDYEVYAQYKDRKSDTKSVSQFDDRSEIYIVLKINTR |
| Ga0210401_102642003 | 3300020583 | Soil | STAVDYEVYAQYKGHKSETKSVSQFDDRSQVYVDLKVDTR |
| Ga0210388_103423071 | 3300021181 | Soil | YEVYAQFNNRKSHTKTVSQFDNRQAVYIDLKVDSTSKDSK |
| Ga0213876_103238532 | 3300021384 | Plant Roots | RFPALASNVDYEVYAQLNGKTSDTKRVSQFDDRKIVNIILHIDTR |
| Ga0210393_105020111 | 3300021401 | Soil | YEVYAQYNGRKSDTKSVSQFDDRSQVYIDLKINTQ |
| Ga0210385_101043533 | 3300021402 | Soil | IDYEVYAQYKGQKSDTKTVSQFDDRKIVNIVLRIDTK |
| Ga0210385_113072252 | 3300021402 | Soil | FPGLSTVDYEVYAQYNGHKSDTKSVSQFDDRPQVYIDLRIDAR |
| Ga0210397_102260992 | 3300021403 | Soil | ELSPDIHYEVYAQYKGQKSETKTVSQFDDRKTANIILRIDTK |
| Ga0210397_105518092 | 3300021403 | Soil | YEVYAQYKDRKSDTKSVSQFDDRSQVYVDLRINAP |
| Ga0210397_110207132 | 3300021403 | Soil | YEVYAQYKGLKSDTKTVSQFDDRKQVNIILRIDAK |
| Ga0210389_109616821 | 3300021404 | Soil | PALQPTIDYEVYAQFDKRRSHTKTVSQFDNRTQVYIDLKIDAK |
| Ga0210383_117275732 | 3300021407 | Soil | PGLSNVDYEVYAQLNSRKSDTKSVSQFDDRSQVYVDLRINKQ |
| Ga0210384_1000719310 | 3300021432 | Soil | YEVYAQYKDHKSDTKTVSQFDTRPTVNINLKIDTK |
| Ga0210384_103502371 | 3300021432 | Soil | NAATEYEVYAQYKGKKSETKSVSQFDDRSQVYLDLKVDTR |
| Ga0210384_106141982 | 3300021432 | Soil | STATDYEVYAQYKGHKSDTKSVSQFDDRSQVYLDLKIDTR |
| Ga0210384_109854932 | 3300021432 | Soil | YEVYAQYRDRKSDTKTVSQFDTRAQVNINLRIDTK |
| Ga0210391_101149711 | 3300021433 | Soil | YEVYAQYKGHKSDTKSVSQFDDRSQVYLDLKIDIR |
| Ga0210390_104809761 | 3300021474 | Soil | ALSTAVDYEVYAQYKGHKSETKSVSQFDDRSQVYLDLKIDVR |
| Ga0187846_100241101 | 3300021476 | Biofilm | AYRFPGLTSVDYEVYAQYKDHKSDTKSVSQFDDRTQVYIDLKINTQSSGR |
| Ga0187846_102961052 | 3300021476 | Biofilm | ALSTSVDYEVYAQFKGHKSDTKSVSQFDERSQVYLDLKIDTK |
| Ga0210398_107387072 | 3300021477 | Soil | VVYKVYAQYKGRKSDTKSVSQFDDRSQVYLDLKVR |
| Ga0210410_115849451 | 3300021479 | Soil | DYEVYAQYNGRKSDTKSVSQFDDRSQVYVDLKINTQ |
| Ga0126371_124235792 | 3300021560 | Tropical Forest Soil | SLSAAIDYEVYAQYKGTKSDTKSLSQFDDRSQVYMVLKVSTK |
| Ga0126371_126340682 | 3300021560 | Tropical Forest Soil | IDYEIYAQYNGHKSDTKMVSQFDNRSVINIDLHIDAK |
| Ga0213853_116062991 | 3300021861 | Watersheds | RFPALSTAIEYEVYAQYKGHKSESKSVSQFDDRSQVYLDFKIDTR |
| Ga0224541_10011992 | 3300022521 | Soil | GLQPGIDYEVYAQFNKHKSATKTVSQFDDRAQVYVPLKISAKAEAAN |
| Ga0212123_102104553 | 3300022557 | Iron-Sulfur Acid Spring | FPALSGAIDYEVYAQYKTHKSETKSVSQFDDRPQIYLDLKVDAR |
| Ga0242671_10569791 | 3300022714 | Soil | AQYNNRKSGTKTVSQFDDRAQVYIDLKVNTKAVVKNDPPK |
| Ga0242665_100601183 | 3300022724 | Soil | DYEVYAQYNNRKSGTKTVSQFDDRSQVYISLKVDTKADAK |
| Ga0242665_100744933 | 3300022724 | Soil | DYEVYAQYKGHKSDTKSVSQFDDRSQVYIDLRVDAR |
| Ga0247550_1005272 | 3300023660 | Soil | YAQRNNGKSDTKSVSQFDDRSQVYIDLKIETKTDPR |
| Ga0209171_102630912 | 3300025320 | Iron-Sulfur Acid Spring | FPALSSAVDYEVYAQYNGHKSDTKSVSQFDDRSEVYIDLRIGPR |
| Ga0208190_10931962 | 3300025473 | Peatland | AQYNNRKSHTKTVSQFDDRSQVYISLKIDTKSETK |
| Ga0207929_10399011 | 3300025505 | Arctic Peat Soil | YEVYAQYHGHKSDTKTVSQFDDRKQVSIILRIDTK |
| Ga0208584_11493461 | 3300025533 | Arctic Peat Soil | QPTTDYEVYAQYNNRKSGTKTVSQFDDRPQVYISLKIDSK |
| Ga0207695_100799866 | 3300025913 | Corn Rhizosphere | AIDYEVYAQFNGKKSDTKSVSQFDDRSQVYLVLKVDPRK |
| Ga0207652_109899002 | 3300025921 | Corn Rhizosphere | ASVDYEVYAQFNGKTSDTKRISQFDDRKVLNVVLKIDTK |
| Ga0207664_105666841 | 3300025929 | Agricultural Soil | FPALAANVDYEVYAQSSGKTSDTKRVSQFDDHKVVNLVLRVDTK |
| Ga0209863_101199951 | 3300026281 | Prmafrost Soil | AANVDYEIYAQLNGKNSDTKKMSQFDDRKQVKIDLRLDVK |
| Ga0209687_10090411 | 3300026322 | Soil | YEVYALFNGKKSDTKTVSQFDTRSTLNINLRIDVK |
| Ga0209473_10864421 | 3300026330 | Soil | NVDYEVYAQSNGKSSDTKRMSQFDDRKVVDIVLRIDIR |
| Ga0257155_10444211 | 3300026481 | Soil | NVDYEVYAQSNGKSSDTKRMSQFDDRKVVNIILKIDAK |
| Ga0257172_10245031 | 3300026482 | Soil | DYEVYAQYDNRKSGTKTVSQFDDRQQVYISLKVNAK |
| Ga0209156_103373422 | 3300026547 | Soil | RFPALAVNVDYEVYAQSNGKTSDTKKMSQFDDRKVVSIVLRVATK |
| Ga0208860_10409591 | 3300027076 | Forest Soil | FPGLSTVDYEVYAQYNNHKSDTKSVSQFDDRSQVYIDLKIDTH |
| Ga0209524_10394591 | 3300027521 | Forest Soil | EVYAQYNNRKSGTKTVSQFDDRSQVYISLKVDTKADAK |
| Ga0208324_11700452 | 3300027604 | Peatlands Soil | YEVYAQYKGHKSDTKSVSQFDDRSQVYLDLRVDAK |
| Ga0209007_11676041 | 3300027652 | Forest Soil | FPGLTSVDYEVYAQYEKHKSDTRSVSQFDDRSQVYIDLRIDTHQ |
| Ga0209446_11151711 | 3300027698 | Bog Forest Soil | AQYNNHKSGTKTVSQFDDRQQVYISLKINTKAETK |
| Ga0209447_101989311 | 3300027701 | Bog Forest Soil | DYEVYAQFNNRKSHTKTVSQFDDRQQVEIILKLDTKADAK |
| Ga0209328_101373462 | 3300027727 | Forest Soil | LTTSVDYEVYAQYDGQKSDVKSVSQFDDRSQVYIDLKINAK |
| Ga0209248_101779582 | 3300027729 | Bog Forest Soil | NVDYEVYAQYKGRKSDTKSVSQFDDRSQVYVDLKINLQ |
| Ga0209139_102455992 | 3300027795 | Bog Forest Soil | IVGQEGSYRFPGLSMVDYEVYAQYSGHKSDTKSVSQFDDRSEVYVDLRVDMR |
| Ga0209039_103851832 | 3300027825 | Bog Forest Soil | PGLSASADYEVYAQRNNDKSDAKSISQFDDRPEVYIDLRIVSH |
| Ga0209580_104075921 | 3300027842 | Surface Soil | PALSTAVDYEVYAQYKGHKSDTKAVSQFDDRPQVYLDLKIDTR |
| Ga0209579_103417742 | 3300027869 | Surface Soil | SVDYEVYAQYKGHRSDTKSVSQFDDRSQVYMDLKIDTR |
| Ga0209579_103925081 | 3300027869 | Surface Soil | DYDVYAQYKGLKSETRTVSQFDDRKSVNIILRIDAK |
| Ga0209169_100512391 | 3300027879 | Soil | LSSAVDYEVYAQYNGHKSDTKSVSQFDDRSEVYIDLRIGPR |
| Ga0209275_100019476 | 3300027884 | Soil | EGTYRFPGLSMMDYEVYAEYKGHKSDTKSVSQFDDRSEVYVDLRIDTR |
| Ga0209415_102759312 | 3300027905 | Peatlands Soil | VDYEIYAQYKGQKSDTKAVSQFDDHKLINIVLRIDTK |
| Ga0209069_109190191 | 3300027915 | Watersheds | VYAQYNNHKSGAKTVSQFDDRTQVYISLKIDTKAESK |
| Ga0209168_100835722 | 3300027986 | Surface Soil | STVDYEVYAQYNGRKSDTKSVSQFDDRPQVYIDLKINSQ |
| Ga0265353_10183032 | 3300028015 | Soil | PALSSAVDYEVYAQYNGHKSDTKSVSQFDDRSEVYIDLRIGSR |
| Ga0265356_10276192 | 3300028017 | Rhizosphere | YRFPGLSNVDYEVYAQSDSGKSDTKSVSQFDDRPQVYVDLKITTH |
| Ga0209526_109869251 | 3300028047 | Forest Soil | STAVDYEVYAQYNGHKSDTKSVSQFDDRSQVYVDLKVNPR |
| Ga0268265_104316161 | 3300028380 | Switchgrass Rhizosphere | YEVYAQFNGKTSDTKRISQFDDRKVLNVVLKIDTK |
| Ga0302152_102113942 | 3300028572 | Bog | FPGLLPVIDYEVYAQYDKAKSGTKTVSQFDDRAEVYIDLKIKNKE |
| Ga0302219_103912101 | 3300028747 | Palsa | YAQFNKHKSATKTVSQFDDRAQVYVPLKISAKAEAAN |
| Ga0302202_101191753 | 3300028762 | Bog | VIDYEVYAQYDKAKSGTKTVSQFDDRAEVYIDLKIKNKE |
| Ga0302225_100687401 | 3300028780 | Palsa | YEVYAQYNGKKSDTKSVSQFDDRTQVYIDLKIQGH |
| Ga0302232_103449512 | 3300028789 | Palsa | VDYEVYAQHDNGKSDTKSVSQFDDRSQVYIDLKIEKR |
| Ga0302278_101763331 | 3300028866 | Bog | TVDYEVYAQYNGKKSDTKSVSQFDDRTQVYIDLKIQGH |
| Ga0308309_110579612 | 3300028906 | Soil | LTPNVDFEIYAQYKGLKSETKEVSQFDDHKLINIVLRIDTK |
| Ga0302200_103240072 | 3300028909 | Bog | LPVIDYEVYAQYDKAKSGTKTVSQFDDRAEVYIDLKIKNKE |
| Ga0311328_101971483 | 3300029939 | Bog | SVDYEVYAQHNDRKSDTKSVSQFDDRSQVYIDLRINNP |
| Ga0311343_105580722 | 3300029953 | Bog | LSTVDYEVYAQYNGKKSDTKSVSQFDDRTQVYIDLKIQGH |
| Ga0311339_111730612 | 3300029999 | Palsa | YRFPGLSTVDYEVYAQYNGHQSDTKSVSQFDDRSQVYIDLRIDAR |
| Ga0302281_100913053 | 3300030044 | Fen | YEVYAQYDKAKSGTKTVSQFDDRAEVYIDLKIKNKE |
| Ga0311372_124844892 | 3300030520 | Palsa | LSTVDYEVYAQYNGHKSDTKSVSQFDDRPQVYIDLRIDAVKIDAR |
| Ga0311356_115264862 | 3300030617 | Palsa | TVDYEVYAQYNNRKSGTKTVSQFDDRQQVYIDLKIDSKTEAK |
| Ga0316363_103162252 | 3300030659 | Peatlands Soil | SIDYEVYAQYNNRKSGTKTVSQFDNRSQVYISLKIDTKAETK |
| Ga0302310_103124612 | 3300030737 | Palsa | YEVYAQHDRGKSDTKSVSQFEDRPQVYIDLKIDAR |
| Ga0265340_100908843 | 3300031247 | Rhizosphere | YAQYNNRKSGTKSVSQFDDRPEVYISLKVDTKADAK |
| Ga0170820_102421931 | 3300031446 | Forest Soil | TAIDYEVYAQSKGKKSDTKSVSQFDDRPQVYLDLKISAQ |
| Ga0170820_151376591 | 3300031446 | Forest Soil | PALSTAVDYEVYAQYKGKKSDTKSVSQFDDRSQVYLDLKVNLR |
| Ga0310686_1048732282 | 3300031708 | Soil | SNVDYEVYAQSDSGKSDTKSVSQFDDRPQVYLDLKLTTH |
| Ga0307474_111420551 | 3300031718 | Hardwood Forest Soil | LSTAVDYEVYAQYKGRKSDTKAVSQFDDRSQVYLDLKLDAH |
| Ga0307474_116195822 | 3300031718 | Hardwood Forest Soil | STAIDYEVYAQYKGRKSDTKSVSQFDDRSQVYVDLKVNTR |
| Ga0307475_115392771 | 3300031754 | Hardwood Forest Soil | FPALSTAIDYEIYAQYKGHKSDTKSVSQFDDRSQVYLDLKIDTR |
| Ga0307473_105150051 | 3300031820 | Hardwood Forest Soil | NIDYEVYAQYSGHKSDNKTVSQFDDRPQVSINLKIDTK |
| Ga0307478_114145641 | 3300031823 | Hardwood Forest Soil | ATNVDYEIYAQSNGKTSDTKRMSQFDDRKVVDIVLRIDIR |
| Ga0302322_1016251451 | 3300031902 | Fen | LDYEVYAQFNGHKSDVKTVSQFDDRQQVSVNLKIDTK |
| Ga0310912_108021342 | 3300031941 | Soil | IDYEIYAQLNGRKSDTKTVSQFDSRSQVNQNLKINMK |
| Ga0310910_112723571 | 3300031946 | Soil | PALSTGVDYEVYAQYKTHKSDTKSLSQFDDRTQVGMNLKIDTR |
| Ga0306926_111080632 | 3300031954 | Soil | YEVYAQFQGKKSDTKTVSQFDDRPQLNINLKIDTR |
| Ga0307479_100684771 | 3300031962 | Hardwood Forest Soil | PSIDYEVYAQYNNRKSGTKSVSQFDDRSQVYISLKVDTKADAK |
| Ga0307479_107254201 | 3300031962 | Hardwood Forest Soil | DYEVYAQINGKSSDTKRVSQFDDRKVVNLVLKIDMK |
| Ga0308173_120857902 | 3300032074 | Soil | LAVNVDYEVYAQSNGKTSDTKKMSQFDDRKVVSIVLRVATK |
| Ga0306920_1029144621 | 3300032261 | Soil | YEVYAQYNSRKSDTKTVSQFDTRQQVNINLKIDNR |
| Ga0335085_100124301 | 3300032770 | Soil | YEVYAQYKNHKSDTKTVSQFDSRPQVNIDLRIDMK |
| Ga0335082_116691632 | 3300032782 | Soil | YEVHAQFKGQKSDTKEVSQFDDRKQVNIILRIDVK |
| Ga0335079_116407071 | 3300032783 | Soil | FPALTAAVDYEVYAQFQNRKSDTKSLSQFDDRSQVYLVLKVNTH |
| Ga0335070_100365441 | 3300032829 | Soil | SNAVDYEVYAQYHGKKSDTKGVSQFDDRSQVYVDLRVDVR |
| Ga0335081_111685222 | 3300032892 | Soil | RFPALSTAVDYEVYAQFNTHKSDTKSVSQFDDRSQVYLVLKIDTR |
| Ga0335081_114566062 | 3300032892 | Soil | EVYAQYKGQKSDTKTVSQFDDRTQVNIMLRIEVEK |
| Ga0335074_111918842 | 3300032895 | Soil | FPALSTAIDYEIYAQYKGHKSETKSVSQFDDRSQVYLDLRVDTR |
| Ga0335084_117093912 | 3300033004 | Soil | LSTAVDYEVYAQYQGRKSDTKGVSQFDDRSEVYMDLRVK |
| Ga0335084_119220291 | 3300033004 | Soil | VDYEIYAQFNNRKSDTKSLSQFDDRSQVYMVLKISTK |
| Ga0335077_107599281 | 3300033158 | Soil | QPNLDYEVYAQFDKRKSHTKTVSQFDNRSQVYIDLKIESK |
| ⦗Top⦘ |