


| Basic Information | |
|---|---|
| Family ID | F016709 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 245 |
| Average Sequence Length | 44 residues |
| Representative Sequence | GQTYRVNQTPTTVFHSKGQTYPYSGVMSYDILKQFLDQLLSQK |
| Number of Associated Samples | 165 |
| Number of Associated Scaffolds | 245 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.02 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (37.551 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.551 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.388 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.72% β-sheet: 16.90% Coil/Unstructured: 63.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 245 Family Scaffolds |
|---|---|---|
| PF07681 | DoxX | 65.31 |
| PF02663 | FmdE | 12.24 |
| PF07291 | MauE | 10.61 |
| PF00912 | Transgly | 3.27 |
| PF03734 | YkuD | 1.22 |
| PF00583 | Acetyltransf_1 | 1.22 |
| PF01551 | Peptidase_M23 | 0.41 |
| PF02894 | GFO_IDH_MocA_C | 0.41 |
| PF13462 | Thioredoxin_4 | 0.41 |
| PF00753 | Lactamase_B | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 245 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 65.31 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 65.31 |
| COG2191 | Formylmethanofuran dehydrogenase subunit E | Energy production and conversion [C] | 12.24 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.27 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 3.27 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 3.27 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.22 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.22 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_11783526 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300001162|JGI12714J13572_1009471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300001593|JGI12635J15846_10361535 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300001593|JGI12635J15846_10496654 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300001661|JGI12053J15887_10375273 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300001661|JGI12053J15887_10449881 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100525381 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300002914|JGI25617J43924_10198154 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300002917|JGI25616J43925_10293288 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300002917|JGI25616J43925_10299294 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300002917|JGI25616J43925_10319567 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300002917|JGI25616J43925_10377915 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10123091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300004092|Ga0062389_104810980 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005167|Ga0066672_10830558 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005174|Ga0066680_10527585 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300005434|Ga0070709_11103227 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005454|Ga0066687_10610568 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005542|Ga0070732_10004560 | All Organisms → cellular organisms → Bacteria | 7487 | Open in IMG/M |
| 3300005554|Ga0066661_10595340 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005555|Ga0066692_10391945 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300005556|Ga0066707_10864478 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005568|Ga0066703_10469402 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005569|Ga0066705_10096932 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300005591|Ga0070761_10357930 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300005921|Ga0070766_10310941 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300006102|Ga0075015_100015127 | All Organisms → cellular organisms → Bacteria | 3326 | Open in IMG/M |
| 3300006174|Ga0075014_100028745 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300006791|Ga0066653_10481363 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300006797|Ga0066659_10614720 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300006797|Ga0066659_11087665 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006804|Ga0079221_10922008 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006806|Ga0079220_10405807 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300006854|Ga0075425_101640069 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006954|Ga0079219_11845365 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006954|Ga0079219_11997865 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300007255|Ga0099791_10129200 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300007255|Ga0099791_10639869 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300007258|Ga0099793_10020302 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
| 3300007258|Ga0099793_10656393 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300007258|Ga0099793_10663496 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300007265|Ga0099794_10449315 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300007982|Ga0102924_1374948 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009038|Ga0099829_11246944 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009038|Ga0099829_11357011 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009038|Ga0099829_11509148 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300009038|Ga0099829_11693959 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009038|Ga0099829_11725744 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300009088|Ga0099830_10081450 | All Organisms → cellular organisms → Bacteria | 2374 | Open in IMG/M |
| 3300009088|Ga0099830_10574720 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300009089|Ga0099828_11696843 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300009090|Ga0099827_10205412 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300009090|Ga0099827_11367925 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009143|Ga0099792_10524746 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300009143|Ga0099792_10554363 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300009545|Ga0105237_10977083 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300009792|Ga0126374_11169382 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300010048|Ga0126373_10147751 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
| 3300010048|Ga0126373_10870889 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300010303|Ga0134082_10107295 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300010321|Ga0134067_10042116 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300010321|Ga0134067_10188442 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300010358|Ga0126370_10764485 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300010358|Ga0126370_11328311 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010358|Ga0126370_11992213 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010361|Ga0126378_10120644 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
| 3300011120|Ga0150983_13956834 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300011120|Ga0150983_14644910 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300011269|Ga0137392_10047419 | All Organisms → cellular organisms → Bacteria | 3217 | Open in IMG/M |
| 3300011269|Ga0137392_10553841 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300011269|Ga0137392_10591168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300011269|Ga0137392_11091798 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300011270|Ga0137391_10997089 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300011270|Ga0137391_11216312 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300011271|Ga0137393_10141118 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300011271|Ga0137393_10522896 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300011271|Ga0137393_10878983 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300012096|Ga0137389_10405232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1165 | Open in IMG/M |
| 3300012096|Ga0137389_11825000 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012189|Ga0137388_10393759 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300012189|Ga0137388_10943379 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300012189|Ga0137388_11160850 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012198|Ga0137364_10051243 | All Organisms → cellular organisms → Bacteria | 2751 | Open in IMG/M |
| 3300012198|Ga0137364_10985038 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012199|Ga0137383_10637556 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300012200|Ga0137382_10149214 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300012202|Ga0137363_10318493 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300012202|Ga0137363_10648153 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300012202|Ga0137363_10696125 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300012202|Ga0137363_11324146 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012203|Ga0137399_10753898 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300012203|Ga0137399_11433475 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300012203|Ga0137399_11684624 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012203|Ga0137399_11696679 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012205|Ga0137362_10539838 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300012205|Ga0137362_11343128 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012205|Ga0137362_11659366 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012207|Ga0137381_11494072 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012209|Ga0137379_11559063 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012211|Ga0137377_10339179 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300012349|Ga0137387_10339049 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300012349|Ga0137387_10455279 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300012349|Ga0137387_11153493 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012351|Ga0137386_10290510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300012351|Ga0137386_10797345 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012351|Ga0137386_10859076 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012359|Ga0137385_10683212 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300012361|Ga0137360_10291660 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300012361|Ga0137360_10554321 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300012361|Ga0137360_11708337 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012361|Ga0137360_11891407 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012362|Ga0137361_11198226 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012362|Ga0137361_11565542 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012363|Ga0137390_11051014 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300012363|Ga0137390_11811983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300012582|Ga0137358_10458401 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300012683|Ga0137398_11020714 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012924|Ga0137413_10941617 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012925|Ga0137419_11810526 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012925|Ga0137419_11870258 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012927|Ga0137416_11378827 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012929|Ga0137404_10936783 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012930|Ga0137407_10870646 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300012930|Ga0137407_11767754 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012931|Ga0153915_11401990 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012957|Ga0164303_10736965 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012960|Ga0164301_10269515 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012960|Ga0164301_11281728 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012986|Ga0164304_11539948 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012989|Ga0164305_12023316 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300014968|Ga0157379_11166361 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300015193|Ga0167668_1034299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300015241|Ga0137418_10197345 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300015241|Ga0137418_10362656 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300015241|Ga0137418_10687588 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300015242|Ga0137412_10727856 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300015245|Ga0137409_10515925 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300015359|Ga0134085_10531698 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300017822|Ga0187802_10323348 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300017961|Ga0187778_10022846 | All Organisms → cellular organisms → Bacteria | 3828 | Open in IMG/M |
| 3300018019|Ga0187874_10387848 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300019877|Ga0193722_1092736 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300020199|Ga0179592_10313372 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300020579|Ga0210407_10216996 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300020579|Ga0210407_10276039 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300020579|Ga0210407_10779196 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300020579|Ga0210407_10851080 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300020579|Ga0210407_11379967 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300020581|Ga0210399_10588778 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300020582|Ga0210395_11437416 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300020583|Ga0210401_10237371 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300021046|Ga0215015_10089517 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300021046|Ga0215015_10398558 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300021046|Ga0215015_10523584 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300021046|Ga0215015_10709218 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300021168|Ga0210406_10502527 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300021168|Ga0210406_10937445 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300021168|Ga0210406_11128482 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300021170|Ga0210400_10482790 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300021170|Ga0210400_10631013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300021170|Ga0210400_11168293 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300021178|Ga0210408_10181765 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300021178|Ga0210408_10888306 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300021180|Ga0210396_11211423 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300021402|Ga0210385_11333869 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300021405|Ga0210387_10721255 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300021420|Ga0210394_10843401 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300021432|Ga0210384_10135808 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300021432|Ga0210384_11875615 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021475|Ga0210392_10265445 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300021475|Ga0210392_10480691 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300021477|Ga0210398_10814939 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300021478|Ga0210402_10110822 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300021559|Ga0210409_10134049 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300021559|Ga0210409_10504270 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300022508|Ga0222728_1013321 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300022531|Ga0242660_1168792 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300024178|Ga0247694_1028666 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300024179|Ga0247695_1002238 | All Organisms → cellular organisms → Bacteria | 2813 | Open in IMG/M |
| 3300024330|Ga0137417_1334185 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300026294|Ga0209839_10220681 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300026296|Ga0209235_1117097 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300026300|Ga0209027_1288074 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300026307|Ga0209469_1021075 | All Organisms → cellular organisms → Bacteria | 2286 | Open in IMG/M |
| 3300026310|Ga0209239_1280545 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300026325|Ga0209152_10109229 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300026496|Ga0257157_1053735 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300026498|Ga0257156_1130560 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300026507|Ga0257165_1095762 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300026515|Ga0257158_1002023 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300026530|Ga0209807_1195515 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300026557|Ga0179587_10853344 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300026557|Ga0179587_11091559 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300026557|Ga0179587_11176797 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300027512|Ga0209179_1069176 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300027512|Ga0209179_1130191 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300027565|Ga0209219_1111412 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300027574|Ga0208982_1109277 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300027605|Ga0209329_1130992 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027643|Ga0209076_1002604 | All Organisms → cellular organisms → Bacteria | 3944 | Open in IMG/M |
| 3300027643|Ga0209076_1127584 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300027643|Ga0209076_1139781 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300027655|Ga0209388_1104741 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300027671|Ga0209588_1124606 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300027674|Ga0209118_1151272 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027698|Ga0209446_1146002 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300027738|Ga0208989_10135490 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300027783|Ga0209448_10071873 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300027787|Ga0209074_10035045 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300027795|Ga0209139_10333622 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300027842|Ga0209580_10027275 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300027842|Ga0209580_10330606 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300027853|Ga0209274_10252287 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300027855|Ga0209693_10023787 | All Organisms → cellular organisms → Bacteria | 2963 | Open in IMG/M |
| 3300027862|Ga0209701_10522803 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300027867|Ga0209167_10396112 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300027895|Ga0209624_10383534 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300027908|Ga0209006_10200531 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300027908|Ga0209006_11069825 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300028023|Ga0265357_1000853 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300028047|Ga0209526_10438792 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300028673|Ga0257175_1078004 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300028792|Ga0307504_10160617 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300029636|Ga0222749_10305146 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300029636|Ga0222749_10497270 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300030879|Ga0265765_1012714 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300031057|Ga0170834_106337345 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031231|Ga0170824_114095054 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031474|Ga0170818_107726663 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300031573|Ga0310915_10096075 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300031679|Ga0318561_10737281 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031751|Ga0318494_10082530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1749 | Open in IMG/M |
| 3300031754|Ga0307475_10976944 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300031820|Ga0307473_10792594 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300031823|Ga0307478_10839182 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300031823|Ga0307478_11068867 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031835|Ga0318517_10037116 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300031945|Ga0310913_10546955 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300031962|Ga0307479_10717517 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300031962|Ga0307479_11242297 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031962|Ga0307479_11415440 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032180|Ga0307471_100366170 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300032205|Ga0307472_101519823 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032275|Ga0315270_10826756 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300032892|Ga0335081_10040847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7366 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 37.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.04% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.22% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.82% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.41% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.41% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.41% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.41% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001162 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_117835261 | 3300000789 | Soil | DKDFALGQSYRVNQTPTTVFHSGGQTYPYAGVMSYDTLKQFLNQLLSGH* |
| JGI12714J13572_10094712 | 3300001162 | Forest Soil | LEAAIDKDYALGQTYRVNQTPTTIFHCKGQTYPFSGGMTYDILKTFLEQLLSQK* |
| JGI12635J15846_103615351 | 3300001593 | Forest Soil | QTPTTVFHSKGQTFPYSGVMSYEILRNFLDQLAAQK* |
| JGI12635J15846_104966542 | 3300001593 | Forest Soil | VALGKLYNVNQTPTTVFHSKGQTFPYGGVMSYDILRNFLDQLGKQ* |
| JGI12053J15887_103752731 | 3300001661 | Forest Soil | LYRVNQTPTTVFHSGGQTYPYAGVMSYDTLKSFLDQLLSGH* |
| JGI12053J15887_104498811 | 3300001661 | Forest Soil | RVNQTPTTVFHCKGQTYPYSGIMTYDILKTFLDQLLNQK* |
| JGIcombinedJ26739_1005253812 | 3300002245 | Forest Soil | GGTLNAAIQKDLALGRLYNVNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLGK* |
| JGI25617J43924_101981541 | 3300002914 | Grasslands Soil | LDAAIDKDFALGQTYRVNQTPTTVFHCKGQTYPYSGVMTYDILKTFLEQLLSQK* |
| JGI25616J43925_102932881 | 3300002917 | Grasslands Soil | DYALGQTYRVNQTPTTVFHSKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| JGI25616J43925_102992942 | 3300002917 | Grasslands Soil | DKDSALGQTYRVNQTPTTVFHCKGQTYPYSGVMTYDVLKTFLEQLLSQK* |
| JGI25616J43925_103195671 | 3300002917 | Grasslands Soil | LNAAIQKDVALGRLYNVNQTPTTVFHAKGQTFPYAGVMSYEILRNFLDQLAK* |
| JGI25616J43925_103779152 | 3300002917 | Grasslands Soil | AAIDKDYALGQTYRVNQTPTTVFHSKGQTYPYSGVMTYEILKQFLDQLLSQK* |
| JGIcombinedJ51221_101230913 | 3300003505 | Forest Soil | IEKDVQLGQMYRVNQTPTTVFHIKGQTYPYSGAMNYETLHQFLDQLLSQK* |
| Ga0062389_1048109802 | 3300004092 | Bog Forest Soil | IAKDQALGQGYRVNQTPTTVFHANGQTFPYAGVMNWEILKQFLDQLLSQK* |
| Ga0066672_108305581 | 3300005167 | Soil | PMIDKDYALGQTYRVNQTPTTVFHCKGQTYPYSGVMTYDTLKTFLDQLLSQK* |
| Ga0066680_105275851 | 3300005174 | Soil | DAAIDKDYALGQMYRVNQTPTTVFHCKGQTYPYSGVMSYDILKQFLEQLLSQK* |
| Ga0070709_111032271 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TLKPLIDKDLALGRLYNVSQTPTTVFHAKGQTFPYSGVMSYEILKNFLDQLAK* |
| Ga0066687_106105682 | 3300005454 | Soil | QTYNVNQTPTTVFHSKGQTYPYPGVMTYDILKTFLDQLLSQK* |
| Ga0070732_100045601 | 3300005542 | Surface Soil | PTTVFHSKGQTFPYAGSMNYEIMRNFLDQLAAQK* |
| Ga0066661_105953401 | 3300005554 | Soil | LIDKDYNLGQTYRVNQTPTTVFHCKGQTYPYSGVMTYDILKQFLNQLLSQ* |
| Ga0066692_103919451 | 3300005555 | Soil | VNQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| Ga0066707_108644782 | 3300005556 | Soil | YRVNQTPTTVFHSKGQTFPYAGVMSWDILKQFLDQLLTQK* |
| Ga0066703_104694022 | 3300005568 | Soil | RVNQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| Ga0066705_100969324 | 3300005569 | Soil | GQTYRVNQTPTTVFHSKGQTFPYAGVMSWDILKQFLDQLLTQK* |
| Ga0070761_103579301 | 3300005591 | Soil | PTTVFHSKGQTYPYSGAMNYEILRQFLDQLLSQK* |
| Ga0070766_103109411 | 3300005921 | Soil | AIAKDQALGQGYRVNQTPTTIFHANGQTFPYAGVMNWEILKQFLDQLLSQK* |
| Ga0075015_1000151274 | 3300006102 | Watersheds | TPTTVFHCKGQTYPYSGAMTYDVLKTFLEQLLSQ* |
| Ga0075014_1000287451 | 3300006174 | Watersheds | GQTYRVNQTPTTVFHSKGQTYPYSGVMSYDILKQFLDQLLSQK* |
| Ga0066653_104813631 | 3300006791 | Soil | DYALGQTYRVNQTPTTVFHCKGQIYPYSGVMTYDILKQFLEQLLAQK* |
| Ga0066659_106147201 | 3300006797 | Soil | QTYRVNQTPTTVFHSKGQTFPYAGVMSWDILKQFLDQLLTQK* |
| Ga0066659_110876651 | 3300006797 | Soil | TPTMIFHVKDQTYPYAGPVSYDILRQFLEQLLNQK* |
| Ga0079221_109220081 | 3300006804 | Agricultural Soil | TLIDKDFALGQMYRVNQTPTTVFHCKGQTYPYAGVMTYDTMKQFLEQLLSQK* |
| Ga0079220_104058071 | 3300006806 | Agricultural Soil | QTYRVNQTPTTVFHAKGQTLPYAGVMSWDILKQFLDQLLSQK* |
| Ga0075425_1016400692 | 3300006854 | Populus Rhizosphere | ALGKTYNVNQTPTTVFHYKGQTMPFAGVMTYDTLHNFLDQLLSQK* |
| Ga0079219_118453651 | 3300006954 | Agricultural Soil | IDKDYALGQTYRVNQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| Ga0079219_119978652 | 3300006954 | Agricultural Soil | PTTVFHYKGQTMPFAGVMTYDTLHNFLDQLLSQK* |
| Ga0099791_101292001 | 3300007255 | Vadose Zone Soil | KDFALGQLYRVNQTPTTVFHSGGQTYPYAGVMSYDTLKSFLDQLLSGH* |
| Ga0099791_106398691 | 3300007255 | Vadose Zone Soil | KDFALGQLYRVNQTPTTVFHSGGQTYPYAGVMSYDTLKSFLDQLLSQK* |
| Ga0099793_100203021 | 3300007258 | Vadose Zone Soil | LGQTYRVNQTPTTVFHCKGQTYPYPGVMTYDILKQFLNQLLSQ* |
| Ga0099793_106563931 | 3300007258 | Vadose Zone Soil | AAIDKDYALGQTYSVNQTPTTIFHCKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| Ga0099793_106634961 | 3300007258 | Vadose Zone Soil | LDAAIDKDFALGQMYRVNQTPTTVFHSSGQTYPYAGVMSYDTLKSFLDQLLSGH* |
| Ga0099794_104493151 | 3300007265 | Vadose Zone Soil | PTTVFHCKGQTYPYAGVMSYDILKQFLDQLLAQK* |
| Ga0102924_13749481 | 3300007982 | Iron-Sulfur Acid Spring | LNPLIQKDVALGKLYNLNQTPTTVFHAKGQTFPYAGVMNYDILRNFLDQLGK* |
| Ga0099829_112469442 | 3300009038 | Vadose Zone Soil | QTYRVNQTPTTVFHSKGQTYPYSGVMTYDILKQFLNQLLSQ* |
| Ga0099829_113570112 | 3300009038 | Vadose Zone Soil | QTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLSQ* |
| Ga0099829_115091481 | 3300009038 | Vadose Zone Soil | IQKDVALGRLYNVNQTPTTVFHAKGQTFPYAGVMSYEILRNFLDQLGKS* |
| Ga0099829_116939592 | 3300009038 | Vadose Zone Soil | VNQTPTTIFHCKGQTYPYSGVMTYDILKTFLDQLLSQK* |
| Ga0099829_117257442 | 3300009038 | Vadose Zone Soil | PTTVFHCKGQTYPYSGAMTYDILKTFLEQLLSQK* |
| Ga0099830_100814504 | 3300009088 | Vadose Zone Soil | GQTYRVNQTPTTVFHCKGQTYPYSGAMTYDILKTFLEQLLSQK* |
| Ga0099830_105747201 | 3300009088 | Vadose Zone Soil | TPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLSQ* |
| Ga0099828_116968432 | 3300009089 | Vadose Zone Soil | APNAAIQKDVALGKFYNVNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLGKN* |
| Ga0099827_102054121 | 3300009090 | Vadose Zone Soil | RVNQTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLSQ* |
| Ga0099827_113679252 | 3300009090 | Vadose Zone Soil | FALGQLYRVNQTPTTVFHSGGQTYPYAGVMSYDTLKSFLDQLLSGH* |
| Ga0099792_105247461 | 3300009143 | Vadose Zone Soil | LNVAIQRDVALGKFYNVNQTPTTVFHSKGQTFPYAGVMNYEILRNFLDQLAAQK* |
| Ga0099792_105543631 | 3300009143 | Vadose Zone Soil | LYNVNQTPTSVFHAKGQTFPYAGVMSYEILRNFLDQLAN* |
| Ga0105237_109770831 | 3300009545 | Corn Rhizosphere | ITKDQAIGNNTYRVNQTPTTVFHANGQTFPYAGVMSWDILKQFLDQLLGGK* |
| Ga0126374_111693822 | 3300009792 | Tropical Forest Soil | MHNVNQTPTTEFYAHGQTYPYAGQINYEFLKQFLDQLLAQK* |
| Ga0126373_101477514 | 3300010048 | Tropical Forest Soil | VSQTPTTVFHAHGQTYPYAGSLSYDVLKDFLDQLLKQ* |
| Ga0126373_108708891 | 3300010048 | Tropical Forest Soil | FPVSQTPTTVFHSKGQTYPYAGTLQYDVLKGFLDQLIAQK* |
| Ga0134082_101072954 | 3300010303 | Grasslands Soil | QTYRVNQTPTTVFHCKGQIYPYSGVMTYDILKQFLEQLLAQK* |
| Ga0134067_100421161 | 3300010321 | Grasslands Soil | MYRVSETPTTIFHFQGKTYPVKGIMAYEMMKQFLEQLLSQSRM* |
| Ga0134067_101884422 | 3300010321 | Grasslands Soil | DYALGQTYRVNQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| Ga0126370_107644851 | 3300010358 | Tropical Forest Soil | DFALGQMYRVNQTPTTVFHCKGQTYPYAGVMTYDTMKQFLEQLLSQK* |
| Ga0126370_113283111 | 3300010358 | Tropical Forest Soil | PLIDKDVAQGKLYNVNQTPTTVFHYKGQTYPYAGVMSYDLLKQFLDQLLSQK* |
| Ga0126370_119922131 | 3300010358 | Tropical Forest Soil | QMYRVSQTPTTVFHSRGQTYPYAGVMTYDTMKQFLEQLLSQK* |
| Ga0126378_101206446 | 3300010361 | Tropical Forest Soil | NQTPTTVFHYKGQIMPYPGVMTYDTMKQFLEQLLSQK* |
| Ga0150983_139568341 | 3300011120 | Forest Soil | KDYSIGQMYRVNQTPTTVFHCKGQTYPYSGPMTYDILKTFLNQLLSQ* |
| Ga0150983_146449101 | 3300011120 | Forest Soil | NQTPTTVFHCKGQTYPYPGVMSYEILKQFLDQLLSQR* |
| Ga0137392_100474191 | 3300011269 | Vadose Zone Soil | VNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLGKS* |
| Ga0137392_105538411 | 3300011269 | Vadose Zone Soil | IQKDVALGHFYNVNQTPTTVFHSKGQTFPYAGVMNYEILRNFLDQLAAQK* |
| Ga0137392_105911681 | 3300011269 | Vadose Zone Soil | IDKDYALGQTYRVNQTPTTVFHCKGQTYPYSGIMTYDILKQFLDQLLSQK* |
| Ga0137392_110917981 | 3300011269 | Vadose Zone Soil | KGGTLNAAIQKDLALGRLYNVNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLAK* |
| Ga0137391_109970891 | 3300011270 | Vadose Zone Soil | TPTTVFHCKGQTYPYSGIMTYDILKQFLEQLLSQK* |
| Ga0137391_112163122 | 3300011270 | Vadose Zone Soil | YALGQTYRVNQTPTTVFHSKGQTYPYSGVMTYEILKQFLDQLLSQK* |
| Ga0137393_101411185 | 3300011271 | Vadose Zone Soil | VNQTPTTVFHCKGQTYPYAGLMPYDVLKTFLEQLLSQK* |
| Ga0137393_105228961 | 3300011271 | Vadose Zone Soil | DAAIDKDYALGQTYRVNQTPTTVFHCKGQTYPYSGIMTYDILKQFLDQLLSQK* |
| Ga0137393_108789831 | 3300011271 | Vadose Zone Soil | TPTTIFHCKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| Ga0137389_104052321 | 3300012096 | Vadose Zone Soil | KLYNVNQTPTSVFHAKGQTFPYAGVMSYEILRNFLDQLAK* |
| Ga0137389_118250001 | 3300012096 | Vadose Zone Soil | NAAIQKDVALGKLYNVNQTPTSVFHAKGQTFPYAGVMSYEILRNFLDQLAK* |
| Ga0137388_103937591 | 3300012189 | Vadose Zone Soil | KGGTLNAAIQKDVALGKFYNVNQTPTTVFHAKGQTFPYAGVMSYEILRNFLDQLAAQK* |
| Ga0137388_109433792 | 3300012189 | Vadose Zone Soil | LGQTYRVNQTPTTVFHCKGQTYPYSGAMTYDILKTFLEQLLSQK* |
| Ga0137388_111608501 | 3300012189 | Vadose Zone Soil | GGTLNAAIQKDVALGKFYNVNQTPTTVFHSKGQTFPYSGVMSYEILRNFLDQLAAQK* |
| Ga0137364_100512435 | 3300012198 | Vadose Zone Soil | GQMYRVNQTPTTVFHYKGQTYPYPGVMTYDTVKQFLEQLLSQK* |
| Ga0137364_109850381 | 3300012198 | Vadose Zone Soil | MIDKDYALGQTYNVNQTPTTVFHSKGQTYPYPGVMTYDILKTFLDQLLSQK* |
| Ga0137383_106375561 | 3300012199 | Vadose Zone Soil | QTPTTVFHSKGQTYPYPGVMTYDILKTFLDQLLSQK* |
| Ga0137382_101492141 | 3300012200 | Vadose Zone Soil | PMIDKDYALGQTYNVNQTPTTVFHSKGQTYPYSGVMTYDVLKTFLDQLLSHK* |
| Ga0137363_103184931 | 3300012202 | Vadose Zone Soil | IDKDYALGQMYRVNQTPTTVFHCKGQTYPYPGVMSYDILKQFLDQLLSQR* |
| Ga0137363_106481532 | 3300012202 | Vadose Zone Soil | VNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLGK* |
| Ga0137363_106961253 | 3300012202 | Vadose Zone Soil | VNQTPTTVFHCKGQTYPYSGVMTYDVLKTFLEQLLSQK* |
| Ga0137363_113241462 | 3300012202 | Vadose Zone Soil | GTLDPMIDKDYALGQTYRVNQTPTTIFHCKGQTYPYSGVMTYDILKQFLDQLLSQ* |
| Ga0137399_107538982 | 3300012203 | Vadose Zone Soil | NQTPTSVFHAKGQTFPYAGVMSYEILRNFLDQLAK* |
| Ga0137399_114334752 | 3300012203 | Vadose Zone Soil | AAIDKDFALGQLYRVNQTPTTVFHSGGQTYPYAGVMSYDTLKSFLNQLLGGR* |
| Ga0137399_116846241 | 3300012203 | Vadose Zone Soil | NQTPTTVFHSKGQTYPYSGVMTYEILKQFLDQLLSQK* |
| Ga0137399_116966791 | 3300012203 | Vadose Zone Soil | RVNQTPTTIFHCKGQTYPFSGVMTYDILKQFLDQLLSQK* |
| Ga0137362_105398381 | 3300012205 | Vadose Zone Soil | KDYALGQVYRVNQTPTTVFHCKGQTYPYAGVMSYDILKQFLNQLLSQ* |
| Ga0137362_113431281 | 3300012205 | Vadose Zone Soil | KDYALGQVYRVNQTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLSQ* |
| Ga0137362_116593661 | 3300012205 | Vadose Zone Soil | QTPTTVFHSGGQTYPYAGVMSYDTLKSFLDQLLSQK* |
| Ga0137381_114940722 | 3300012207 | Vadose Zone Soil | RINQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| Ga0137379_115590631 | 3300012209 | Vadose Zone Soil | LGHVYKVNQTPTMIFHVKDQTYPYAGPVTYDILRQFLEQLLSQR* |
| Ga0137377_103391794 | 3300012211 | Vadose Zone Soil | YALGQTYRINQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| Ga0137387_103390493 | 3300012349 | Vadose Zone Soil | AYKVNQTPTMIFHVKDQTYPYAGPVSYDILRQFLEQLLNQK* |
| Ga0137387_104552791 | 3300012349 | Vadose Zone Soil | GQVYRVNQTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLSQ* |
| Ga0137387_111534931 | 3300012349 | Vadose Zone Soil | LIDKDFALGQMYRVNQTPTTVFHCKGQTYPYPGVMTYNTVKQFLEQLLSQK* |
| Ga0137386_102905101 | 3300012351 | Vadose Zone Soil | KDFALGQTYRVNQTPTTVFHCKGQTYPYAGVMSYDMLKQFLDQLLSQ* |
| Ga0137386_107973452 | 3300012351 | Vadose Zone Soil | QTYRINQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| Ga0137386_108590762 | 3300012351 | Vadose Zone Soil | GSLDAAIEKDIALGHVYKVNQTPTMIFHVKDQTYPYAGPVTYDILRQFLEQLLSQR* |
| Ga0137385_106832123 | 3300012359 | Vadose Zone Soil | DKDYALGQTYRVNQTPTTIFHCKGQTFPYSGVMTYDTLKTFLDQLLSQK* |
| Ga0137360_102916604 | 3300012361 | Vadose Zone Soil | GQTYRVNQTPTTVFHCKGQTYPYAGVMSYDMLKQFLDQLLSQ* |
| Ga0137360_105543211 | 3300012361 | Vadose Zone Soil | NQTPTTVFHCKGQTYPYAGVMSYDILKQFLNQLLSQ* |
| Ga0137360_117083371 | 3300012361 | Vadose Zone Soil | IDKDFALGQTYRVNQTPTTVFHCKGQTYPYSGVMTYDVLKTFLEQLLSQK* |
| Ga0137360_118914071 | 3300012361 | Vadose Zone Soil | QTYRVNQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK* |
| Ga0137361_111982261 | 3300012362 | Vadose Zone Soil | NPLIQKDVALGKLYNLNQTPTTVFHAKGQTYPYAGVMNYDILRNFLDQLAK* |
| Ga0137361_115655422 | 3300012362 | Vadose Zone Soil | KDKQAGQVIPVNQTPTTVFRHKGQTYPYAGVMSYDILKGFLDDLLSR* |
| Ga0137390_110510142 | 3300012363 | Vadose Zone Soil | YALGQSYRVNQTPTTIFHSKGQTYPFSGVMTYDILKQFLDQLLSQK* |
| Ga0137390_118119832 | 3300012363 | Vadose Zone Soil | VYRVNQTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLSQ* |
| Ga0137358_104584011 | 3300012582 | Vadose Zone Soil | AIDKDYALGQTYRVNQTPTTIFHCKGQTYPFSGVMTYDILKQFLDQLLSQK* |
| Ga0137398_110207142 | 3300012683 | Vadose Zone Soil | TPTTVFHCKGQTYPYSGVMTYDILKQFLNQLLSQ* |
| Ga0137413_109416171 | 3300012924 | Vadose Zone Soil | VALGKLYNVNQTPTSVFHAKGQTFPYAGVMSYEILRNFLDQLAN* |
| Ga0137419_118105262 | 3300012925 | Vadose Zone Soil | VNQTPTTVFRCKGQTYPYAGVMNYDILKQFLDQLLSQK* |
| Ga0137419_118702581 | 3300012925 | Vadose Zone Soil | IDKDFTLGQLYRVTQTPTTVFHSGGQTYPYAGVMSYDILKQFLDQLLSGH* |
| Ga0137416_113788272 | 3300012927 | Vadose Zone Soil | IDKDKQAGQVIPVNQTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLSQK* |
| Ga0137404_109367831 | 3300012929 | Vadose Zone Soil | VGQTPTTIFHSKGQTYPVAGAMTFEVLKNFIDQLASQK* |
| Ga0137407_108706461 | 3300012930 | Vadose Zone Soil | TLIQKDVALGKLYNLNQTPTSVFHAKGQTFPYAGVMSYEILHNFLDQLAQ* |
| Ga0137407_117677541 | 3300012930 | Vadose Zone Soil | RVNQTPTTVFHCKGQTYPYSGVMTYDILKQFLNQLLSQ* |
| Ga0153915_114019902 | 3300012931 | Freshwater Wetlands | VSQTPTTVFLANGQTYPYGGVMSYDILRQFLNQLLNQK* |
| Ga0164303_107369652 | 3300012957 | Soil | PLIEKDKQAGQMIPVSQTPTTVFHCKGQTYPYAGVMSYDLLKQFLDQLLSQK* |
| Ga0164301_102695153 | 3300012960 | Soil | MYRVSQTPTSVFHSKGQTYPYSGVMSYEILRQFLDQLLSQK* |
| Ga0164301_112817281 | 3300012960 | Soil | GQTYRVNQTPTTVFHSKGQTFPYAGIMSWDILKQFLDQLLSQK* |
| Ga0164304_115399481 | 3300012986 | Soil | GQMYRVNQTPTTVFHSGGQTYPYAGVMSYDTLKSFLNQLLGGR* |
| Ga0164305_120233161 | 3300012989 | Soil | TYHVNQTPTTIFHANGQTFPYAGVMTWDILHQFLDQLLAQK* |
| Ga0157379_111663612 | 3300014968 | Switchgrass Rhizosphere | AGITKDQAIGNNTYRVNQTPTTVFHANGQTFPYAGVMSWDILKQFLDQLLGGK* |
| Ga0167668_10342993 | 3300015193 | Glacier Forefield Soil | DYALGQMYRVNQTPTTVFHSKGQTYPYSGVMSYDILKQFLDQLLSQK* |
| Ga0137418_101973454 | 3300015241 | Vadose Zone Soil | LYNLNQTPTSVFHAKGQTFPYAGVMNYEILRNFLDQLAN* |
| Ga0137418_103626563 | 3300015241 | Vadose Zone Soil | LYNLNQTPTSVFHAKGQTFPYAGVMSYEILHNFLDQLAQ* |
| Ga0137418_106875881 | 3300015241 | Vadose Zone Soil | EPLIDKDKQAGQLIPVNQTPTTVFRCKGQTYPYAGVMSYDILKQFLDQLLAQK* |
| Ga0137412_107278561 | 3300015242 | Vadose Zone Soil | NQTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLAQK* |
| Ga0137409_105159252 | 3300015245 | Vadose Zone Soil | QKDVALGKLYNLNQTPTSVFHAKGQTFPYAGVMSYEILRNFLDQLAQ* |
| Ga0134085_105316982 | 3300015359 | Grasslands Soil | DKDFALGQMYRVNQTPTTVFHCKGQTYPYPGVMTYDTVKQFLEQLLSQK* |
| Ga0187802_103233481 | 3300017822 | Freshwater Sediment | DYELGEVYRVNSTPTSVFHAKGQTYPYAGMMNYEILSQFLNQLLSQK |
| Ga0187778_100228461 | 3300017961 | Tropical Peatland | QGYRVNQTPTTVFHSKGQTYPYAGVMTYATLKQFLDQLLSQS |
| Ga0187874_103878481 | 3300018019 | Peatland | QALGQGYRVNQTPTTIFHANGQTFPYAGVMNWEILKQFLDQLLSQK |
| Ga0193722_10927362 | 3300019877 | Soil | LIPVNQTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLAQK |
| Ga0179592_103133722 | 3300020199 | Vadose Zone Soil | LDPLIDKDYALGQTYNVNQTPTTVFHCKGQTYPYSGIMTYDILKQFLEQLLSQK |
| Ga0210407_102169961 | 3300020579 | Soil | MYRVNQTPTTVFHSKGQTYPYSSAMSYEILHQFLDQLLSQK |
| Ga0210407_102760392 | 3300020579 | Soil | GGTLNAAIQKDVALGRFYNVNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLGK |
| Ga0210407_107791962 | 3300020579 | Soil | VKSGALNAAIQKDVALGKFYNVNQTPTTVFHAKGQTFPYGGVMNYEILRNFLDQLGKS |
| Ga0210407_108510802 | 3300020579 | Soil | PLINKDVQLGQMYRVNQTPTTVFHSKGQTYPYSSAMSYEILRQFLDQLLSQK |
| Ga0210407_113799672 | 3300020579 | Soil | NVTQTPTTVFHSKGQTYPYGGAMSFDTLKQFLDQLLSQK |
| Ga0210399_105887781 | 3300020581 | Soil | NVNQTPTTVFHAKGQTFPYAGVMNYEILRNFLDQLAK |
| Ga0210395_114374162 | 3300020582 | Soil | LDAGIDKDSALGQLYRVSQTPTTVFHSKGQTYPFAGVMTYDMLKQFLDQLLSQK |
| Ga0210401_102373714 | 3300020583 | Soil | GYRVNQTPTTIFHANGQTFPYAGVMNWEILKQFLDQLLSQK |
| Ga0215015_100895171 | 3300021046 | Soil | DFALGQTYRVNQTPTTVFHCKGQTYPYPGVISYEILKQFLDQLLSQR |
| Ga0215015_103985582 | 3300021046 | Soil | NVNQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK |
| Ga0215015_105235841 | 3300021046 | Soil | IDKDYALGQMYRVNQTPTTVFHCKGQTYPYPGVMSYDILKQFLDQLLSQR |
| Ga0215015_107092181 | 3300021046 | Soil | IQKDVALGKFYNVNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLAAQK |
| Ga0210406_105025273 | 3300021168 | Soil | FPVTQTPTTVFHSKGQTYPYAGTLSYDVLKDFLDQLVAQK |
| Ga0210406_109374452 | 3300021168 | Soil | DQALGQTYRVNQTPTTIFHANGQTFPYAGVMNWEILKQFLDQLLSQK |
| Ga0210406_111284821 | 3300021168 | Soil | NQTPTSIFHTKGQIYPVAGIISYDVLKQFLDQLLSQK |
| Ga0210400_104827903 | 3300021170 | Soil | YRVNQTPTTVFHSKGQTYPYSSAMSYEILHQFLDQLLSQK |
| Ga0210400_106310133 | 3300021170 | Soil | TQTPTTVFYAHGQTYPYAGQINYEFLKQFLDQLLAQK |
| Ga0210400_111682932 | 3300021170 | Soil | KLYNLNQTPTTVFHAKGQTYPYAGVMNYDILRNFLDQLAK |
| Ga0210408_101817651 | 3300021178 | Soil | TPTTVFYAHGQTYPYAGQINYEFLKQFLDQLLAQK |
| Ga0210408_108883061 | 3300021178 | Soil | LGKFYNVNQTPTTVFHAKGQTFPYGGVMNYEILRNFLDQLGKS |
| Ga0210396_112114232 | 3300021180 | Soil | IEKDLQLGQMYRVNQTPTTVFHSKGQTYPYSGAMNYDTLRQFLDQLLSQK |
| Ga0210385_113338691 | 3300021402 | Soil | TPTTVFHTKGQTYPYSGAMNYDTLHQFLDQLLGQK |
| Ga0210387_107212551 | 3300021405 | Soil | LGQMYRVNQTPTSVFHSKGQTYPYSGAMSYEILHQFLDQLLSQK |
| Ga0210394_108434011 | 3300021420 | Soil | VTQTPTTVFYAHGQTYPYAGQINYEFLKQFLDQLLAQK |
| Ga0210384_101358084 | 3300021432 | Soil | VALGKLYNVNQTPTTVFHSKGQTFPYGGVMSYDILRNFLDQLAKQ |
| Ga0210384_118756152 | 3300021432 | Soil | VTQTPTSVFHSKGQPYPYAGTLSYDVLKDFLDQLLAQK |
| Ga0210392_102654451 | 3300021475 | Soil | QTPTTIFHANGQTLPYAGVMNWDILKQFLDQLLAGK |
| Ga0210392_104806911 | 3300021475 | Soil | KDVQLGQMYRVSQTPTTVFHSKGQTYPYSSAMSYDILHQFLDQLLSQK |
| Ga0210398_108149391 | 3300021477 | Soil | DAAIAKDQALGQGYRVNQTPTTIFHANGQTFPYAGVMNWEILKQFLDQLLSQK |
| Ga0210402_101108221 | 3300021478 | Soil | YRVNQTPTTIFHANGQTFPYAGVMNWEILKQFLDQLLSQK |
| Ga0210409_101340494 | 3300021559 | Soil | LDPLIDKDYALGQTYNVNQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK |
| Ga0210409_105042701 | 3300021559 | Soil | KDYVLGQTYSVNQTPTTVFHCKGQTYPYSGLMPYDVLKQFLDQLLSQK |
| Ga0222728_10133211 | 3300022508 | Soil | TPTTVFHSKGQTYPYSSAMSYEILRQFLDQLLSQK |
| Ga0242660_11687921 | 3300022531 | Soil | LARMHNVTQTPTTVFYAHGQTYPYAGQINYEFLKQFLDQLLAQK |
| Ga0247694_10286661 | 3300024178 | Soil | MYRVSQTPTSVFHSKGQTYPYSGVMSYEILRQFLDQLLSQK |
| Ga0247695_10022385 | 3300024179 | Soil | QTPTSVFHSKGQTYPFAGTLSYDVLKDFLDQLIAQK |
| Ga0137417_13341853 | 3300024330 | Vadose Zone Soil | VNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLGKS |
| Ga0209839_102206811 | 3300026294 | Soil | AIAKDQALGNTYRVNQTPTTIFHSNGQTFPYAGVMNWEILKQFLDQLLTQK |
| Ga0209235_11170971 | 3300026296 | Grasslands Soil | DAAIDKDFALGQLYRVNQTPTTVFHSGGQTYPYAGVMSYDTLKSFLDQLLSGH |
| Ga0209027_12880741 | 3300026300 | Grasslands Soil | QTPTTVFHSKGQTYPFPGIMTYDILKQFLDQLLSQK |
| Ga0209469_10210751 | 3300026307 | Soil | PTTIFHFQGKTYPVKGIMAYEMMKQFLEQLLSQSRM |
| Ga0209239_12805451 | 3300026310 | Grasslands Soil | RVNQTPTTVFHCKGKTYPYAGMMTYDTMRQFLEQLLSEK |
| Ga0209152_101092291 | 3300026325 | Soil | GQTYRVNQTPTTIFHCKGQTFPYSGVMTYDTLKTFLDQLLSQK |
| Ga0257157_10537351 | 3300026496 | Soil | AIDKDYALGQTYRVNQTPTTIFHCKGQTYPFSGVMTYDILKQFLDQLLSQK |
| Ga0257156_11305601 | 3300026498 | Soil | IQKDVALGKLYNVNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLGK |
| Ga0257165_10957622 | 3300026507 | Soil | QTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLAQK |
| Ga0257158_10020231 | 3300026515 | Soil | KDYALGQTYNVNQTPTTVFHCKGQTYPYSGIMTYDILKQFLDQLLSQK |
| Ga0209807_11955151 | 3300026530 | Soil | QTYRVNQTPTTVFHSKGQTFPYAGVMSWDILKQFLDQLLTQK |
| Ga0179587_108533441 | 3300026557 | Vadose Zone Soil | NQTPTSVFHAKGQTFPYAGVMSYEILRNFLDQLAK |
| Ga0179587_110915592 | 3300026557 | Vadose Zone Soil | LIDKDKQAGQLVPVNQTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLAQK |
| Ga0179587_111767971 | 3300026557 | Vadose Zone Soil | QTYRVNQTPTTIFHCKGQTYPFSGVMTYDILKQFLDQLLSQK |
| Ga0209179_10691761 | 3300027512 | Vadose Zone Soil | ALGKLYNVNQTPTSVFHAKGQTFPYAGVMSYEILRNFLDQLAQ |
| Ga0209179_11301912 | 3300027512 | Vadose Zone Soil | GQTYRVNQTPTTVFHCKGQTYPYAGVMTYDILKQFLNQLLSQ |
| Ga0209219_11114121 | 3300027565 | Forest Soil | DVALGKLYNVNQTPTTVFHSKGQTFPYGGVMSYDILRNFLDQLGKQ |
| Ga0208982_11092772 | 3300027574 | Forest Soil | AKDQALGNTTYRVSQTPTTIFHANGQTYPYAGVMSWDILKQFLDQLLGGK |
| Ga0209329_11309921 | 3300027605 | Forest Soil | LNAAIQKDLALGKLYNVNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLGK |
| Ga0209076_10026041 | 3300027643 | Vadose Zone Soil | YALGQTYRVNQTPTTIFHCKGQTYPFSGVMTYDILKQFLDQLLSQK |
| Ga0209076_11275842 | 3300027643 | Vadose Zone Soil | IQKDVALGRLYNVNQTPTTVFHAKGQTFPYAGVMSYEILRNFLDQLAK |
| Ga0209076_11397812 | 3300027643 | Vadose Zone Soil | SMINKDFALGQTYRVSQTPTTVFHCKGQTYPYSGVMTYDILKTFLEQLLSQK |
| Ga0209388_11047412 | 3300027655 | Vadose Zone Soil | LYNVNQTPTTVFHAKGQTFPYAGVMSYEILRNFLDQLAK |
| Ga0209588_11246061 | 3300027671 | Vadose Zone Soil | KDYALGQTYRVNQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK |
| Ga0209118_11512721 | 3300027674 | Forest Soil | NAAIQKDLALGRLYNVNQTPTTVFHAKGQTFPYAGVMSYDILRNFLDQLGKS |
| Ga0209446_11460022 | 3300027698 | Bog Forest Soil | YRVNSTPTTVFHSKGQTYPYSGAMNYDILKQFLDQLLSQK |
| Ga0208989_101354902 | 3300027738 | Forest Soil | KGGTLTPLIQKDVALGKLYNVNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLSK |
| Ga0209448_100718731 | 3300027783 | Bog Forest Soil | LIDKDYALGQMYRVASTPTSVFHSKGQTYPYSGVMPYETLHQFLDQLLSQK |
| Ga0209074_100350453 | 3300027787 | Agricultural Soil | MYRVNQTPTTVFHCKGQTYPYAGVMTYETMKQFLEQLLSQK |
| Ga0209139_103336221 | 3300027795 | Bog Forest Soil | YRVNQTPTTVFHSKGQTYPYSGAMGYETLHQFLDQLLSQK |
| Ga0209580_100272754 | 3300027842 | Surface Soil | QTPTTVFHSKGQTFPYAGSMNYEIMRNFLDQLAAQK |
| Ga0209580_103306062 | 3300027842 | Surface Soil | DYALGQGYHVNQTPTSIFHTKGQIYPVAGIISYDVLKQFLDQLLSQK |
| Ga0209274_102522873 | 3300027853 | Soil | TPTTVFHSKGQTYPYSGAMNYEILRQFLDQLLSQK |
| Ga0209693_100237871 | 3300027855 | Soil | LETLIEKDVQLGQMYRVNQTPTTVFHSKGQTYPYSGAMNYETLHQFLDQLLSQK |
| Ga0209701_105228032 | 3300027862 | Vadose Zone Soil | GQTYNVNQTPTTVFHSKGQTYPYSGVMTYDILKTFLDQLLSQK |
| Ga0209167_103961121 | 3300027867 | Surface Soil | PINQTPTTVFHSKGQTYPYVGVMSYDVLKQFLDQLLSQK |
| Ga0209624_103835341 | 3300027895 | Forest Soil | LGNTTYRVSQTPTTIFHANGQTFPYAGVMSWDILKQFLDQLLGGK |
| Ga0209006_102005314 | 3300027908 | Forest Soil | KDVQLGQMYRVNQTPTTVFHSKGQTYPYSSAMSYEILRQFLDQLLSQK |
| Ga0209006_110698251 | 3300027908 | Forest Soil | KDQALGNNTYRVNQTPTTIFHANGQTFPYAGVMSWDILKQFLDQLLGGK |
| Ga0265357_10008531 | 3300028023 | Rhizosphere | MYRVNQTPTSVFHSKGQTYPYSGAMNYETLRQFLDQLLSQK |
| Ga0209526_104387921 | 3300028047 | Forest Soil | TPTTVFHSKGQTYPYSNVMSYDILHQFLDQLLSQK |
| Ga0257175_10780041 | 3300028673 | Soil | QMYRVNQTPTTVFHSGGQTYPYAGVMSYDTLKSFLDQLLSGH |
| Ga0307504_101606171 | 3300028792 | Soil | NVNQTPTTVFHAKGQTFPYAGVMNYEILRNFLDQLGK |
| Ga0222749_103051462 | 3300029636 | Soil | QTYRVNQTPTTIFHCKGQTYPFSGGMTYDILKTFLEQLLSQK |
| Ga0222749_104972702 | 3300029636 | Soil | NQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLGK |
| Ga0265765_10127141 | 3300030879 | Soil | QTPTSVFHSKGQTYPYSGAMNYETLRQFLDQLLSQK |
| Ga0170834_1063373452 | 3300031057 | Forest Soil | NNTYRVNQTPTTVFHANGQTFPYAGVMSWDILKPFLDQLLGGK |
| Ga0170824_1140950542 | 3300031231 | Forest Soil | GQMYRVSQTPTTVFHSKGQTYPYSSAMSYDILHQFLDQLLSQK |
| Ga0170818_1077266632 | 3300031474 | Forest Soil | DKDKQAGQLIPVNQTPTTVFHCKGQTYPYAGVMSYDILKQFLDQLLAQK |
| Ga0310915_100960754 | 3300031573 | Soil | LDALIDKDFALGQTYRVSQTPTTIFHCKGQTYPYAGVMTYDTMKQFLEQLLSQK |
| Ga0318561_107372812 | 3300031679 | Soil | DFALGQTYRVSQTPTTIFHCKGQTYPYAGVMTYDTMKQFLEQLLSQK |
| Ga0318494_100825301 | 3300031751 | Soil | SLDALIDKDFALGQTYRVSQTPTTIFHCKGQTYPYAGVMTYDTMKQFLEQLLSQK |
| Ga0307475_109769442 | 3300031754 | Hardwood Forest Soil | EALIDKDYALGQTYNVNQTPTTVFHSKGQTYPYSGVMTYDILKQFLDQLLSQK |
| Ga0307473_107925942 | 3300031820 | Hardwood Forest Soil | YNVNQTPTTVFHCKGQTYPYSGVMTYDILKQFLDQLLSQK |
| Ga0307478_108391822 | 3300031823 | Hardwood Forest Soil | VNQTPTTVFHSKGQTFPYGGVMSYDILRNFLDQLAKQ |
| Ga0307478_110688671 | 3300031823 | Hardwood Forest Soil | RLYNVNQTPTTVFHAKGQTFPYAGVMSYDILRNFLDQLGKS |
| Ga0318517_100371161 | 3300031835 | Soil | QTYRVSQTPTTIFHCKGQTYPYAGVMTYDTMKQFLEQLLSQK |
| Ga0310913_105469553 | 3300031945 | Soil | SQTPTTVFHANGQTYPYAGTLNYDVLKEFLDQLVAKK |
| Ga0307479_107175173 | 3300031962 | Hardwood Forest Soil | TPTTVFHCKGQTYPYSGIMTYDILKQFLDQLLSQK |
| Ga0307479_112422972 | 3300031962 | Hardwood Forest Soil | GQTYRVNQTPTTIFHCKGQTLPYSGVMTYDTLKTFLDQLLSQK |
| Ga0307479_114154401 | 3300031962 | Hardwood Forest Soil | KQAGQLIPVNQTPTTVFRHKGQTYPYAGVMSYDILKGFLDDLLSR |
| Ga0307471_1003661703 | 3300032180 | Hardwood Forest Soil | DVALGRFYNVNQTPTTVFHAKGQTFPYSGVMSYEILRNFLDQLGK |
| Ga0307472_1015198231 | 3300032205 | Hardwood Forest Soil | DNQTPTTVFHAKGQTFPYAGVMSYEILRNFLDQLGKS |
| Ga0315270_108267561 | 3300032275 | Sediment | FNVSQTPTTIFHSKGQTFPYGGQVNYDILRQFLDQLIGQ |
| Ga0335081_100408471 | 3300032892 | Soil | QSYRVNQTPTTVFHCKGQTYPYSGAMSYDILKQFLEQLLSQK |
| ⦗Top⦘ |