


| Basic Information | |
|---|---|
| Family ID | F016949 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 243 |
| Average Sequence Length | 38 residues |
| Representative Sequence | ALPNTRLKLTAPVICGRIAFVNVKVWRRSLGAIR |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 242 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 20.92 % |
| % of genes near scaffold ends (potentially truncated) | 72.43 % |
| % of genes from short scaffolds (< 2000 bps) | 70.78 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.374 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (38.683 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.502 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.971 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.74% β-sheet: 0.00% Coil/Unstructured: 82.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 242 Family Scaffolds |
|---|---|---|
| PF14534 | DUF4440 | 3.31 |
| PF09932 | DUF2164 | 2.48 |
| PF07883 | Cupin_2 | 1.65 |
| PF07681 | DoxX | 1.24 |
| PF08818 | DUF1801 | 1.24 |
| PF09720 | Unstab_antitox | 1.24 |
| PF07676 | PD40 | 1.24 |
| PF04237 | YjbR | 1.24 |
| PF05016 | ParE_toxin | 0.83 |
| PF00583 | Acetyltransf_1 | 0.83 |
| PF04029 | 2-ph_phosp | 0.83 |
| PF00903 | Glyoxalase | 0.83 |
| PF13826 | DUF4188 | 0.83 |
| PF09413 | DUF2007 | 0.83 |
| PF13683 | rve_3 | 0.83 |
| PF13442 | Cytochrome_CBB3 | 0.83 |
| PF07927 | HicA_toxin | 0.83 |
| PF12867 | DinB_2 | 0.83 |
| PF01906 | YbjQ_1 | 0.83 |
| PF04365 | BrnT_toxin | 0.83 |
| PF04255 | DUF433 | 0.83 |
| PF06736 | TMEM175 | 0.83 |
| PF10861 | DUF2784 | 0.41 |
| PF13565 | HTH_32 | 0.41 |
| PF11008 | DUF2846 | 0.41 |
| PF14085 | DUF4265 | 0.41 |
| PF04993 | TfoX_N | 0.41 |
| PF11746 | DUF3303 | 0.41 |
| PF13432 | TPR_16 | 0.41 |
| PF13489 | Methyltransf_23 | 0.41 |
| PF12680 | SnoaL_2 | 0.41 |
| PF13211 | DUF4019 | 0.41 |
| PF03681 | Obsolete Pfam Family | 0.41 |
| PF07859 | Abhydrolase_3 | 0.41 |
| PF03167 | UDG | 0.41 |
| PF06902 | Fer4_19 | 0.41 |
| PF13011 | LZ_Tnp_IS481 | 0.41 |
| PF00156 | Pribosyltran | 0.41 |
| PF13207 | AAA_17 | 0.41 |
| PF07007 | LprI | 0.41 |
| PF11528 | DUF3224 | 0.41 |
| PF01435 | Peptidase_M48 | 0.41 |
| PF07715 | Plug | 0.41 |
| PF11373 | DUF3175 | 0.41 |
| PF09844 | DUF2071 | 0.41 |
| PF00557 | Peptidase_M24 | 0.41 |
| PF04191 | PEMT | 0.41 |
| PF02129 | Peptidase_S15 | 0.41 |
| PF15589 | Imm21 | 0.41 |
| PF07110 | EthD | 0.41 |
| PF04140 | ICMT | 0.41 |
| PF00150 | Cellulase | 0.41 |
| PF16826 | DUF5076 | 0.41 |
| PF14317 | YcxB | 0.41 |
| PF14281 | PDDEXK_4 | 0.41 |
| PF01381 | HTH_3 | 0.41 |
| PF14499 | DUF4437 | 0.41 |
| PF12762 | DDE_Tnp_IS1595 | 0.41 |
| PF01344 | Kelch_1 | 0.41 |
| PF09997 | DUF2238 | 0.41 |
| PF12697 | Abhydrolase_6 | 0.41 |
| PF14026 | DUF4242 | 0.41 |
| PF13238 | AAA_18 | 0.41 |
| PF07311 | Dodecin | 0.41 |
| PF05973 | Gp49 | 0.41 |
| PF08774 | VRR_NUC | 0.41 |
| PF10604 | Polyketide_cyc2 | 0.41 |
| PF13453 | zf-TFIIB | 0.41 |
| PF07366 | SnoaL | 0.41 |
| PF13540 | RCC1_2 | 0.41 |
| PF13365 | Trypsin_2 | 0.41 |
| PF08378 | NERD | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 242 Family Scaffolds |
|---|---|---|---|
| COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 1.65 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.24 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 1.24 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.24 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.24 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.24 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.24 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.83 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.83 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.83 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.83 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.83 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.41 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.41 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.41 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.41 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.41 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.41 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.41 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.41 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.41 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.41 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.79 % |
| Unclassified | root | N/A | 36.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10001440 | All Organisms → cellular organisms → Bacteria | 7558 | Open in IMG/M |
| 3300002558|JGI25385J37094_10099246 | Not Available | 866 | Open in IMG/M |
| 3300002561|JGI25384J37096_10140851 | Not Available | 781 | Open in IMG/M |
| 3300002561|JGI25384J37096_10228507 | Not Available | 544 | Open in IMG/M |
| 3300002562|JGI25382J37095_10065722 | Not Available | 1363 | Open in IMG/M |
| 3300002562|JGI25382J37095_10116194 | Not Available | 920 | Open in IMG/M |
| 3300002562|JGI25382J37095_10187627 | Not Available | 632 | Open in IMG/M |
| 3300002562|JGI25382J37095_10200797 | Not Available | 603 | Open in IMG/M |
| 3300002908|JGI25382J43887_10128639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1310 | Open in IMG/M |
| 3300002908|JGI25382J43887_10152875 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300002912|JGI25386J43895_10002101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5008 | Open in IMG/M |
| 3300002912|JGI25386J43895_10051943 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300005174|Ga0066680_10479333 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005175|Ga0066673_10849128 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005186|Ga0066676_10170461 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300005336|Ga0070680_100190005 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300005445|Ga0070708_100325920 | Not Available | 1447 | Open in IMG/M |
| 3300005446|Ga0066686_10080877 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
| 3300005450|Ga0066682_10001449 | All Organisms → cellular organisms → Bacteria | 9445 | Open in IMG/M |
| 3300005471|Ga0070698_100569471 | Not Available | 1072 | Open in IMG/M |
| 3300005540|Ga0066697_10005362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6224 | Open in IMG/M |
| 3300005549|Ga0070704_100785401 | Not Available | 850 | Open in IMG/M |
| 3300005553|Ga0066695_10031513 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
| 3300005553|Ga0066695_10101292 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300005553|Ga0066695_10658554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
| 3300005555|Ga0066692_10747925 | Not Available | 603 | Open in IMG/M |
| 3300005556|Ga0066707_10016596 | All Organisms → cellular organisms → Bacteria | 3804 | Open in IMG/M |
| 3300005557|Ga0066704_10128821 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_65_7 | 1684 | Open in IMG/M |
| 3300005557|Ga0066704_10534901 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005557|Ga0066704_10764561 | Not Available | 603 | Open in IMG/M |
| 3300005559|Ga0066700_10798277 | Not Available | 636 | Open in IMG/M |
| 3300005560|Ga0066670_10001001 | All Organisms → cellular organisms → Bacteria | 9289 | Open in IMG/M |
| 3300005586|Ga0066691_10056459 | Not Available | 2118 | Open in IMG/M |
| 3300005586|Ga0066691_10708092 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005598|Ga0066706_10013499 | All Organisms → cellular organisms → Bacteria | 4655 | Open in IMG/M |
| 3300005598|Ga0066706_10218244 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1472 | Open in IMG/M |
| 3300005598|Ga0066706_10805239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 740 | Open in IMG/M |
| 3300005598|Ga0066706_11114861 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006034|Ga0066656_10112926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1663 | Open in IMG/M |
| 3300006034|Ga0066656_10240098 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300006034|Ga0066656_10341592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 967 | Open in IMG/M |
| 3300006034|Ga0066656_10498045 | Not Available | 794 | Open in IMG/M |
| 3300006046|Ga0066652_100059803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2916 | Open in IMG/M |
| 3300006046|Ga0066652_101931170 | Not Available | 528 | Open in IMG/M |
| 3300006791|Ga0066653_10319619 | Not Available | 782 | Open in IMG/M |
| 3300006796|Ga0066665_10012206 | All Organisms → cellular organisms → Bacteria | 5045 | Open in IMG/M |
| 3300006796|Ga0066665_10304259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 1283 | Open in IMG/M |
| 3300006796|Ga0066665_10346769 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1210 | Open in IMG/M |
| 3300006796|Ga0066665_10352836 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300006797|Ga0066659_10235010 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300006797|Ga0066659_10318633 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300006845|Ga0075421_100947687 | Not Available | 978 | Open in IMG/M |
| 3300006852|Ga0075433_10050740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3612 | Open in IMG/M |
| 3300006852|Ga0075433_10115454 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300006854|Ga0075425_100279823 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300006854|Ga0075425_100472189 | Not Available | 1444 | Open in IMG/M |
| 3300006854|Ga0075425_101897739 | Not Available | 667 | Open in IMG/M |
| 3300006871|Ga0075434_100136897 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300006871|Ga0075434_100452936 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300006871|Ga0075434_101287489 | Not Available | 742 | Open in IMG/M |
| 3300006903|Ga0075426_10522608 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 883 | Open in IMG/M |
| 3300006904|Ga0075424_100717490 | Not Available | 1067 | Open in IMG/M |
| 3300006904|Ga0075424_101112511 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300006904|Ga0075424_101869157 | Not Available | 635 | Open in IMG/M |
| 3300006904|Ga0075424_102413784 | Not Available | 551 | Open in IMG/M |
| 3300006914|Ga0075436_100191127 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300007076|Ga0075435_100083183 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300007265|Ga0099794_10001949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 7430 | Open in IMG/M |
| 3300007265|Ga0099794_10036345 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
| 3300009012|Ga0066710_101643499 | Not Available | 981 | Open in IMG/M |
| 3300009012|Ga0066710_101719884 | Not Available | 953 | Open in IMG/M |
| 3300009012|Ga0066710_101733290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 948 | Open in IMG/M |
| 3300009012|Ga0066710_103567450 | Not Available | 587 | Open in IMG/M |
| 3300009012|Ga0066710_104255518 | Not Available | 535 | Open in IMG/M |
| 3300009088|Ga0099830_10035767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3399 | Open in IMG/M |
| 3300009088|Ga0099830_10542495 | Not Available | 951 | Open in IMG/M |
| 3300009089|Ga0099828_10981637 | Not Available | 753 | Open in IMG/M |
| 3300009089|Ga0099828_10986830 | Not Available | 751 | Open in IMG/M |
| 3300009089|Ga0099828_11271376 | Not Available | 652 | Open in IMG/M |
| 3300009090|Ga0099827_11646521 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009137|Ga0066709_102265169 | Not Available | 746 | Open in IMG/M |
| 3300009137|Ga0066709_102294891 | Not Available | 740 | Open in IMG/M |
| 3300009162|Ga0075423_10135080 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300010301|Ga0134070_10131945 | Not Available | 887 | Open in IMG/M |
| 3300010301|Ga0134070_10246128 | Not Available | 668 | Open in IMG/M |
| 3300010304|Ga0134088_10240241 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300010321|Ga0134067_10002979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4262 | Open in IMG/M |
| 3300010322|Ga0134084_10428355 | Not Available | 522 | Open in IMG/M |
| 3300010329|Ga0134111_10512149 | Not Available | 528 | Open in IMG/M |
| 3300010329|Ga0134111_10568492 | Not Available | 505 | Open in IMG/M |
| 3300010396|Ga0134126_11136005 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 870 | Open in IMG/M |
| 3300010401|Ga0134121_10120583 | Not Available | 2215 | Open in IMG/M |
| 3300010403|Ga0134123_10317553 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300011269|Ga0137392_10018227 | All Organisms → cellular organisms → Bacteria | 4866 | Open in IMG/M |
| 3300012096|Ga0137389_10979365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300012096|Ga0137389_11129114 | Not Available | 671 | Open in IMG/M |
| 3300012198|Ga0137364_10029249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3498 | Open in IMG/M |
| 3300012198|Ga0137364_10183560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 1527 | Open in IMG/M |
| 3300012199|Ga0137383_10152524 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300012199|Ga0137383_10201824 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300012199|Ga0137383_10659261 | Not Available | 765 | Open in IMG/M |
| 3300012199|Ga0137383_10975931 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012199|Ga0137383_11055268 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300012200|Ga0137382_10011773 | All Organisms → cellular organisms → Bacteria | 4698 | Open in IMG/M |
| 3300012201|Ga0137365_10025073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium | 4609 | Open in IMG/M |
| 3300012201|Ga0137365_10844092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 669 | Open in IMG/M |
| 3300012203|Ga0137399_11069587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium | 679 | Open in IMG/M |
| 3300012203|Ga0137399_11509817 | Not Available | 559 | Open in IMG/M |
| 3300012203|Ga0137399_11794800 | Not Available | 502 | Open in IMG/M |
| 3300012204|Ga0137374_10573367 | Not Available | 864 | Open in IMG/M |
| 3300012204|Ga0137374_10630460 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 814 | Open in IMG/M |
| 3300012206|Ga0137380_10074653 | All Organisms → cellular organisms → Bacteria → FCB group | 3101 | Open in IMG/M |
| 3300012206|Ga0137380_10074898 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
| 3300012206|Ga0137380_10087215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2853 | Open in IMG/M |
| 3300012206|Ga0137380_10691031 | Not Available | 886 | Open in IMG/M |
| 3300012206|Ga0137380_10801099 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 813 | Open in IMG/M |
| 3300012207|Ga0137381_10686688 | Not Available | 890 | Open in IMG/M |
| 3300012207|Ga0137381_10939698 | Not Available | 747 | Open in IMG/M |
| 3300012207|Ga0137381_11714101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
| 3300012208|Ga0137376_10178374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1834 | Open in IMG/M |
| 3300012208|Ga0137376_10529609 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1021 | Open in IMG/M |
| 3300012208|Ga0137376_10817354 | Not Available | 802 | Open in IMG/M |
| 3300012209|Ga0137379_10119177 | Not Available | 2538 | Open in IMG/M |
| 3300012209|Ga0137379_10437005 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1217 | Open in IMG/M |
| 3300012209|Ga0137379_10611256 | Not Available | 997 | Open in IMG/M |
| 3300012209|Ga0137379_11081413 | Not Available | 707 | Open in IMG/M |
| 3300012209|Ga0137379_11136249 | Not Available | 687 | Open in IMG/M |
| 3300012210|Ga0137378_10132080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas hortensis | 2308 | Open in IMG/M |
| 3300012210|Ga0137378_10476849 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300012210|Ga0137378_11339038 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
| 3300012210|Ga0137378_11786035 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300012211|Ga0137377_10010897 | All Organisms → cellular organisms → Bacteria | 7640 | Open in IMG/M |
| 3300012211|Ga0137377_10017859 | All Organisms → cellular organisms → Bacteria | 6194 | Open in IMG/M |
| 3300012211|Ga0137377_10120707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2499 | Open in IMG/M |
| 3300012211|Ga0137377_10126938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2435 | Open in IMG/M |
| 3300012211|Ga0137377_10310499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis elabens | 1512 | Open in IMG/M |
| 3300012211|Ga0137377_10399792 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300012211|Ga0137377_10878240 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7 | 829 | Open in IMG/M |
| 3300012211|Ga0137377_11435379 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012211|Ga0137377_11435567 | Not Available | 618 | Open in IMG/M |
| 3300012211|Ga0137377_11752889 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 541 | Open in IMG/M |
| 3300012285|Ga0137370_10947992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300012349|Ga0137387_10126129 | Not Available | 1808 | Open in IMG/M |
| 3300012349|Ga0137387_10563800 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 826 | Open in IMG/M |
| 3300012351|Ga0137386_10210713 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300012353|Ga0137367_10021950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4984 | Open in IMG/M |
| 3300012353|Ga0137367_10469131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 888 | Open in IMG/M |
| 3300012356|Ga0137371_10046937 | All Organisms → cellular organisms → Bacteria | 3336 | Open in IMG/M |
| 3300012356|Ga0137371_10055448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Wenzhouxiangellaceae → Wenzhouxiangella → unclassified Wenzhouxiangella → Wenzhouxiangella sp. W260 | 3067 | Open in IMG/M |
| 3300012356|Ga0137371_10300735 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300012356|Ga0137371_10398581 | Not Available | 1067 | Open in IMG/M |
| 3300012356|Ga0137371_10801720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 718 | Open in IMG/M |
| 3300012357|Ga0137384_10333187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1259 | Open in IMG/M |
| 3300012357|Ga0137384_10494497 | Not Available | 1004 | Open in IMG/M |
| 3300012359|Ga0137385_10237863 | Not Available | 1580 | Open in IMG/M |
| 3300012359|Ga0137385_10281792 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. UW-LDO-01 | 1433 | Open in IMG/M |
| 3300012359|Ga0137385_10444727 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1101 | Open in IMG/M |
| 3300012362|Ga0137361_10069598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2976 | Open in IMG/M |
| 3300012363|Ga0137390_11118625 | Not Available | 736 | Open in IMG/M |
| 3300012918|Ga0137396_10010125 | All Organisms → cellular organisms → Bacteria | 5742 | Open in IMG/M |
| 3300012918|Ga0137396_10206490 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1445 | Open in IMG/M |
| 3300012922|Ga0137394_10138190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2070 | Open in IMG/M |
| 3300012922|Ga0137394_10146100 | Not Available | 2010 | Open in IMG/M |
| 3300012922|Ga0137394_10976186 | Not Available | 705 | Open in IMG/M |
| 3300012922|Ga0137394_11147588 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300012927|Ga0137416_10862471 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012927|Ga0137416_11296341 | Not Available | 658 | Open in IMG/M |
| 3300012927|Ga0137416_11551783 | Not Available | 602 | Open in IMG/M |
| 3300012930|Ga0137407_10706442 | Not Available | 950 | Open in IMG/M |
| 3300012930|Ga0137407_10837544 | Not Available | 869 | Open in IMG/M |
| 3300012972|Ga0134077_10219364 | Not Available | 779 | Open in IMG/M |
| 3300012975|Ga0134110_10202739 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300014154|Ga0134075_10389150 | Not Available | 615 | Open in IMG/M |
| 3300014166|Ga0134079_10000755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 8581 | Open in IMG/M |
| 3300015242|Ga0137412_10780028 | Not Available | 703 | Open in IMG/M |
| 3300017656|Ga0134112_10288655 | Not Available | 657 | Open in IMG/M |
| 3300017657|Ga0134074_1013532 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
| 3300017657|Ga0134074_1036982 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300017659|Ga0134083_10372072 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
| 3300017659|Ga0134083_10559288 | Not Available | 519 | Open in IMG/M |
| 3300018075|Ga0184632_10002795 | All Organisms → cellular organisms → Bacteria | 7273 | Open in IMG/M |
| 3300018431|Ga0066655_10001259 | All Organisms → cellular organisms → Bacteria | 9025 | Open in IMG/M |
| 3300018431|Ga0066655_10022554 | All Organisms → cellular organisms → Bacteria | 2953 | Open in IMG/M |
| 3300018431|Ga0066655_10860441 | Not Available | 618 | Open in IMG/M |
| 3300018431|Ga0066655_11195459 | Not Available | 538 | Open in IMG/M |
| 3300018433|Ga0066667_10110971 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
| 3300018468|Ga0066662_10028587 | All Organisms → cellular organisms → Bacteria | 3271 | Open in IMG/M |
| 3300018482|Ga0066669_11291716 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300019259|Ga0184646_1008723 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300019882|Ga0193713_1009921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2900 | Open in IMG/M |
| 3300025910|Ga0207684_11051304 | Not Available | 679 | Open in IMG/M |
| 3300026295|Ga0209234_1012329 | All Organisms → cellular organisms → Bacteria | 3243 | Open in IMG/M |
| 3300026295|Ga0209234_1061669 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300026296|Ga0209235_1021488 | All Organisms → cellular organisms → Bacteria | 3443 | Open in IMG/M |
| 3300026296|Ga0209235_1083390 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300026297|Ga0209237_1030767 | All Organisms → cellular organisms → Bacteria | 2932 | Open in IMG/M |
| 3300026297|Ga0209237_1030767 | All Organisms → cellular organisms → Bacteria | 2932 | Open in IMG/M |
| 3300026297|Ga0209237_1167008 | Not Available | 808 | Open in IMG/M |
| 3300026298|Ga0209236_1003911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 9102 | Open in IMG/M |
| 3300026301|Ga0209238_1123205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_65_7 | 849 | Open in IMG/M |
| 3300026305|Ga0209688_1107325 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aerophobetes → unclassified Aerophobetes → Candidatus Aerophobetes bacterium Ae_b3b | 523 | Open in IMG/M |
| 3300026307|Ga0209469_1001084 | All Organisms → cellular organisms → Bacteria | 15540 | Open in IMG/M |
| 3300026313|Ga0209761_1007543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 7131 | Open in IMG/M |
| 3300026313|Ga0209761_1187109 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300026313|Ga0209761_1202037 | Not Available | 871 | Open in IMG/M |
| 3300026315|Ga0209686_1020367 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
| 3300026320|Ga0209131_1041812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2629 | Open in IMG/M |
| 3300026327|Ga0209266_1034796 | All Organisms → cellular organisms → Bacteria | 2628 | Open in IMG/M |
| 3300026327|Ga0209266_1052471 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300026328|Ga0209802_1195793 | Not Available | 785 | Open in IMG/M |
| 3300026330|Ga0209473_1035444 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
| 3300026330|Ga0209473_1088443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
| 3300026528|Ga0209378_1094606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1327 | Open in IMG/M |
| 3300026529|Ga0209806_1167843 | Not Available | 817 | Open in IMG/M |
| 3300026529|Ga0209806_1201427 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 694 | Open in IMG/M |
| 3300026532|Ga0209160_1007567 | All Organisms → cellular organisms → Bacteria | 8300 | Open in IMG/M |
| 3300026536|Ga0209058_1146153 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1121 | Open in IMG/M |
| 3300026536|Ga0209058_1244256 | Not Available | 638 | Open in IMG/M |
| 3300026536|Ga0209058_1296319 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300026537|Ga0209157_1038891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2650 | Open in IMG/M |
| 3300026537|Ga0209157_1315939 | Not Available | 568 | Open in IMG/M |
| 3300026538|Ga0209056_10051653 | All Organisms → cellular organisms → Bacteria | 3674 | Open in IMG/M |
| 3300026538|Ga0209056_10585119 | Not Available | 564 | Open in IMG/M |
| 3300026538|Ga0209056_10669234 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 524 | Open in IMG/M |
| 3300027573|Ga0208454_1002719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5889 | Open in IMG/M |
| 3300027671|Ga0209588_1000422 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 10987 | Open in IMG/M |
| 3300027748|Ga0209689_1149606 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300027862|Ga0209701_10003912 | All Organisms → cellular organisms → Bacteria | 9791 | Open in IMG/M |
| 3300027862|Ga0209701_10677513 | Not Available | 535 | Open in IMG/M |
| 3300027882|Ga0209590_10027421 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 2964 | Open in IMG/M |
| 3300027882|Ga0209590_10111818 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300027882|Ga0209590_10304456 | Not Available | 1023 | Open in IMG/M |
| 3300027882|Ga0209590_10869878 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300028536|Ga0137415_10201947 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300028715|Ga0307313_10143110 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300032180|Ga0307471_100202395 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1988 | Open in IMG/M |
| 3300032180|Ga0307471_101440959 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_4_69_5 | 848 | Open in IMG/M |
| 3300032205|Ga0307472_102302040 | Not Available | 545 | Open in IMG/M |
| 3300034164|Ga0364940_0174140 | Not Available | 625 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 38.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.23% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.41% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.41% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.41% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100014404 | 3300002558 | Grasslands Soil | MMETLSVPPNMRLTLAAPVVCGRIAFVHRTVWRRSLGAIR* |
| JGI25385J37094_100992463 | 3300002558 | Grasslands Soil | SGFTGAAPNMRLKLPAPVNWGRIAFVKVKTWRRSLGALR* |
| JGI25384J37096_101408511 | 3300002561 | Grasslands Soil | VEVLVMWVPNKRLKLSAPVVCGRIVFVNVLVWRRSLGAPR* |
| JGI25384J37096_102285072 | 3300002561 | Grasslands Soil | PSERALRPNERLKLAAPAVSGTIPFVKTKARRRSLGAIR* |
| JGI25382J37095_100657222 | 3300002562 | Grasslands Soil | VLWKGVPPNMRLKLAAPILGGRIAFVHRTVWRRSLGAIR* |
| JGI25382J37095_101161943 | 3300002562 | Grasslands Soil | MQRTALGRLVSVRPNTRLKLPAPVVYGRIAFVQRTVCRRSLGAVR |
| JGI25382J37095_101876271 | 3300002562 | Grasslands Soil | MPVPGPNALPNMRLKLPAPVVCGKIAFVNIPARRRSLGAPR* |
| JGI25382J37095_102007971 | 3300002562 | Grasslands Soil | CKFFAPPSNMRLKLAAPVVGGRLAFVNLLVWRRSLGAVR* |
| JGI25382J43887_101286393 | 3300002908 | Grasslands Soil | MSQQPMRLLPNTRLKLTAPGLYGSILFVNVLIRRRSLGARR* |
| JGI25382J43887_101528752 | 3300002908 | Grasslands Soil | MMSSVRAQPNKRLKLTAPVIYGRIAFVNVKARRRSLGAIR* |
| JGI25386J43895_100021013 | 3300002912 | Grasslands Soil | MMETLSVPPNMRLTLAAPVVCGRIALVHRTVWRRSLGAIR* |
| JGI25386J43895_100519431 | 3300002912 | Grasslands Soil | DLMSQQPMRLLPNTRLKLTAPGLYGSILFVNVLIRRRSLGARR* |
| JGI25389J43894_10583002 | 3300002916 | Grasslands Soil | PYSYRVGEERPNKRLKLTAPVVYGRIAFVNIPARRRSLGAPR* |
| Ga0066683_101136303 | 3300005172 | Soil | MEAEMTRVERPNTRLKLTAPVIYGRIAFVNVTVWRRSLGAPR* |
| Ga0066680_104793331 | 3300005174 | Soil | MISTGEELLPNTRLKLTAPGVYGRIRFVNIPVRRRSLGAIR* |
| Ga0066673_108491283 | 3300005175 | Soil | SSSRLMIVEPNKRLKLAAPGVSGTIPFVKTKARRRSLGAIR* |
| Ga0066676_101704612 | 3300005186 | Soil | MSFLGQQPNMRLKLTAPVICGKIAFVIIPARRRSLSAIR* |
| Ga0070680_1001900051 | 3300005336 | Corn Rhizosphere | LPFQSRAAHLAAPPNKRLKLSAPVIYGRIAFVNLRVWRRSLGAIR* |
| Ga0070708_1003259202 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDEVTGPSKVRLKLPAPVLECRIAFVIFTARRRSLGAIR* |
| Ga0066686_100808771 | 3300005446 | Soil | MSFLGQQPNMRLKLTAPVICGKIAFVIIPARRRSLGAIR* |
| Ga0066682_100014493 | 3300005450 | Soil | MMETLRVPPNTRLTLAAPVVCGRIAFVHRTVWRRSLGAIR* |
| Ga0066682_107441382 | 3300005450 | Soil | LCDHRSRWERPNTRLKLTAPVVYGRIAFVNPLVWRRSLGAIR* |
| Ga0070698_1005694713 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | HDQREAAPNMRLKLTAPVIYSRIAFVNVLVWRRSLGAFR* |
| Ga0066697_1000536211 | 3300005540 | Soil | VVYQLAPNKRLKLTAPVIRGRIPFVIIPVRRRSLGAPR* |
| Ga0070704_1007854012 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDEVTGPSKVRLKLPAPVLECRIAFVIFTARRRSLGAPR* |
| Ga0066695_100315133 | 3300005553 | Soil | MITALPNLRLKLAAPVVYGRIAFVSISVRRRSLSAIR* |
| Ga0066695_101012923 | 3300005553 | Soil | QKRSRRGLPNPRLKLAAPVVCGTIAFVNVKAWRRSLGALR* |
| Ga0066695_106585543 | 3300005553 | Soil | APPNTRLKLAAPVVSGRLAFVNVKAWRRSLGAPR* |
| Ga0066692_107479252 | 3300005555 | Soil | GFLTLLPNKRLKLTAPVIWGRIPFVNVPVRRRSLGASR* |
| Ga0066707_100165963 | 3300005556 | Soil | MVVKLPPNTRLKLTAPVGYGRIPFVIIVARRRSLGAPR* |
| Ga0066704_101288213 | 3300005557 | Soil | LSAFKQPPNTRLKLSAPVICGKLPFVIISARRRSLSAIR* |
| Ga0066704_105349011 | 3300005557 | Soil | SIREQQPNMRLKLTAPVVCGRIPFVTLPARRRSLGALR* |
| Ga0066704_107645611 | 3300005557 | Soil | ALPNKRLKLPAPVLEGRIAFVNIRDRRRSLGAPR* |
| Ga0066700_107982771 | 3300005559 | Soil | HQSILGPRPNKRLKLAAPVVYGRIAFVNTLVRRRSLGALR* |
| Ga0066670_100010016 | 3300005560 | Soil | MVVKLPPNTRLKLTAPVGYRIPFVIIVARRRSLGAAR* |
| Ga0066691_100564592 | 3300005586 | Soil | MVEQLPNKRLKLPAPVVCGRIAFVNMKARRRSLGAIR* |
| Ga0066691_107080921 | 3300005586 | Soil | MSSIKSRRPLPNKRLKLTAPVAYGRIAFVNLSVWRRSFRRIPLG |
| Ga0066706_100134994 | 3300005598 | Soil | MPPNTRLKLSAPVVCGRIAFVNVRVWRRSLSAIR* |
| Ga0066706_102182441 | 3300005598 | Soil | RAVPNPRLKLTAPVVCGRIPFVIILARRRSLGAIR* |
| Ga0066706_108052391 | 3300005598 | Soil | MVQHVTLQPNTRLKLTAPGVYGRIPFVIMPAWRHSLGHNPL |
| Ga0066706_111148613 | 3300005598 | Soil | SIPRAVPNPRLKLTAPVVCGRIPFVIILARRRSLGAIR* |
| Ga0066656_101129265 | 3300006034 | Soil | LNGQPPNKRLKLPAPGVCGTIPFVKTKARRRSLGAPR* |
| Ga0066656_102400983 | 3300006034 | Soil | LGSARGHAQSAMSFLGQQPNMRLKLTAPVICGKIAFVIIPARRRSLSAIR* |
| Ga0066656_103415923 | 3300006034 | Soil | SLNGQPPNKRLKLTAPVVCGRIPFVIIMARRRSLGAPR* |
| Ga0066656_104980452 | 3300006034 | Soil | GAGSPPNTRLKLTAPVVYGRIAFVNLLVWRRSLGAIR* |
| Ga0066652_1000598031 | 3300006046 | Soil | AQPNKRLKLTAPAVCGRIAFVISPAWRRSLGAIP* |
| Ga0066652_1019311702 | 3300006046 | Soil | QLAPNKRLKLTAPVIRGRIPFVIIPVRRRSLGAPR* |
| Ga0066653_103196191 | 3300006791 | Soil | RDESFLFSFRNGLPNKRLKLTAPVVCGKLSFVNIPVRRRSLGASR* |
| Ga0066665_100122066 | 3300006796 | Soil | MVVKLPPNTRLKLTAPVGYRIPFVIIVARRRSLGAPR* |
| Ga0066665_103042594 | 3300006796 | Soil | LVFLARVPNMRLKLSAPVLEGKIAFVQRTVWRRSLSAIR* |
| Ga0066665_103467691 | 3300006796 | Soil | SGRPNKRLKLTAPVIWGRIAFVKIPAWRRSLGAIR* |
| Ga0066665_103528363 | 3300006796 | Soil | HFPMSAPPNKRLKLTAPVVYGRIAFVNLPVWRRSLGAPR* |
| Ga0066659_102350104 | 3300006797 | Soil | FVVGAPPNKRLKLAAPVNCGKLAFVNVPVWRRSLGAIR* |
| Ga0066659_103186331 | 3300006797 | Soil | VYQLAPNKRLKLTAPVIRGRIPFVIIPVRRRSLSAVR* |
| Ga0075421_1009476871 | 3300006845 | Populus Rhizosphere | RRPNKRLKLTAPVIYGRIAFVNVIARRRSLGAFR* |
| Ga0075433_100507406 | 3300006852 | Populus Rhizosphere | MKTPMSVLSNVRLKLTAPVLEGRIALVNHTVWRRSLGAFR* |
| Ga0075433_101154543 | 3300006852 | Populus Rhizosphere | MPRLFQRSDAPSNVRLKLPAPVLEGRIAFVHRTVWRRSLGAIR* |
| Ga0075425_1002798234 | 3300006854 | Populus Rhizosphere | MNSFVTLPNLRLKLPAPGVYGRIPFVIIPVGRRSLGAIR* |
| Ga0075425_1004721893 | 3300006854 | Populus Rhizosphere | MLDEVMGPSNMRLKLSAPVICGRIAFVNVNAWRRSLGAIR* |
| Ga0075425_1018977392 | 3300006854 | Populus Rhizosphere | SDAPSNVRLKLPAPVLEGRIAFVHRTVWRRSLGAIR* |
| Ga0075434_1001368976 | 3300006871 | Populus Rhizosphere | MNGQRPNTRLKLTAPVIYGRLAFVHRTVWRRSLGAIR* |
| Ga0075434_1004529363 | 3300006871 | Populus Rhizosphere | ARDRLPNTRLKLSAPVLEGRIAFVIRTTRRRSLGAIR* |
| Ga0075434_1012874892 | 3300006871 | Populus Rhizosphere | VPPNMRLKLPAPVVCGRIAFVNLKARRRSLGAIR* |
| Ga0075426_105226081 | 3300006903 | Populus Rhizosphere | RAIDERVVPAPNKRLKLAAPSCWGGHQFVNVKATRRSLGAIR* |
| Ga0075424_1007174904 | 3300006904 | Populus Rhizosphere | TRGALPNTRLKLTAPVLEGRIAFVIRTTRRRSLGASR* |
| Ga0075424_1011125113 | 3300006904 | Populus Rhizosphere | PLPNMRLKLAAPVLEGRIAFVNHTVWRRSFSAVR* |
| Ga0075424_1018691571 | 3300006904 | Populus Rhizosphere | LLSISIGRVPPNMRLKLTAPVLGGRIAFVHRTVWRR |
| Ga0075424_1024137841 | 3300006904 | Populus Rhizosphere | RAPSNTRLKLPAPVIWGRIAFVKTTARRRSLGAIR* |
| Ga0075436_1001911271 | 3300006914 | Populus Rhizosphere | GQPNKRLKLAAPVLDGRIAFVNRTVWRRSLGAIR* |
| Ga0075435_1000831835 | 3300007076 | Populus Rhizosphere | MSFFGQQPNTRLKLTAPVVWGRIAFVHRTVWRRSLGAIR* |
| Ga0099794_1000194910 | 3300007265 | Vadose Zone Soil | MKREGAPPNKRMKLPAPGVCGRIAFVMILTRRRSLGAPR* |
| Ga0099794_100363454 | 3300007265 | Vadose Zone Soil | GAAWCGALPNKRLKLSAPVVCGNILFVNVKVWRRSLGAPR* |
| Ga0066710_1016434991 | 3300009012 | Grasslands Soil | HVVYQLAPNKRLKLTAPVIRGRIPFVIIPVRRRSLSAIR |
| Ga0066710_1017198841 | 3300009012 | Grasslands Soil | EMTRVERPNTRLKLTAPVIYGRIAFVNVTVWRRSLGAPR |
| Ga0066710_1017332903 | 3300009012 | Grasslands Soil | FGLTNLPLPNPRLKLTAPRNYGRLAFVCVHVRRRSLGAPR |
| Ga0066710_1035674502 | 3300009012 | Grasslands Soil | GSVKELPNTRLKLAAPVVYGRIAFVNIPVRRRSLGAPR |
| Ga0066710_1042555182 | 3300009012 | Grasslands Soil | ALTFVIAVLPNTRLKLAAPAISGNIAFVNVKAWRRSLGAPR |
| Ga0099830_100357673 | 3300009088 | Vadose Zone Soil | MKREGAPPNKRLKLPAPGVSGTIPFVKTKARRRSLGAPR* |
| Ga0099830_105424953 | 3300009088 | Vadose Zone Soil | MSVSRPGALPNKRLKLAAPFIYCRIAFVNVPARRR |
| Ga0099828_109816372 | 3300009089 | Vadose Zone Soil | ALPNTRLKLTAPVICGRIAFVNVKVWRRSLGAIR* |
| Ga0099828_109868301 | 3300009089 | Vadose Zone Soil | REKLPNMRLKLTAPDVYGRIAFVHVPVRRRSLGASR* |
| Ga0099828_112713761 | 3300009089 | Vadose Zone Soil | VAHVVDGATRAPNKRLKLTAPVVYGRIPFVIVPVRRRSL |
| Ga0099827_116465212 | 3300009090 | Vadose Zone Soil | WSHEALPPNTRLKLSALVLEGKIAFVNRTVWRRSLGAIH* |
| Ga0066709_1022651691 | 3300009137 | Grasslands Soil | HDVALGPPNKRLKLAAPVVCGSILFVNVLVRRRSLGAPR* |
| Ga0066709_1022948912 | 3300009137 | Grasslands Soil | VYQLAPNKRLKLTAPVIRGRIPFVIIPVRRRSLGAPR* |
| Ga0075423_101350801 | 3300009162 | Populus Rhizosphere | LSVSVPPNTRLKLTAPVLEGRIAFVILTARRRSLGAFR* |
| Ga0134070_101319451 | 3300010301 | Grasslands Soil | APLYSLRPNTRLKLTALVVCGNIAFVIIPARRRSLGAPR* |
| Ga0134070_102461282 | 3300010301 | Grasslands Soil | ESECSRPNKRLKLAAPVIYGKIAFVNLSVWRRSLGAPR* |
| Ga0134088_102402411 | 3300010304 | Grasslands Soil | TKCVELLLPPNTRLKLTAPVVCGRIVFVNVKAWRRSLGALR* |
| Ga0134067_100029792 | 3300010321 | Grasslands Soil | MVVKLPPNTRLKLTAPVGYRIPFVIILARRRSLGAAR* |
| Ga0134084_100954912 | 3300010322 | Grasslands Soil | DRGSTSADEAQPNMRLKLTAPVICGRIAFVNVMARRRSLGAPR* |
| Ga0134084_104283551 | 3300010322 | Grasslands Soil | MNSIAAWAQPNKRLKLTAPAVCGRIAFVISPAWRRSLGAIP |
| Ga0134111_105121491 | 3300010329 | Grasslands Soil | TIVGAQPNQRLKLPAPVICGKLLFVIIPVLRRSLGAIR* |
| Ga0134111_105684921 | 3300010329 | Grasslands Soil | MPGWISVPRSNMRLKLTAPVICGRIAFVNLLVWRRSL |
| Ga0134126_111360052 | 3300010396 | Terrestrial Soil | GLLPNMRLKLTAPVVCGRIAFVHPTVWRRSLGAIR* |
| Ga0134121_101205831 | 3300010401 | Terrestrial Soil | SIGALLPNMRLKLTAPVVYCRIAFVNVLVWRRSLGAFR* |
| Ga0134123_103175533 | 3300010403 | Terrestrial Soil | GAQDDTLQPNMRPKLSAPVVEGRIAFVHRIVWRRSLGAIR* |
| Ga0137392_1001822710 | 3300011269 | Vadose Zone Soil | CHPAVIMAPNKRLKLPAPVVWGRIAFVNVKARRRSLGASR* |
| Ga0137389_109793653 | 3300012096 | Vadose Zone Soil | HLPNQRLKLAAPVVCGSIVFVNLQCWRRSLGAPR* |
| Ga0137389_111291143 | 3300012096 | Vadose Zone Soil | VAHVVDGATRAPNKRLKLTAPVVYGRIPFVIVPVRRRSLGA |
| Ga0137364_100292494 | 3300012198 | Vadose Zone Soil | MSVPPNTRLKLTAPVTYGRIAFVNVKAWRRSLGAIR* |
| Ga0137364_101835604 | 3300012198 | Vadose Zone Soil | HRSRWERPNTRLKLTAPVVYGRIAFVNPLVWRRSLGAIR* |
| Ga0137383_101525241 | 3300012199 | Vadose Zone Soil | HVVYQLAPNKRLKLTAPVIRGRIPFVIIPVRRRSLGAPR* |
| Ga0137383_102018244 | 3300012199 | Vadose Zone Soil | PTPPPNTRLKLAAPFIYCRIAFVNLPVWRRSLGAIR* |
| Ga0137383_106592612 | 3300012199 | Vadose Zone Soil | ATPPSNTRLKLTAPVVYGRIAFVTVPVWRRSLGAIR* |
| Ga0137383_109759311 | 3300012199 | Vadose Zone Soil | PRAQAVTLPNMHLKLPAPVVCGRIAFVNIPVRRRSLGAPR* |
| Ga0137383_110552681 | 3300012199 | Vadose Zone Soil | VEGLVGRLPNMRLKLTAPALEGRIAFVKMTVWRRS |
| Ga0137382_100117735 | 3300012200 | Vadose Zone Soil | VRVLSNVRLKLTAPVLEGRIAFVHRTVWRRSLGAIR* |
| Ga0137365_100250733 | 3300012201 | Vadose Zone Soil | VLALPNTRLKLAAPVVCSKIAFVNIPVRRRSLGAFR* |
| Ga0137365_108440923 | 3300012201 | Vadose Zone Soil | CGGIHRAQPNKRLKLTAPVLEGRIAFVNHTVWRRSLGAPR* |
| Ga0137399_110695871 | 3300012203 | Vadose Zone Soil | SYGLPNKRLQVAAPVVCGRIPFVIIHVRRRSLGAIR* |
| Ga0137399_115098171 | 3300012203 | Vadose Zone Soil | DGASAVTLLPNKRLKLTAPVVYGRLAFVNVKAWRRSLGASR* |
| Ga0137399_117948002 | 3300012203 | Vadose Zone Soil | MDRTVPPNTRLKLTAPVVCGTIAFVIIHVRRRSLGASR |
| Ga0137374_105733671 | 3300012204 | Vadose Zone Soil | RCHVLPNTRLKLTAPVVCGRIAFVNVRAWRRSLGAIR* |
| Ga0137374_106304602 | 3300012204 | Vadose Zone Soil | LAVQPPNQRLKLTAPGVYGRIAFVNVKAWRRSLGAFR* |
| Ga0137380_100746531 | 3300012206 | Vadose Zone Soil | LLPNTRLKLTAPRFYGRIAFVNVRVWRRSLGAIR* |
| Ga0137380_100748983 | 3300012206 | Vadose Zone Soil | VRVLPNTRLKLTAPGVYGRIAFVNMKARRRSLGAIR* |
| Ga0137380_100872153 | 3300012206 | Vadose Zone Soil | MRALSNTRLKLAAAGVYGRIAFVNSHVRRRSLGAIR* |
| Ga0137380_106910312 | 3300012206 | Vadose Zone Soil | IEREGRLPNKRLKLPAPLVCGKLSFVIIPARRRSLGAPR* |
| Ga0137380_108010992 | 3300012206 | Vadose Zone Soil | VSLIERPPNMRLKLTAPVLEGRIAFVKMTVWRRSLGAIR* |
| Ga0137381_106866882 | 3300012207 | Vadose Zone Soil | ERPPNMRLKLTAPVLEGRIAFVKMTVWRRSLGAIR* |
| Ga0137381_109396981 | 3300012207 | Vadose Zone Soil | STVARAPLPNTRLKLPAPVVCGRIAFVNVLVRRRSLGALR* |
| Ga0137381_117141011 | 3300012207 | Vadose Zone Soil | APLPNTRLKLPAPVVCGRIAFVNVLVRRRSLGALR* |
| Ga0137376_101783741 | 3300012208 | Vadose Zone Soil | RRDNRRLPNERLKLAAPGVFGKIPFVTVHVRRRSLGAIR* |
| Ga0137376_105296091 | 3300012208 | Vadose Zone Soil | VQPNTRLKLPAPVICGKLAFVNLLVWRRSLRAIH* |
| Ga0137376_108173542 | 3300012208 | Vadose Zone Soil | MDFVIGVLPNKRLKLTAPVVYGKIAFVNISVGRRSLGAIR* |
| Ga0137379_101191771 | 3300012209 | Vadose Zone Soil | AMSFLGQQPNMRLKVTAPVICGKIAFVIIPARRRSLGAIR* |
| Ga0137379_104370051 | 3300012209 | Vadose Zone Soil | SDVPPALPNKRLKLPAPVVCGKISFVNIPVRRRSLGAPR* |
| Ga0137379_106112563 | 3300012209 | Vadose Zone Soil | EGSVSWRPNTRLKLTAPVVHGRIAFVNRTVWRRSLGAIR* |
| Ga0137379_110814131 | 3300012209 | Vadose Zone Soil | PCQMSARAPNTRLKLAAPVNCGKLAFVNVPVWRRSLGASR* |
| Ga0137379_111362492 | 3300012209 | Vadose Zone Soil | VRGLPNKRLKLTAPVIYCRIAFVNTLARRRSLGAIR* |
| Ga0137378_101320803 | 3300012210 | Vadose Zone Soil | MRGRVLPNKGLKLTAPVVCGKIAFVNIPVRRRSLGAVR* |
| Ga0137378_104768492 | 3300012210 | Vadose Zone Soil | MSFLGQQPNMRLKLTAPVICGKIAFVIIPARRRSFL* |
| Ga0137378_113390382 | 3300012210 | Vadose Zone Soil | KALPNKRLKLTAPGVYGRIAVVIIPVWRRSVGAIR* |
| Ga0137378_117860351 | 3300012210 | Vadose Zone Soil | MSFQGHVIALPNTRLKLSAPGVYGRIAFVNVKARRRSLG |
| Ga0137377_100108971 | 3300012211 | Vadose Zone Soil | SRWARPNMRLKLTAPVVCGRIVFVNLLVWRRSLGAPR* |
| Ga0137377_100178594 | 3300012211 | Vadose Zone Soil | MMRFLPQAPNKRLKLTAPVIWGRIAFVKVKTWRRSLGAPR* |
| Ga0137377_101207072 | 3300012211 | Vadose Zone Soil | MALPNMRLKLPAPVICGKLLFVIVPVRRRSLGAPR* |
| Ga0137377_101269384 | 3300012211 | Vadose Zone Soil | MKSSTERPNKRLKLTAPVNCGKLAVVNVLVWRRSLGAIR* |
| Ga0137377_103104991 | 3300012211 | Vadose Zone Soil | IAPVLPNKRLKLAAPGVSGTIPFVKTKARRRSLGAPR* |
| Ga0137377_103997921 | 3300012211 | Vadose Zone Soil | SFGLRPNKRLKLSAPVVCGKIAFVNVLVWRRSLSAIR* |
| Ga0137377_108782401 | 3300012211 | Vadose Zone Soil | DERIYHALPNKRLKLTAPVICGKIAFVNIPVRRRSLGALR* |
| Ga0137377_114353791 | 3300012211 | Vadose Zone Soil | IIGAQPNQRLKLTAPVICGRIAFVNVLGRRRSLGAPR* |
| Ga0137377_114355671 | 3300012211 | Vadose Zone Soil | VSSLPNMRLKLSAPVVYCRIAFVNVKVWRRSLSAI |
| Ga0137377_117528892 | 3300012211 | Vadose Zone Soil | PRSNTRLKLTAPGVYGKIPFVIIPALRRSSGVLR* |
| Ga0137370_109479921 | 3300012285 | Vadose Zone Soil | MRSALPNKRLKLTAPFFYGRIAFVTVLVRRRSLGAI |
| Ga0137387_101261294 | 3300012349 | Vadose Zone Soil | YFLRARPNKRLKLTAPVVYGRIAFVNLPVWLLSLAASR* |
| Ga0137387_105638001 | 3300012349 | Vadose Zone Soil | MSVLPNMRLKLTAPVLKGRIAFVHHAVWRRSLGAIR |
| Ga0137386_102107134 | 3300012351 | Vadose Zone Soil | QIVAGLRPNTRLKLTAPVICGTIAFVTVKARRRSLGALR* |
| Ga0137367_100219508 | 3300012353 | Vadose Zone Soil | GWRLAVQPPNQRLKLTAPGVYGRIAFVNVKAWRRSLGAFR* |
| Ga0137367_104691313 | 3300012353 | Vadose Zone Soil | MVQVQPNKRLKLAAPVVYGRIAFVNILAWHRSLSAVR* |
| Ga0137371_100469373 | 3300012356 | Vadose Zone Soil | MSARAPNTRLKLAAPVNCGKLAFVNVPVWRRSLGASR* |
| Ga0137371_100554484 | 3300012356 | Vadose Zone Soil | VSVLPNMRLKLTAPVLKGRIAFVKMTVWRRSLGAIR* |
| Ga0137371_103007353 | 3300012356 | Vadose Zone Soil | FLGQQPNMRLKLTAPVICGKIAFVIIPARRRSLGAIR* |
| Ga0137371_103985813 | 3300012356 | Vadose Zone Soil | PMSVPPNTRLKLTAPVTYGRIAFVNVKAWRRSLGAIR* |
| Ga0137371_108017202 | 3300012356 | Vadose Zone Soil | ALPNTRLKLAAPVVYGRIAFVDRIARRRSLSAIR* |
| Ga0137384_103331874 | 3300012357 | Vadose Zone Soil | LSGLLNTRLKLTAPVIGGRIAFVNVKTWRRSLGAGR* |
| Ga0137384_104944973 | 3300012357 | Vadose Zone Soil | LRPNTRLKLTAPVICGTIAFVTVKARRRSLGALR* |
| Ga0137385_102378631 | 3300012359 | Vadose Zone Soil | MYHVLPNTRVKLTAPVVYGRIAFVNVKVWRRSLGAPR* |
| Ga0137385_102817921 | 3300012359 | Vadose Zone Soil | TWRAALPNKRLKLTAPVACGKIAFAIIPAWRRSLGAIR* |
| Ga0137385_104447272 | 3300012359 | Vadose Zone Soil | AASMSAPPNTRLKLTAPVVERRIAFVNVQVRRRSLGAPR* |
| Ga0137361_100695984 | 3300012362 | Vadose Zone Soil | MSFLGQQPNMRLKLTVPVICGKIAFVIIRARRRSLGAIR* |
| Ga0137390_111186252 | 3300012363 | Vadose Zone Soil | VLAVQPNKRLKLSAPVLEGRIAFVHRTVWRRSLGAV |
| Ga0137396_100101251 | 3300012918 | Vadose Zone Soil | MGPPSNTRLKLPAPGVCGRIAFVILLVWRRTLVAP |
| Ga0137396_102064901 | 3300012918 | Vadose Zone Soil | VMPNKRLKLTAPVICGKLLFVIIPVRRRSLGAPR* |
| Ga0137394_101381902 | 3300012922 | Vadose Zone Soil | MEPGLPSKRLKPSAPVVYGRIAFVNLLVWRRSLGASR* |
| Ga0137394_101461001 | 3300012922 | Vadose Zone Soil | MMETGPLPTTRLKLAAPVIYCRISFVNVTVWRGSLGAFRQA |
| Ga0137394_109761861 | 3300012922 | Vadose Zone Soil | GLTEPLSNMRLKLSAPVIWRTIAFVKMTVWRRSLGAIR* |
| Ga0137394_111475882 | 3300012922 | Vadose Zone Soil | TEPLSNMRLKLSAPVIWRTIAFVKMTVWRRSLGAIR* |
| Ga0137416_108624711 | 3300012927 | Vadose Zone Soil | TEPLSNMRLKLSAPVIWGTIAFVKMTVWRRSLGAIR* |
| Ga0137416_112963412 | 3300012927 | Vadose Zone Soil | AAALPNTRLKLTAPVIYGRIAFVIILDGRRSLGASR* |
| Ga0137416_115517831 | 3300012927 | Vadose Zone Soil | NLPNMRLKLAAPVVCGRIAFVNLSVWRRSLGAIR* |
| Ga0137407_107064422 | 3300012930 | Vadose Zone Soil | LVNVLPNMRLKLTAPVVCGKLSFVIIRDRRRSLGAIR* |
| Ga0137407_108375442 | 3300012930 | Vadose Zone Soil | MMEPGQLPNTRLKLPAPVIYCRISFVNVTVWRRSLGAFR* |
| Ga0134077_102193642 | 3300012972 | Grasslands Soil | AGRLPNKRLKLTAPVIYCRIAFVNSHVGRRSLGAPR* |
| Ga0134110_102027393 | 3300012975 | Grasslands Soil | YCSERLDGPPNTRLKLTAPVICGRIAFVIITARRRSLGALR* |
| Ga0134075_103891501 | 3300014154 | Grasslands Soil | IAPVLPNKRLKLAAPVICCRIAFVNLLAWRRSLGAPR* |
| Ga0134079_100007551 | 3300014166 | Grasslands Soil | KRSRRGLPNPRLKLAAPVVCGTIAFVNVKAWRRSLGALR* |
| Ga0137412_107800282 | 3300015242 | Vadose Zone Soil | NGRTVPVLPNTRLKLTAPVVCGRIAFVNVLVRRRSLSAIC* |
| Ga0134112_102886551 | 3300017656 | Grasslands Soil | FCHARALSNMRLKLTAPVLECRITFVNRIVWRRSLRALR |
| Ga0134074_10135321 | 3300017657 | Grasslands Soil | VGVTAPLYSLRPNTRLKLTARVICGKIAFVNTRVWRRSLGAIR |
| Ga0134074_10369824 | 3300017657 | Grasslands Soil | TIIGAQPNKRLKLTAPGVYGRIPFVNIPVRRRSLGAIR |
| Ga0134083_103720721 | 3300017659 | Grasslands Soil | MMETLSVPPNMRLTLAAPVVCGRIAFVHRTVWRRS |
| Ga0134083_105592881 | 3300017659 | Grasslands Soil | GRLPSNKRLKLAAPFFFGRIAFVNTKPERRTLGAIR |
| Ga0184632_1000279514 | 3300018075 | Groundwater Sediment | FSAGAFSPPPNRRLKLTAPVVCGRIAFVNVKARRRSLGAIR |
| Ga0066655_100012595 | 3300018431 | Grasslands Soil | MMETLSVPPNIRLTLAAPVVCGRIAFVHRTMWRRSLGAIR |
| Ga0066655_100225543 | 3300018431 | Grasslands Soil | MVVKLPPNTRLKLTAPVGYRIPFVIIVARRRSLGAAR |
| Ga0066655_108604411 | 3300018431 | Grasslands Soil | AYSSLAMVLPNKRLTLPAPGVYGRIAFVNIPVRRRSLGAPR |
| Ga0066655_111954592 | 3300018431 | Grasslands Soil | VMVLPNKRLKLSAPVIYGRIPFVNIPVRRRSLGAPR |
| Ga0066667_101109714 | 3300018433 | Grasslands Soil | HVVYQLAPNKRLKLTAPVIRGRIPFVIIPVRRRSLGAPR |
| Ga0066662_100285875 | 3300018468 | Grasslands Soil | MVVKLPPNTRLKLTAPVGYGRIPFVIIVARRRSLGAPR |
| Ga0066669_112917161 | 3300018482 | Grasslands Soil | VSAAPNKRLKLPAPVVCGKLSFVIIPVRRRSLSAIR |
| Ga0184646_10087231 | 3300019259 | Groundwater Sediment | PVAANARLKLRAPGVYGRIPFVIILGRRRSLGALR |
| Ga0193713_10099214 | 3300019882 | Soil | MALPNKRLKLTAPVVYGRIPFVIIPAWRRSLSALR |
| Ga0207684_110513041 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDEVTGPSKVRLKLPAPVLECRIAFVIFTARRRSLGAIR |
| Ga0209234_10123293 | 3300026295 | Grasslands Soil | MVAALPNKRLKLPAPVIYGRISFVNIPVRRRSLGASR |
| Ga0209234_10616695 | 3300026295 | Grasslands Soil | APPDRLAPNTRLKLAAPVVCGRIAFVIVPVWRRSLGAIR |
| Ga0209235_10214883 | 3300026296 | Grasslands Soil | MMETLSVPPNMRLTLAAPVVCGRIAFVHRTVWRRSLGAIR |
| Ga0209235_10833904 | 3300026296 | Grasslands Soil | PKSLRVIRPNTRLKLTAPVVCGRIVFVNVLVWRRSLGAPR |
| Ga0209237_10307676 | 3300026297 | Grasslands Soil | MTLPNMRLKLAAPVVYGRMAFVNLLVWRRSLGAPR |
| Ga0209237_10307678 | 3300026297 | Grasslands Soil | ARVRAQRPNTRLKLPAPVIYGRIAFVTFTVWRRSLGASR |
| Ga0209237_11670081 | 3300026297 | Grasslands Soil | VSVIVQPNKRLKLTAPAVCGKLAFVNVNAWRRSLGG |
| Ga0209236_10039115 | 3300026298 | Grasslands Soil | MSAPSNKRLKLTAPVNCGKLAVVNVPVWRRSLGASR |
| Ga0209238_11232052 | 3300026301 | Grasslands Soil | PLVAPPNKRLKLTAPGVSGTIPFVKTKARRRSLGAPR |
| Ga0209688_11073251 | 3300026305 | Soil | LRVPSNKRLKLTAPVVRGKLSFVIIPGRRRSLGAIR |
| Ga0209469_100108424 | 3300026307 | Soil | MMETLRVPPNTRLTLAAPVVCGRIAFVHRTVWRRSLGAIR |
| Ga0209761_10075434 | 3300026313 | Grasslands Soil | MRLLPNTRLKLTAPGLYGSILFVNVLIRRRSLGARR |
| Ga0209761_11871092 | 3300026313 | Grasslands Soil | MYHGRPNQRLKLAAPVVCGRIPFVNVPARRRSLSAIRWA |
| Ga0209761_12020371 | 3300026313 | Grasslands Soil | TIVGAQPNQRLKLTAPVICCRIAFVIIHVRRRSLGAPR |
| Ga0209686_10203672 | 3300026315 | Soil | MVVKLPPNTRLKLTAPLGYRIPFVIIVARRRSLGAPR |
| Ga0209131_10418124 | 3300026320 | Grasslands Soil | MTTLPDPLPNTRLKLAAPVLEGRIAFANRTLWRRSVGALL |
| Ga0209266_10347966 | 3300026327 | Soil | MITALPNLRLKLAAPVVYGRIAFVSISVRRRSLSAI |
| Ga0209266_10524715 | 3300026327 | Soil | ESGVGFSPPPNTRLKLTAPVNCGKLAFVKLSVWRRSLGAIR |
| Ga0209802_11957933 | 3300026328 | Soil | ELHVPPNKRLKLTAPVVYGRIAFVIIHTWRRSLGAPR |
| Ga0209473_10354441 | 3300026330 | Soil | FSATSVMVVKLPPNTRLKLTAPVGYRIPFVIIVARRRSLGAAR |
| Ga0209473_10884434 | 3300026330 | Soil | LSVGASAPSNTRLKLTAPVICGTIAFVIIQVWRRSLSAIR |
| Ga0209378_10946061 | 3300026528 | Soil | RVSLIERPPNMRLKLTAPVLEGRIAFVKMTVWRRSLGAIR |
| Ga0209806_11678432 | 3300026529 | Soil | TASETSGAFGLTNLPLPNLRLKLTARNYGRLAFVCVHVRRRSLGAPR |
| Ga0209806_12014271 | 3300026529 | Soil | VALPNQRLKLTAPGVCGRIAFVNVPVWRRSLGAPR |
| Ga0209160_10075674 | 3300026532 | Soil | MVVKLPPNTRLKLTAPVGYRIPFVIIVARRRSLGAPR |
| Ga0209058_11461533 | 3300026536 | Soil | QLAPNKRLKLTAPVIRGRIPFVIIPVRRRSLSAIR |
| Ga0209058_12442563 | 3300026536 | Soil | HAQSAMSFLGQQPNMRLKLTAPVICGKIAFVIIPARRRSLGAIR |
| Ga0209058_12963192 | 3300026536 | Soil | LTAPSNKRLKLAAPVVCGRIAFVNVPARRRSLGAIR |
| Ga0209157_10388911 | 3300026537 | Soil | RAQPNKRLKLTAPVVYGRIAFVNVLIRRRSASAIR |
| Ga0209157_13159391 | 3300026537 | Soil | SQPGALPNKRLKLSAPVFYGRIAFVNVPVWRRSLGAIR |
| Ga0209056_100516536 | 3300026538 | Soil | VFLARVPNMRLKLSAPVLEGKIAFVQRTVWRRSLSAIR |
| Ga0209056_105851191 | 3300026538 | Soil | ATIAGAQPNTRLKLAAPVVYGRIAFVNLPIWRRSLGAPR |
| Ga0209056_106692341 | 3300026538 | Soil | VKELPNTRLKLAAPVVYGRIAFVNIPVRRRSLGAPR |
| Ga0208454_100271910 | 3300027573 | Soil | VGAALLPNKRLKLAAPVLEGTIAFVNRTVWRRSLGAFR |
| Ga0209588_10004229 | 3300027671 | Vadose Zone Soil | MKREGAPPNKRMKLPAPGVCGRIAFVMILTRRRSLGAPR |
| Ga0209689_11496063 | 3300027748 | Soil | VYQLAPNKRLKLTAPVIRGRIPFVIIPVRRRSLGAPR |
| Ga0209701_100039129 | 3300027862 | Vadose Zone Soil | MKREGAPPNKRLKLPAPGVSGTIPFVKTKARRRSLGAPR |
| Ga0209701_106775131 | 3300027862 | Vadose Zone Soil | MYPVCTCPPPNTRLKLTAPGVCGRIAFVIIPVRRRSLGAAR |
| Ga0209590_100274215 | 3300027882 | Vadose Zone Soil | QALIGVPPNKRLKLTGPVVYGRIPFVIVPVRRRSLGASR |
| Ga0209590_101118183 | 3300027882 | Vadose Zone Soil | GLENAPPNARLKLPAPVVCGRIAFVNMKVWRRSLGAPG |
| Ga0209590_103044561 | 3300027882 | Vadose Zone Soil | PQIAVAWPLPNKRLKLTALGVYGRIAFVTLTVWRRSLGAIR |
| Ga0209590_108698783 | 3300027882 | Vadose Zone Soil | LSSVRHLPNKRLKLAAPVVYGRIAFVTLTAWRRSLGAPR |
| Ga0137415_102019472 | 3300028536 | Vadose Zone Soil | MIGAPLPNTRLKLSAPVVCGRIAFVNILAWRRSLSAIR |
| Ga0307313_101431101 | 3300028715 | Soil | PIPNVAPNQRLKLTAPVVCGRIPFVNLLVRRRSLGAPR |
| Ga0307471_1002023951 | 3300032180 | Hardwood Forest Soil | RRLRLALPNPRLKLTAHVVCGRIAFVSIPVRRRSLGAIR |
| Ga0307471_1014409591 | 3300032180 | Hardwood Forest Soil | SVLPNTRLKLTSPVVCGKLAFVILTVWRRSLRAIR |
| Ga0307472_1023020401 | 3300032205 | Hardwood Forest Soil | MIQRAWLPNKRLKLTAPVVYGRIAFVIISVRCRSLGA |
| Ga0364940_0174140_508_624 | 3300034164 | Sediment | IIIGAQPNQRLKLAAPGVYGRIPFVIILARRRSLGAVR |
| ⦗Top⦘ |