


| Basic Information | |
|---|---|
| Family ID | F016668 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 245 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQSDVHS |
| Number of Associated Samples | 158 |
| Number of Associated Scaffolds | 245 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 80.41 % |
| % of genes near scaffold ends (potentially truncated) | 28.57 % |
| % of genes from short scaffolds (< 2000 bps) | 61.63 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (44.082 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine (13.469 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.653 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 21.43% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 245 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 39.18 |
| PF02511 | Thy1 | 11.02 |
| PF01612 | DNA_pol_A_exo1 | 6.53 |
| PF03796 | DnaB_C | 5.71 |
| PF13481 | AAA_25 | 4.08 |
| PF00476 | DNA_pol_A | 3.67 |
| PF13155 | Toprim_2 | 3.27 |
| PF00589 | Phage_integrase | 2.86 |
| PF14090 | HTH_39 | 1.22 |
| PF05367 | Phage_endo_I | 1.22 |
| PF00145 | DNA_methylase | 0.82 |
| PF06568 | DUF1127 | 0.82 |
| PF00462 | Glutaredoxin | 0.82 |
| PF13662 | Toprim_4 | 0.41 |
| PF02945 | Endonuclease_7 | 0.41 |
| PF03819 | MazG | 0.41 |
| PF16778 | Phage_tail_APC | 0.41 |
| PF05658 | YadA_head | 0.41 |
| PF02867 | Ribonuc_red_lgC | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 245 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 11.02 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 5.71 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 5.71 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 3.67 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.82 |
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.82 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.39 % |
| Unclassified | root | N/A | 30.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10010934 | Not Available | 5830 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10017032 | All Organisms → Viruses → Predicted Viral | 4379 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10051274 | All Organisms → Viruses → Predicted Viral | 2059 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10080088 | All Organisms → Viruses → Predicted Viral | 1452 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10119995 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10002236 | Not Available | 12377 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10033348 | All Organisms → Viruses → Predicted Viral | 2244 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10203876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 549 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10009258 | Not Available | 5187 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10268156 | Not Available | 512 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10000053 | Not Available | 54746 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10002989 | Not Available | 10634 | Open in IMG/M |
| 3300000928|OpTDRAFT_10000047 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 10261 | Open in IMG/M |
| 3300000928|OpTDRAFT_10011395 | All Organisms → Viruses → Predicted Viral | 3625 | Open in IMG/M |
| 3300000928|OpTDRAFT_10067300 | All Organisms → Viruses → Predicted Viral | 1167 | Open in IMG/M |
| 3300000929|NpDRAFT_10034407 | All Organisms → Viruses → Predicted Viral | 1768 | Open in IMG/M |
| 3300000929|NpDRAFT_10407133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 603 | Open in IMG/M |
| 3300000930|BpDRAFT_10170739 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300000930|BpDRAFT_10170740 | All Organisms → Viruses → Predicted Viral | 1450 | Open in IMG/M |
| 3300000947|BBAY92_10004153 | All Organisms → Viruses → Predicted Viral | 3764 | Open in IMG/M |
| 3300000947|BBAY92_10018578 | All Organisms → Viruses → Predicted Viral | 1883 | Open in IMG/M |
| 3300001948|GOS2228_1043344 | All Organisms → Viruses → Predicted Viral | 1420 | Open in IMG/M |
| 3300003216|JGI26079J46598_1007037 | All Organisms → Viruses → Predicted Viral | 3663 | Open in IMG/M |
| 3300003216|JGI26079J46598_1009389 | All Organisms → Viruses → Predicted Viral | 3000 | Open in IMG/M |
| 3300003346|JGI26081J50195_1002388 | Not Available | 6641 | Open in IMG/M |
| 3300003410|JGI26086J50260_1043265 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| 3300003580|JGI26260J51721_1012299 | All Organisms → Viruses → Predicted Viral | 2137 | Open in IMG/M |
| 3300003580|JGI26260J51721_1029264 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300004097|Ga0055584_102470092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 525 | Open in IMG/M |
| 3300004279|Ga0066605_10072934 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300004448|Ga0065861_1015794 | All Organisms → Viruses → Predicted Viral | 2055 | Open in IMG/M |
| 3300004448|Ga0065861_1020170 | All Organisms → Viruses → Predicted Viral | 4644 | Open in IMG/M |
| 3300004448|Ga0065861_1042676 | All Organisms → Viruses → Predicted Viral | 4011 | Open in IMG/M |
| 3300004457|Ga0066224_1042178 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
| 3300004460|Ga0066222_1051559 | All Organisms → Viruses → Predicted Viral | 2335 | Open in IMG/M |
| 3300005748|Ga0076925_1053144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 988 | Open in IMG/M |
| 3300005837|Ga0078893_11892269 | All Organisms → Viruses → Predicted Viral | 3959 | Open in IMG/M |
| 3300005837|Ga0078893_11954980 | All Organisms → Viruses → Predicted Viral | 1260 | Open in IMG/M |
| 3300005941|Ga0070743_10000158 | Not Available | 24885 | Open in IMG/M |
| 3300006027|Ga0075462_10032932 | All Organisms → Viruses → Predicted Viral | 1664 | Open in IMG/M |
| 3300006029|Ga0075466_1053423 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
| 3300006399|Ga0075495_1556450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 557 | Open in IMG/M |
| 3300006484|Ga0070744_10002006 | Not Available | 6151 | Open in IMG/M |
| 3300006752|Ga0098048_1000281 | Not Available | 25951 | Open in IMG/M |
| 3300006752|Ga0098048_1000341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 23490 | Open in IMG/M |
| 3300006752|Ga0098048_1001761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 9313 | Open in IMG/M |
| 3300006752|Ga0098048_1003224 | All Organisms → Viruses | 6680 | Open in IMG/M |
| 3300006752|Ga0098048_1009016 | All Organisms → Viruses → Predicted Viral | 3611 | Open in IMG/M |
| 3300006752|Ga0098048_1023016 | All Organisms → Viruses → Predicted Viral | 2076 | Open in IMG/M |
| 3300006752|Ga0098048_1032655 | All Organisms → Viruses → Predicted Viral | 1690 | Open in IMG/M |
| 3300006752|Ga0098048_1124799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 772 | Open in IMG/M |
| 3300006752|Ga0098048_1151028 | Not Available | 692 | Open in IMG/M |
| 3300006752|Ga0098048_1262708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Veravirus → Roseobacter phage CRP-4 | 503 | Open in IMG/M |
| 3300006789|Ga0098054_1042905 | All Organisms → Viruses → Predicted Viral | 1747 | Open in IMG/M |
| 3300006789|Ga0098054_1101672 | Not Available | 1076 | Open in IMG/M |
| 3300006803|Ga0075467_10544659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 595 | Open in IMG/M |
| 3300006810|Ga0070754_10006294 | Not Available | 7889 | Open in IMG/M |
| 3300006810|Ga0070754_10136717 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300006870|Ga0075479_10304445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 625 | Open in IMG/M |
| 3300006916|Ga0070750_10118692 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300006916|Ga0070750_10228926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 813 | Open in IMG/M |
| 3300006916|Ga0070750_10379862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 592 | Open in IMG/M |
| 3300006920|Ga0070748_1006083 | Not Available | 5366 | Open in IMG/M |
| 3300006925|Ga0098050_1002516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus → Celeribacter virus P12053L → Celeribacter phage P12053L | 6115 | Open in IMG/M |
| 3300006990|Ga0098046_1048647 | Not Available | 995 | Open in IMG/M |
| 3300006990|Ga0098046_1122809 | Not Available | 567 | Open in IMG/M |
| 3300007276|Ga0070747_1126670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Veravirus → Roseobacter phage CRP-4 | 928 | Open in IMG/M |
| 3300007276|Ga0070747_1281856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 573 | Open in IMG/M |
| 3300007344|Ga0070745_1141711 | Not Available | 915 | Open in IMG/M |
| 3300007344|Ga0070745_1337205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 531 | Open in IMG/M |
| 3300007345|Ga0070752_1281332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 638 | Open in IMG/M |
| 3300007346|Ga0070753_1367277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 505 | Open in IMG/M |
| 3300007540|Ga0099847_1053884 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300007557|Ga0102821_1172085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 551 | Open in IMG/M |
| 3300007864|Ga0105749_1153386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 542 | Open in IMG/M |
| 3300008012|Ga0075480_10624502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 508 | Open in IMG/M |
| 3300009000|Ga0102960_1121212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 947 | Open in IMG/M |
| 3300009001|Ga0102963_1047928 | All Organisms → Viruses → Predicted Viral | 1769 | Open in IMG/M |
| 3300009024|Ga0102811_1334215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 569 | Open in IMG/M |
| 3300009050|Ga0102909_1020659 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
| 3300009071|Ga0115566_10821079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 511 | Open in IMG/M |
| 3300009074|Ga0115549_1024206 | All Organisms → Viruses → Predicted Viral | 2365 | Open in IMG/M |
| 3300009076|Ga0115550_1009543 | Not Available | 5304 | Open in IMG/M |
| 3300009076|Ga0115550_1155734 | Not Available | 795 | Open in IMG/M |
| 3300009076|Ga0115550_1280459 | Not Available | 539 | Open in IMG/M |
| 3300009079|Ga0102814_10052952 | All Organisms → Viruses → Predicted Viral | 2250 | Open in IMG/M |
| 3300009086|Ga0102812_10060999 | All Organisms → Viruses → Predicted Viral | 2090 | Open in IMG/M |
| 3300009086|Ga0102812_10352225 | Not Available | 801 | Open in IMG/M |
| 3300009434|Ga0115562_1280628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 574 | Open in IMG/M |
| 3300009435|Ga0115546_1206155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 679 | Open in IMG/M |
| 3300009442|Ga0115563_1136234 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300009447|Ga0115560_1096998 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
| 3300009447|Ga0115560_1149206 | Not Available | 929 | Open in IMG/M |
| 3300009449|Ga0115558_1192880 | Not Available | 843 | Open in IMG/M |
| 3300009467|Ga0115565_10189264 | Not Available | 951 | Open in IMG/M |
| 3300009495|Ga0115571_1409567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 527 | Open in IMG/M |
| 3300009495|Ga0115571_1445069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 500 | Open in IMG/M |
| 3300009496|Ga0115570_10368681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 613 | Open in IMG/M |
| 3300009497|Ga0115569_10029043 | All Organisms → Viruses → Predicted Viral | 3276 | Open in IMG/M |
| 3300009507|Ga0115572_10324822 | Not Available | 869 | Open in IMG/M |
| 3300009507|Ga0115572_10374615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 799 | Open in IMG/M |
| 3300009507|Ga0115572_10766244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 521 | Open in IMG/M |
| 3300009507|Ga0115572_10795702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 508 | Open in IMG/M |
| 3300010296|Ga0129348_1007029 | All Organisms → Viruses → Predicted Viral | 4106 | Open in IMG/M |
| 3300010389|Ga0136549_10468479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 504 | Open in IMG/M |
| 3300011253|Ga0151671_1002733 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300013010|Ga0129327_10078106 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
| 3300013010|Ga0129327_10900561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 508 | Open in IMG/M |
| 3300016724|Ga0182048_1146810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 725 | Open in IMG/M |
| 3300016737|Ga0182047_1552500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 651 | Open in IMG/M |
| 3300017697|Ga0180120_10382754 | Not Available | 554 | Open in IMG/M |
| 3300017708|Ga0181369_1034039 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
| 3300017709|Ga0181387_1045639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Veravirus → Roseobacter phage CRP-4 | 869 | Open in IMG/M |
| 3300017719|Ga0181390_1028675 | All Organisms → Viruses → Predicted Viral | 1759 | Open in IMG/M |
| 3300017742|Ga0181399_1014081 | All Organisms → Viruses → Predicted Viral | 2290 | Open in IMG/M |
| 3300017753|Ga0181407_1161123 | Not Available | 551 | Open in IMG/M |
| 3300017762|Ga0181422_1169986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 664 | Open in IMG/M |
| 3300017764|Ga0181385_1053860 | Not Available | 1251 | Open in IMG/M |
| 3300017769|Ga0187221_1006497 | All Organisms → Viruses → Predicted Viral | 4731 | Open in IMG/M |
| 3300017783|Ga0181379_1001230 | Not Available | 12146 | Open in IMG/M |
| 3300017783|Ga0181379_1029912 | All Organisms → Viruses → Predicted Viral | 2163 | Open in IMG/M |
| 3300017786|Ga0181424_10011105 | All Organisms → Viruses → Predicted Viral | 3896 | Open in IMG/M |
| 3300017786|Ga0181424_10322903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 638 | Open in IMG/M |
| 3300017824|Ga0181552_10004973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9193 | Open in IMG/M |
| 3300017824|Ga0181552_10142907 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300018041|Ga0181601_10100035 | All Organisms → Viruses → Predicted Viral | 1877 | Open in IMG/M |
| 3300018048|Ga0181606_10580459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 578 | Open in IMG/M |
| 3300019077|Ga0188868_1002399 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 554 | Open in IMG/M |
| 3300020053|Ga0181595_10097011 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300020165|Ga0206125_10298365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 603 | Open in IMG/M |
| 3300020165|Ga0206125_10305104 | Not Available | 595 | Open in IMG/M |
| 3300020166|Ga0206128_1001998 | Not Available | 19005 | Open in IMG/M |
| 3300020166|Ga0206128_1089526 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
| 3300020169|Ga0206127_1155360 | Not Available | 879 | Open in IMG/M |
| 3300020182|Ga0206129_10012522 | Not Available | 7463 | Open in IMG/M |
| 3300020182|Ga0206129_10069192 | All Organisms → Viruses → Predicted Viral | 2040 | Open in IMG/M |
| 3300020185|Ga0206131_10154944 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
| 3300020185|Ga0206131_10163757 | All Organisms → Viruses → Predicted Viral | 1145 | Open in IMG/M |
| 3300020187|Ga0206130_10189410 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300020191|Ga0181604_10357139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-13 | 644 | Open in IMG/M |
| 3300020347|Ga0211504_1001463 | Not Available | 10604 | Open in IMG/M |
| 3300020347|Ga0211504_1003293 | Not Available | 6197 | Open in IMG/M |
| 3300020347|Ga0211504_1006197 | All Organisms → Viruses → Predicted Viral | 4013 | Open in IMG/M |
| 3300020347|Ga0211504_1097308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 664 | Open in IMG/M |
| 3300020385|Ga0211677_10084078 | All Organisms → Viruses → Predicted Viral | 1409 | Open in IMG/M |
| 3300020438|Ga0211576_10025510 | All Organisms → Viruses → Predicted Viral | 3538 | Open in IMG/M |
| 3300020595|Ga0206126_10022396 | All Organisms → Viruses → Predicted Viral | 4122 | Open in IMG/M |
| 3300021085|Ga0206677_10011391 | All Organisms → Viruses | 6074 | Open in IMG/M |
| 3300021085|Ga0206677_10013419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 5412 | Open in IMG/M |
| 3300021085|Ga0206677_10013837 | Not Available | 5294 | Open in IMG/M |
| 3300021085|Ga0206677_10366882 | Not Available | 554 | Open in IMG/M |
| 3300021347|Ga0213862_10004199 | Not Available | 5876 | Open in IMG/M |
| 3300021371|Ga0213863_10000743 | Not Available | 24247 | Open in IMG/M |
| 3300021375|Ga0213869_10346331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 621 | Open in IMG/M |
| 3300021378|Ga0213861_10055084 | All Organisms → Viruses → Predicted Viral | 2532 | Open in IMG/M |
| 3300021957|Ga0222717_10000654 | Not Available | 29497 | Open in IMG/M |
| 3300021957|Ga0222717_10010753 | Not Available | 6353 | Open in IMG/M |
| 3300021957|Ga0222717_10039718 | All Organisms → Viruses → Predicted Viral | 3086 | Open in IMG/M |
| 3300021957|Ga0222717_10078663 | All Organisms → Viruses → Predicted Viral | 2089 | Open in IMG/M |
| 3300021957|Ga0222717_10404463 | Not Available | 754 | Open in IMG/M |
| 3300021958|Ga0222718_10020260 | All Organisms → Viruses → Predicted Viral | 4637 | Open in IMG/M |
| 3300021959|Ga0222716_10305483 | Not Available | 959 | Open in IMG/M |
| 3300021960|Ga0222715_10113174 | All Organisms → Viruses → Predicted Viral | 1735 | Open in IMG/M |
| 3300021960|Ga0222715_10119698 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
| 3300021960|Ga0222715_10351039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 821 | Open in IMG/M |
| 3300021964|Ga0222719_10489025 | Not Available | 742 | Open in IMG/M |
| 3300022068|Ga0212021_1010948 | All Organisms → Viruses → Predicted Viral | 1546 | Open in IMG/M |
| 3300022178|Ga0196887_1033911 | All Organisms → Viruses → Predicted Viral | 1400 | Open in IMG/M |
| 3300022187|Ga0196899_1000951 | Not Available | 14648 | Open in IMG/M |
| 3300022218|Ga0224502_10027517 | All Organisms → Viruses → Predicted Viral | 2113 | Open in IMG/M |
| 3300022223|Ga0224501_10246996 | Not Available | 947 | Open in IMG/M |
| 3300022923|Ga0255783_10313472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 630 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10018881 | Not Available | 5088 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10121669 | All Organisms → Viruses → Predicted Viral | 1423 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10331228 | Not Available | 691 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10361816 | Not Available | 646 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10032540 | All Organisms → Viruses → Predicted Viral | 1522 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10124715 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10147441 | Not Available | 964 | Open in IMG/M |
| 3300024192|Ga0228637_1113868 | Not Available | 535 | Open in IMG/M |
| 3300024228|Ga0228633_1149913 | Not Available | 518 | Open in IMG/M |
| 3300024229|Ga0233402_1031469 | All Organisms → Viruses → Predicted Viral | 1145 | Open in IMG/M |
| 3300024229|Ga0233402_1058884 | Not Available | 811 | Open in IMG/M |
| 3300024236|Ga0228655_1026942 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
| 3300024247|Ga0228675_1097124 | Not Available | 547 | Open in IMG/M |
| 3300024294|Ga0228664_1055444 | Not Available | 950 | Open in IMG/M |
| 3300024346|Ga0244775_10002616 | Not Available | 19416 | Open in IMG/M |
| 3300024346|Ga0244775_10013338 | Not Available | 7703 | Open in IMG/M |
| 3300024346|Ga0244775_10744621 | Not Available | 787 | Open in IMG/M |
| 3300024413|Ga0233393_1000094 | Not Available | 38462 | Open in IMG/M |
| 3300025070|Ga0208667_1000257 | Not Available | 24715 | Open in IMG/M |
| 3300025070|Ga0208667_1000300 | Not Available | 22317 | Open in IMG/M |
| 3300025070|Ga0208667_1001076 | Not Available | 10617 | Open in IMG/M |
| 3300025070|Ga0208667_1001765 | All Organisms → Viruses | 7538 | Open in IMG/M |
| 3300025070|Ga0208667_1002038 | Not Available | 6842 | Open in IMG/M |
| 3300025070|Ga0208667_1003320 | All Organisms → Viruses → Predicted Viral | 4922 | Open in IMG/M |
| 3300025070|Ga0208667_1005819 | All Organisms → Viruses → Predicted Viral | 3268 | Open in IMG/M |
| 3300025070|Ga0208667_1015476 | All Organisms → Viruses → Predicted Viral | 1599 | Open in IMG/M |
| 3300025070|Ga0208667_1016620 | All Organisms → Viruses → Predicted Viral | 1513 | Open in IMG/M |
| 3300025084|Ga0208298_1036686 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300025085|Ga0208792_1008484 | All Organisms → Viruses → Predicted Viral | 2413 | Open in IMG/M |
| 3300025103|Ga0208013_1037874 | All Organisms → Viruses → Predicted Viral | 1350 | Open in IMG/M |
| 3300025103|Ga0208013_1069009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 928 | Open in IMG/M |
| 3300025108|Ga0208793_1002839 | Not Available | 8823 | Open in IMG/M |
| 3300025483|Ga0209557_1113447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 538 | Open in IMG/M |
| 3300025543|Ga0208303_1003730 | Not Available | 5464 | Open in IMG/M |
| 3300025543|Ga0208303_1106861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 583 | Open in IMG/M |
| 3300025577|Ga0209304_1000123 | Not Available | 53734 | Open in IMG/M |
| 3300025620|Ga0209405_1030603 | All Organisms → Viruses → Predicted Viral | 2079 | Open in IMG/M |
| 3300025621|Ga0209504_1006980 | Not Available | 5847 | Open in IMG/M |
| 3300025621|Ga0209504_1067769 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300025621|Ga0209504_1090036 | Not Available | 824 | Open in IMG/M |
| 3300025621|Ga0209504_1169606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 505 | Open in IMG/M |
| 3300025626|Ga0209716_1012875 | All Organisms → Viruses → Predicted Viral | 3713 | Open in IMG/M |
| 3300025626|Ga0209716_1015583 | All Organisms → Viruses → Predicted Viral | 3246 | Open in IMG/M |
| 3300025626|Ga0209716_1031806 | All Organisms → Viruses → Predicted Viral | 1941 | Open in IMG/M |
| 3300025645|Ga0208643_1000609 | Not Available | 22854 | Open in IMG/M |
| 3300025654|Ga0209196_1096488 | Not Available | 885 | Open in IMG/M |
| 3300025671|Ga0208898_1183565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 525 | Open in IMG/M |
| 3300025684|Ga0209652_1018438 | All Organisms → Viruses → Predicted Viral | 3589 | Open in IMG/M |
| 3300025694|Ga0209406_1135576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 794 | Open in IMG/M |
| 3300025695|Ga0209653_1021817 | All Organisms → Viruses → Predicted Viral | 2948 | Open in IMG/M |
| 3300025701|Ga0209771_1036207 | All Organisms → Viruses → Predicted Viral | 1919 | Open in IMG/M |
| 3300025809|Ga0209199_1170748 | Not Available | 788 | Open in IMG/M |
| 3300025832|Ga0209307_1107165 | Not Available | 888 | Open in IMG/M |
| 3300025870|Ga0209666_1083217 | All Organisms → Viruses → Predicted Viral | 1606 | Open in IMG/M |
| 3300025876|Ga0209223_10066428 | All Organisms → Viruses → Predicted Viral | 2108 | Open in IMG/M |
| 3300025879|Ga0209555_10066865 | All Organisms → Viruses → Predicted Viral | 1590 | Open in IMG/M |
| 3300026479|Ga0228622_1042703 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300027413|Ga0208950_1016788 | All Organisms → Viruses → Predicted Viral | 2224 | Open in IMG/M |
| 3300027612|Ga0209037_1005372 | All Organisms → Viruses → Predicted Viral | 3360 | Open in IMG/M |
| 3300027612|Ga0209037_1020515 | All Organisms → Viruses → Predicted Viral | 1659 | Open in IMG/M |
| 3300027751|Ga0208304_10076629 | All Organisms → Viruses → Predicted Viral | 1274 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10034223 | All Organisms → Viruses → Predicted Viral | 2071 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10194825 | Not Available | 933 | Open in IMG/M |
| 3300028008|Ga0228674_1110280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 951 | Open in IMG/M |
| 3300028125|Ga0256368_1010345 | All Organisms → Viruses → Predicted Viral | 1565 | Open in IMG/M |
| 3300028125|Ga0256368_1015102 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300028196|Ga0257114_1337704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 510 | Open in IMG/M |
| 3300028287|Ga0257126_1033630 | All Organisms → Viruses → Predicted Viral | 2278 | Open in IMG/M |
| 3300031143|Ga0308025_1011972 | All Organisms → Viruses → Predicted Viral | 3548 | Open in IMG/M |
| 3300031628|Ga0308014_1046536 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
| 3300031851|Ga0315320_10007908 | Not Available | 8613 | Open in IMG/M |
| 3300032277|Ga0316202_10030637 | All Organisms → Viruses → Predicted Viral | 2591 | Open in IMG/M |
| 3300032277|Ga0316202_10371214 | Not Available | 668 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 13.47% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.24% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.61% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.53% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.71% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.31% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.49% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 4.49% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.90% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.67% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.86% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.86% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.86% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 2.86% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.04% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.04% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.04% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.63% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.22% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.82% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.82% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.82% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.82% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.82% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.82% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.41% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.41% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.41% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300000930 | Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001948 | Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012 | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
| 3300003410 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005748 | Seawater microbial communities from Vineyard Sound, MA, USA - control T7 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300016724 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011507AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016737 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019077 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p8 | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024192 | Seawater microbial communities from Monterey Bay, California, United States - 47D | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
| 3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024413 | Seawater microbial communities from Monterey Bay, California, United States - 21D | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025654 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100109341 | 3300000101 | Marine | MIPVGQLRLLLTKAGLNYIITRVDGNVAHVNILVMEGSDVHS* |
| DelMOSum2010_100170324 | 3300000101 | Marine | MIPVGQLKLLLTKAGLEFKIVRVEGSVAHVNILVAEV* |
| DelMOSum2010_100512745 | 3300000101 | Marine | MIPVGQLKLLLTKAGLEFKIVRVEGSVAHVNILVEEGSDVHS* |
| DelMOSum2010_100800883 | 3300000101 | Marine | MIPVSMLRVLLTKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS* |
| DelMOSum2010_101199952 | 3300000101 | Marine | MIPVSMLRRLLTKEGLDFKIVKVXGNVAQVNIIVAEGSDVHS* |
| DelMOSum2011_1000223618 | 3300000115 | Marine | MIPVGQLRLMLRKAGLEFVITRVEGNVAHVNILVAEGSDVHS* |
| DelMOSum2011_100333481 | 3300000115 | Marine | PVGQLRLVLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS* |
| DelMOSum2011_102038761 | 3300000115 | Marine | MIPVGQLRLLLTKAGLEFVITRVEGNVAHVNILVAEGSDVHS* |
| DelMOSpr2010_100092588 | 3300000116 | Marine | MIPVGQLRLLLTKAGLEYKXTRVEGXVAHVNILVAEQPDVHS* |
| DelMOSpr2010_102681562 | 3300000116 | Marine | MIPIGQLRLLLTKAGLEYKITRVEGNVAHVNILIDEVKKDVHS* |
| DelMOWin2010_1000005328 | 3300000117 | Marine | MIPIGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS* |
| DelMOWin2010_1000298916 | 3300000117 | Marine | MIPVGQLRLLLTKAGLEYIITRVEGNVAHVNILVAEQPDVHS* |
| OpTDRAFT_100000476 | 3300000928 | Freshwater And Marine | MIPIGQLRLLLTKAGLEYKITRVDGNVAHVNILVAEQPDVHSRTGI* |
| OpTDRAFT_100113952 | 3300000928 | Freshwater And Marine | MIPVGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEQPDVQR* |
| OpTDRAFT_100673001 | 3300000928 | Freshwater And Marine | LRLLLTKAGLEYVITRVEGNVAHVNILVAEQSDVHS* |
| NpDRAFT_100344073 | 3300000929 | Freshwater And Marine | MIPIGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQSDVHS* |
| NpDRAFT_104071331 | 3300000929 | Freshwater And Marine | STKRRGKVMIPIGQLRLLLTKAGLEYTITRIDGNVAHVNILVAEVKGDVHS* |
| BpDRAFT_101707394 | 3300000930 | Freshwater And Marine | IPVGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEQPDVHS* |
| BpDRAFT_101707401 | 3300000930 | Freshwater And Marine | MIPIGQLRLLLTKAGLEFVITRVEGNVAHVNILVGDQPDVHS* |
| BBAY92_100041535 | 3300000947 | Macroalgal Surface | MIPVGQLRLLLIKAGLEFKITRVEGSIAHVNIMVAEGSDVHSRV* |
| BBAY92_100185785 | 3300000947 | Macroalgal Surface | RGKAMIPVGQLRLMLRKAGLDFVITRVEGNIAHVNILVAEGSDVHS* |
| GOS2228_10433445 | 3300001948 | Marine | MIPIGQLRLLLTKAGLEYVITRVEGNVAHVNILVADQPDVHS* |
| JGI26079J46598_10070377 | 3300003216 | Marine | MIPVGQLRLLLTKAGLDYVITRVEGNVAHVNILVAEQPDVHS* |
| JGI26079J46598_10093891 | 3300003216 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVHS* |
| JGI26081J50195_10023885 | 3300003346 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS* |
| JGI26086J50260_10432654 | 3300003410 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAGVEKDVHS* |
| JGI26260J51721_10122992 | 3300003580 | Marine | MIPVGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEQPDVHS* |
| JGI26260J51721_10292642 | 3300003580 | Marine | MIPVGQLRLLLTKAGLEYKITRVEGSVAHVNILVAEQPDVHS* |
| Ga0055584_1024700922 | 3300004097 | Pelagic Marine | MIPVGQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0066605_100729343 | 3300004279 | Marine | MIPLSMLRVLLTKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS* |
| Ga0065861_10157941 | 3300004448 | Marine | MMPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0065861_10201702 | 3300004448 | Marine | MIPVGQLRLLLIKAGLEFKITRVEGNIAHVNIMVAEGSDVHS* |
| Ga0065861_10426764 | 3300004448 | Marine | MIPVSMLRRLLTKEGLDFKIVKVTGNVAQVNIIVAEGSDVHS* |
| Ga0066224_10421784 | 3300004457 | Marine | MIPVGQLRLLLTKAGLEFVITRVEGNVAHVNIIVAEGSDVHS* |
| Ga0066222_10515592 | 3300004460 | Marine | MIPVGQLRLLLIKAGLEFKITRVEGNIAHVNIIVAEGSDVHS* |
| Ga0076925_10531444 | 3300005748 | Marine | MIPVGQLRLLLTKAGLEFVITRVEGNVAHVNIIVAEGSNVHS* |
| Ga0078893_118922693 | 3300005837 | Marine Surface Water | MIPISMLKRLLIKEGLEFKIVKVVGNVAQVNIIVAEPSDVHS* |
| Ga0078893_119549802 | 3300005837 | Marine Surface Water | MIPIGQLRLLLTKAGLEFVITRVDGNVAHVNILVGDQPDVHS* |
| Ga0070743_1000015827 | 3300005941 | Estuarine | MIPIGQLRLLLTKAGLEYTITRIDGNVAHVNILVAEVKGDVHS* |
| Ga0075462_100329322 | 3300006027 | Aqueous | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVQR* |
| Ga0075466_10534231 | 3300006029 | Aqueous | MIPVGQLRLLLTKAGLDYVITRVEGNVAHVNIWVAEQPDVQR* |
| Ga0075495_15564502 | 3300006399 | Aqueous | MIPVGQLRLMLRKAGLDFVITRVDGNVAHVNILVAEGSDVHS* |
| Ga0070744_1000200610 | 3300006484 | Estuarine | MIPIGQLRLLLTKAGLEYSITRIEGNVAHVNILIAEVKKGVHS* |
| Ga0098048_100028123 | 3300006752 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNIAHVNILVAEQPDVHSRTGI* |
| Ga0098048_100034128 | 3300006752 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVEEQTDVHS* |
| Ga0098048_100176112 | 3300006752 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVDGELNVQR* |
| Ga0098048_10032246 | 3300006752 | Marine | MIPIGQLRLLLTKAGLEFVITRVDGNVAHVNILVGEQPDVHS* |
| Ga0098048_10090162 | 3300006752 | Marine | MIPIGQLRLLLTKAGLDYVITRVEGNIAHVNILIDEVK* |
| Ga0098048_10230162 | 3300006752 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVDGELNVHS* |
| Ga0098048_10326553 | 3300006752 | Marine | MIPIGQLRLLLTKAGLEYVITRVEGNIAHVNILVDGELNVQR* |
| Ga0098048_11247993 | 3300006752 | Marine | MIPVSMLKRLLIKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS* |
| Ga0098048_11510282 | 3300006752 | Marine | MIPVGQLRLLLTKAGLEYKITRVEGNVAHVNIIVAEQPDVHS* |
| Ga0098048_12627082 | 3300006752 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVDGELHVHS* |
| Ga0098054_10429056 | 3300006789 | Marine | MIPVGQLRLLLTKAGLDYVITRVDGNVAHVNILVDGELNVHS* |
| Ga0098054_11016724 | 3300006789 | Marine | MIPIGQLRLLLTKAGLEYIITRVDGNVAHVNILVDGELHVHS* |
| Ga0075467_105446591 | 3300006803 | Aqueous | MIPVSMLRRLLTKEGLEFKIVKVTGNVAQVNIIVAEGSDVHS* |
| Ga0070754_100062944 | 3300006810 | Aqueous | MIPVGQLRLLLTKAGLEYVITRVDGNVAHVNIIVAEGSDVYS* |
| Ga0070754_101367172 | 3300006810 | Aqueous | MIPVGQLRLLLTKAGLEYVITRVEGNVTHVNILVAGVEKDVHS* |
| Ga0075479_103044454 | 3300006870 | Aqueous | VGQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0070750_101186925 | 3300006916 | Aqueous | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNIIVAEQPDVHS* |
| Ga0070750_102289261 | 3300006916 | Aqueous | MMPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS* |
| Ga0070750_103798622 | 3300006916 | Aqueous | MIPVGQLRLLLTKAGLDFVITRVEGNVAHVNILVAEQPDVQR* |
| Ga0070748_10060836 | 3300006920 | Aqueous | MIPLGQLRLLLTKAGLDYVITRVEGNVAHVNIWVAEQPDVQR* |
| Ga0098050_10025161 | 3300006925 | Marine | IPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVDGELHVHS* |
| Ga0098046_10486471 | 3300006990 | Marine | VMIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0098046_11228092 | 3300006990 | Marine | MIPIGQLRLLLTKAGLEYVITRVEGNVAHVNILVDGELNVHS* |
| Ga0070747_11266701 | 3300007276 | Aqueous | LLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS* |
| Ga0070747_12818562 | 3300007276 | Aqueous | MIPVGQLRLMLRKAGLEFVITRVEGNVAHVNIMVQEIQDVHS* |
| Ga0070745_11417111 | 3300007344 | Aqueous | KGYNMIPVGQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0070745_13372053 | 3300007344 | Aqueous | VGQLRLLLTKAGLEYVITRVDGNVAHVNIIVAEGSDVYS* |
| Ga0070752_12813322 | 3300007345 | Aqueous | MMPVGQLRLLLTKAGLEYVITRVEGNVALVNILVAEGSDVHS* |
| Ga0070753_13672773 | 3300007346 | Aqueous | QLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0099847_10538843 | 3300007540 | Aqueous | MIPVGQLRLMLRKAGLEFVITRVEGNVAHVNIMVQEGSDVHS* |
| Ga0102821_11720851 | 3300007557 | Estuarine | MIPIGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEQPDVHS* |
| Ga0105749_11533862 | 3300007864 | Estuary Water | MIPVGQLRLLLTKAGLEYVITRVDGNVAHVNIIVAEQPDVHS* |
| Ga0075480_106245023 | 3300008012 | Aqueous | MIPVGQLRLLLTKAGLEYVITRVDGNVAHVNIIVA |
| Ga0102960_11212121 | 3300009000 | Pond Water | MIPVGQLRLLLTKAGLEYIITRVEGNVAHVNILVAEGSDVHS*V*IRRIHCYHTR |
| Ga0102963_10479284 | 3300009001 | Pond Water | MIPVGQLRLLLTKAGLEYIITRVEGNVAHVNILVAEGSDVHS* |
| Ga0102811_13342153 | 3300009024 | Estuarine | MIPVGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEQPNVHS* |
| Ga0102909_10206591 | 3300009050 | Estuarine | RCMIPVSMLRVLLTKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS* |
| Ga0115566_108210792 | 3300009071 | Pelagic Marine | MIPVGQLRLMLRKAGLEFVITRVEGNVAHVNIMVQERSDVHS* |
| Ga0115549_10242064 | 3300009074 | Pelagic Marine | MIPVGQLRLLLTKAGLDFVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0115550_100954311 | 3300009076 | Pelagic Marine | MIPIGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVQR* |
| Ga0115550_11557342 | 3300009076 | Pelagic Marine | MIPVGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEGSDVHS* |
| Ga0115550_12804593 | 3300009076 | Pelagic Marine | MIPVGQLRLLLTKSGLEYVITLVEGNVAHVNILVAEQPDVHS* |
| Ga0102814_100529524 | 3300009079 | Estuarine | MIPIGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEQPNVHS* |
| Ga0102812_100609995 | 3300009086 | Estuarine | MIPIGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEQPDVQR* |
| Ga0102812_103522251 | 3300009086 | Estuarine | KGTDMIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILIAEGSDVHS* |
| Ga0115562_12806281 | 3300009434 | Pelagic Marine | MIPVGQLRLLLTKAGLNFVITRVEGNVAHVNILVAEQPDVQR* |
| Ga0115546_12061551 | 3300009435 | Pelagic Marine | RKGQVMIPVGQLSLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0115563_11362344 | 3300009442 | Pelagic Marine | IMIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS* |
| Ga0115560_10969984 | 3300009447 | Pelagic Marine | MIPVGQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSNVHS* |
| Ga0115560_11492064 | 3300009447 | Pelagic Marine | MIPLGQLRLLLTKAGLDYVITRVEGNVAHVNILVAEQPDVQR* |
| Ga0115558_11928802 | 3300009449 | Pelagic Marine | MIPLGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVQR* |
| Ga0115565_101892641 | 3300009467 | Pelagic Marine | RLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS* |
| Ga0115571_14095672 | 3300009495 | Pelagic Marine | MIPIGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEKPDVHS* |
| Ga0115571_14450692 | 3300009495 | Pelagic Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVHS*VRV |
| Ga0115570_103686813 | 3300009496 | Pelagic Marine | GWKGYGMIPVGQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0115569_100290431 | 3300009497 | Pelagic Marine | GWKGYGMIPVGQLRLMLRKAGLEFVITRVEGNVAHVNIMVQERSDVHS* |
| Ga0115572_103248223 | 3300009507 | Pelagic Marine | MIPVGQLRLLLTKAGLDYVITRVEGNVAHVNILVAEQPDVQR* |
| Ga0115572_103746152 | 3300009507 | Pelagic Marine | MIPVGQLRLLLTKSGLEYVITRVEGNVAHVNILVAEQPDVHS* |
| Ga0115572_107662443 | 3300009507 | Pelagic Marine | KGYSMIPVGQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0115572_107957021 | 3300009507 | Pelagic Marine | GQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSNVHS* |
| Ga0129348_10070293 | 3300010296 | Freshwater To Marine Saline Gradient | MIPVSMLRRLLTKEGLDFKIVKVIGNVAQVNIIVAEGSDVHS* |
| Ga0136549_104684791 | 3300010389 | Marine Methane Seep Sediment | RLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0151671_10027334 | 3300011253 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSD |
| Ga0129327_100781063 | 3300013010 | Freshwater To Marine Saline Gradient | MIPVGQLRLLLVKAGLEFKITRVEGNIAHVNIIVAEGSDVHS* |
| Ga0129327_109005611 | 3300013010 | Freshwater To Marine Saline Gradient | GMIPVGQLRLVLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS* |
| Ga0182048_11468103 | 3300016724 | Salt Marsh | MIPVGQLRLMLRKAGLEFVITRVEGNVAHVNILVAEGSDVHS |
| Ga0182047_15525002 | 3300016737 | Salt Marsh | MIPVGQLRLMLRKAGLDFVITRVEGNVAHVNIMVEDGSDVHS |
| Ga0180120_103827542 | 3300017697 | Freshwater To Marine Saline Gradient | MIPVGQLRLLLVKAGLEFKITRVEGNIAHVNIIVAEGSDVHS |
| Ga0181369_10340394 | 3300017708 | Marine | MIPVGQLRLLLTKAGLDYVITRVDGNVAHVNILVAEQSDVHS |
| Ga0181387_10456393 | 3300017709 | Seawater | AMIPVGQLRLLLTKAGLEYKITRVEGNVAHVNIIVAEQPDVHS |
| Ga0181390_10286754 | 3300017719 | Seawater | MIPVGQLRLLLTKAGLDYVITRVEGNVAHVNILVAEVERDVHS |
| Ga0181399_10140812 | 3300017742 | Seawater | MIPVGQLRLLLTKAGLEYVITRVEGNIAHVNILVAEQPDVHS |
| Ga0181407_11611232 | 3300017753 | Seawater | MIPVGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEKPDVHSXVXI |
| Ga0181422_11699862 | 3300017762 | Seawater | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVYSRD |
| Ga0181385_10538603 | 3300017764 | Seawater | MIPISMLKRLLIKEGLEFKIVKVVGNVAQVNIIVAEPSDVHS |
| Ga0187221_10064977 | 3300017769 | Seawater | MIPVTMLRRLLTKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS |
| Ga0181379_100123011 | 3300017783 | Seawater | MIPVGQLRLLLTKAGLDYVITRVDGNVAHVNILVAEQPDVQR |
| Ga0181379_10299124 | 3300017783 | Seawater | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQSDVHS |
| Ga0181424_100111054 | 3300017786 | Seawater | MIPVGQLRLLLTKAGLEYVITRVDGNVAHVNILVAEQPDVHSRTGI |
| Ga0181424_103229033 | 3300017786 | Seawater | MIPIGQLRLLLTKAGLEYVITRVEGNIAHVNILVAEQPDVHS |
| Ga0181552_1000497313 | 3300017824 | Salt Marsh | MIPVGQLRLMLRKAGLEFVITRVEGNVAHVNIMVEDGSDVHS |
| Ga0181552_101429073 | 3300017824 | Salt Marsh | MIPVGQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS |
| Ga0181601_101000352 | 3300018041 | Salt Marsh | MIPVGQLRLLLIKAGLEFKITRVEGNIAHVNIMVAEGSDVHS |
| Ga0181606_105804591 | 3300018048 | Salt Marsh | MIPVGQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSDVHSSV |
| Ga0188868_10023993 | 3300019077 | Freshwater Lake | MIPVSMLRVLLTKEGLEFKIVKVVGNVAQVNIIVAV |
| Ga0181595_100970114 | 3300020053 | Salt Marsh | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS |
| Ga0206125_102983653 | 3300020165 | Seawater | MIPVSMLRRLLTKEGLEFKIVKVTGNVAQVNIIVAEGSDVHS |
| Ga0206125_103051043 | 3300020165 | Seawater | KGRCMIPVSMLRRLLTKEGLEFKIVKVTGNVAQVNIIVAEGSDVHS |
| Ga0206128_100199812 | 3300020166 | Seawater | MIPIGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS |
| Ga0206128_10895264 | 3300020166 | Seawater | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNIIVAEQPDVHS |
| Ga0206127_11553603 | 3300020169 | Seawater | GRCMIPVSMLRRLLTKEGLEFKIVKVTGNVAQVNIIVAEKSDVHS |
| Ga0206129_1001252210 | 3300020182 | Seawater | MIPVGQLRLMLRKSGLEFVITRVEGNVAHVNIMVQEIQDVHS |
| Ga0206129_100691922 | 3300020182 | Seawater | MIPVGQLRLMLRKAGLEFVITRVEGNVAHVNIMVQEGSDVHS |
| Ga0206131_101549442 | 3300020185 | Seawater | MIPVGQLRLLLIKAGLEFKITRVEGNIAHVNIIVAEGSDVHS |
| Ga0206131_101637574 | 3300020185 | Seawater | MIPVGQLRLLLTKAGLDYVITRVEGNVAHVNIWVAEQPDVQR |
| Ga0206130_101894104 | 3300020187 | Seawater | TRGESIMIPVGQLRLLLTKAGLEYVITRVEGNVAHVNIIVAEQPDVHS |
| Ga0181604_103571394 | 3300020191 | Salt Marsh | VCKHAYQPVKRRGKAMIPVGQLRLLLIKAGLEFKITRVEGNIAHVNIMVAEGSDVHS |
| Ga0211504_10014639 | 3300020347 | Marine | MIPIGQLRLLLTKAGLEFVITRVDGNVAHVNILVGDQPDVHS |
| Ga0211504_100329320 | 3300020347 | Marine | MIPLSMLRVLLTKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS |
| Ga0211504_10061975 | 3300020347 | Marine | MIPVGQLKLLLTKAGLEFKIVRVEGSVAHVNILVAEGSDVHS |
| Ga0211504_10973084 | 3300020347 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVMEGSDVHS |
| Ga0211677_100840783 | 3300020385 | Marine | MIPVGQLRLLLTKAGLEYIITRVEGNIAHVNILVAEQPDVHSRI |
| Ga0211576_100255103 | 3300020438 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAGVEKDVHS |
| Ga0206126_100223961 | 3300020595 | Seawater | VSMLRRLLTKEGLEFKIVKVTGNVAQVNIIVAEGSDVHS |
| Ga0206677_100113914 | 3300021085 | Seawater | MIPVSMLRRLLTKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS |
| Ga0206677_100134195 | 3300021085 | Seawater | MIPIGQLRLLLTKAGLEYVITRVEGNIAHVNIIVAEQPDVHS |
| Ga0206677_100138375 | 3300021085 | Seawater | MIPVGQLRLILTKAGLKYIITRVEGKVAHVNILVAEQPDVHS |
| Ga0206677_103668821 | 3300021085 | Seawater | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQSDV |
| Ga0213862_100041997 | 3300021347 | Seawater | MIPVGQLRLLLTKAGLEYIITRVEGNVAHVNILVAEQPDVHS |
| Ga0213863_1000074317 | 3300021371 | Seawater | MIPVSMLRRLLTKEGLDFKIVKVIGNVAQVNIIVAEGSDVHS |
| Ga0213869_103463313 | 3300021375 | Seawater | MIPVGQLRLMLRKAGLEFVITRVEGNVAHVNIMVEEGSDVH |
| Ga0213861_100550843 | 3300021378 | Seawater | MIPVGQLRLMLRKAGLDFVITRVDGNVAHVNILVAEGSDVHS |
| Ga0222717_1000065444 | 3300021957 | Estuarine Water | MIPVSMLRVLLTKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS |
| Ga0222717_100107534 | 3300021957 | Estuarine Water | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEVEKDVHS |
| Ga0222717_100397186 | 3300021957 | Estuarine Water | MIPIGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEQPDVHS |
| Ga0222717_100786633 | 3300021957 | Estuarine Water | MIPVGQLRLLLTKAGLDYVITRVDGNVAHVNILVAEQSDVHSRTGI |
| Ga0222717_104044632 | 3300021957 | Estuarine Water | MIPVGQLRLLLTKAGLDYVITRVDGNVAHVNILVAEQPDVHSRTGI |
| Ga0222718_100202604 | 3300021958 | Estuarine Water | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAAGSDVHS |
| Ga0222716_103054834 | 3300021959 | Estuarine Water | IGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS |
| Ga0222715_101131742 | 3300021960 | Estuarine Water | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVHS |
| Ga0222715_101196981 | 3300021960 | Estuarine Water | RLLLTKAGLDYVITRVDGNVAHVNILVAEQPDVHSRTGI |
| Ga0222715_103510393 | 3300021960 | Estuarine Water | MMPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS |
| Ga0222719_104890251 | 3300021964 | Estuarine Water | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQP |
| Ga0212021_10109481 | 3300022068 | Aqueous | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEPSDVQR |
| Ga0196887_10339114 | 3300022178 | Aqueous | MIPVGQLRLLLTKAGLEFVITRVEGNVAHVNIIVAEGSDVHS |
| Ga0196899_100095110 | 3300022187 | Aqueous | MIPVGQLRLLLTKAGLEYVITRVDGNVAHVNIIVAEGSDVYS |
| Ga0224502_100275177 | 3300022218 | Sediment | MIPVGQLRLLLTKAGLEYKITRIEGNVAHVNIIVAEQPDVHS |
| Ga0224501_102469961 | 3300022223 | Sediment | IPVSMLRVLLTKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS |
| Ga0255783_103134723 | 3300022923 | Salt Marsh | MIPVGQLRLMLRKAGLEFVITRVEGNVAHVNIMVED |
| (restricted) Ga0233432_100188814 | 3300023109 | Seawater | MIPIGQLRLLLTKAGLEFVITRVEGNVAHVNILVGDQPDVHS |
| (restricted) Ga0233432_101216694 | 3300023109 | Seawater | RLLLTKAGLEYIITRVEGNVAHVNILVAEQPDVHS |
| (restricted) Ga0233432_103312284 | 3300023109 | Seawater | GQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS |
| (restricted) Ga0233412_103618162 | 3300023210 | Seawater | MIPVGQLRLLLTKAGLEYKITRVEGSVAHVNILVAEQPDVHS |
| (restricted) Ga0233410_100325404 | 3300023276 | Seawater | PMIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS |
| (restricted) Ga0255039_101247154 | 3300024062 | Seawater | LNTSNLLLTKAGLEYKITRVEGNVAHVNILVAEQPDVHS |
| (restricted) Ga0255039_101474411 | 3300024062 | Seawater | MIPIGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHSRTGI |
| Ga0228637_11138681 | 3300024192 | Seawater | MIPVSMLIVLLTKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS |
| Ga0228633_11499132 | 3300024228 | Seawater | MIPIGQLRLLLTKTGLEFVITRVDGNVAHVNILVGDQPDVHS |
| Ga0233402_10314692 | 3300024229 | Seawater | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVEEVEKDVHS |
| Ga0233402_10588842 | 3300024229 | Seawater | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDV |
| Ga0228655_10269424 | 3300024236 | Seawater | MIPVGQLRLLLTKAGLEFVITRVDGNVAHVNILVGDQPDVHS |
| Ga0228675_10971242 | 3300024247 | Seawater | MIPVGQLRLLLTKAGLEYKITRVEGNVAHVNIIVAEQPDVHSXV |
| Ga0228664_10554443 | 3300024294 | Seawater | MIPIGQLRLLLTKAGLEYKITRVEGNVAHVNIIVAEQPDVHS |
| Ga0244775_1000261627 | 3300024346 | Estuarine | MIPIGQLRLLLTKAGLEYTITRIDGNVAHVNILVAEVKGDVHS |
| Ga0244775_100133383 | 3300024346 | Estuarine | MIPIGQLRLLLTKAGLEYSITRIEGNVAHVNILIAEVKKGVHS |
| Ga0244775_107446212 | 3300024346 | Estuarine | MIPVGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEQPNVHS |
| Ga0233393_10000941 | 3300024413 | Seawater | MIPVSMLRVLLTKEGLEFKIVKVVGNVAQVNIIVAEGSDV |
| Ga0208667_100025729 | 3300025070 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVEEQTDVHS |
| Ga0208667_100030021 | 3300025070 | Marine | MIPIGQLRLLLTKAGLDYVITRVEGNIAHVNILIDEVK |
| Ga0208667_10010767 | 3300025070 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVDGELNVQR |
| Ga0208667_10017656 | 3300025070 | Marine | MIPVSMLKRLLIKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS |
| Ga0208667_10020386 | 3300025070 | Marine | MIPIGQLRLLLTKAGLEFVITRVDGNVAHVNILVGEQPDVHS |
| Ga0208667_10033206 | 3300025070 | Marine | MIPVGQLRLLLTKAGLDYVITRVDGNVAHVNILVDGELHVHS |
| Ga0208667_10058192 | 3300025070 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVDGELHVHS |
| Ga0208667_10154764 | 3300025070 | Marine | MIPIGQLRLLLTKAGLEYVITRVEGNIAHVNILVDGELNVQR |
| Ga0208667_10166202 | 3300025070 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNIAHVNILVAEQPDVHSRTGI |
| Ga0208298_10366862 | 3300025084 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVDGELNVHS |
| Ga0208792_10084841 | 3300025085 | Marine | LRLLLTKAGLEYVITRVEGNVAHVNILVDGELHVHS |
| Ga0208013_10378743 | 3300025103 | Marine | RKGRCMIPVSMLKRLLIKEGLEFKIVKVVGNVAQVNIIVAEGSDVHS |
| Ga0208013_10690093 | 3300025103 | Marine | MIPVSMLKRLLIKEGLEFKIVKVVGNVAQVNIIVAEGSDV |
| Ga0208793_100283914 | 3300025108 | Marine | AMIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVEEQTDVHS |
| Ga0209557_11134473 | 3300025483 | Marine | SIMIPVGQLRLLLTKAGLEYVITRVEGNVAHVNIIVAEQPDVHS |
| Ga0208303_100373017 | 3300025543 | Aqueous | MIPVGQLRLVLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS |
| Ga0208303_11068612 | 3300025543 | Aqueous | MIPVGQLRLLLTKAGLEFVITRVEGNVAHVNILVAEGSDVHS |
| Ga0209304_100012332 | 3300025577 | Pelagic Marine | MIPVGQLRLLLTKAGLDFVITRVEGNVAHVNILVAEGSDVHS |
| Ga0209405_10306035 | 3300025620 | Pelagic Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEKPDVHS |
| Ga0209504_100698012 | 3300025621 | Pelagic Marine | MIPIGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVQR |
| Ga0209504_10677694 | 3300025621 | Pelagic Marine | DMIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVHS |
| Ga0209504_10900362 | 3300025621 | Pelagic Marine | MIPVGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEGSDVHS |
| Ga0209504_11696063 | 3300025621 | Pelagic Marine | MIPVGQLRLLLTKAGLEYVITRVEGKVAHVNILVAEQPDVHS |
| Ga0209716_10128756 | 3300025626 | Pelagic Marine | MIPVGQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSNVHS |
| Ga0209716_10155835 | 3300025626 | Pelagic Marine | QLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS |
| Ga0209716_10318062 | 3300025626 | Pelagic Marine | MIPIGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEKPDVHS |
| Ga0208643_100060910 | 3300025645 | Aqueous | MIPLGQLRLLLTKAGLDYVITRVEGNVAHVNIWVAEQPDVQR |
| Ga0209196_10964881 | 3300025654 | Pelagic Marine | MIPLGQLRLLLTKAGLDYVITRVEGNVAHVNILVAEQPDVQR |
| Ga0208898_11835651 | 3300025671 | Aqueous | GQLRLLLTKAGLEYVITRVDGNVAHVNIIVAEGSDVYS |
| Ga0209652_10184381 | 3300025684 | Marine | RKGTDMIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVHS |
| Ga0209406_11355763 | 3300025694 | Pelagic Marine | MIPVGQLRLMLRKAGLEFVITRVEGNVAHVNIMVQERSDVHS |
| Ga0209653_10218171 | 3300025695 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQ |
| Ga0209771_10362071 | 3300025701 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSDV |
| Ga0209199_11707481 | 3300025809 | Pelagic Marine | QVMIPVGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEGSDVHS |
| Ga0209307_11071651 | 3300025832 | Pelagic Marine | IYGWKGYGMIPVGQLRLMLRKAGLDFVITRVEGNVAHVNILVAEGSDVHS |
| Ga0209666_10832174 | 3300025870 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNIIVAEVEKGVHS |
| Ga0209223_100664284 | 3300025876 | Pelagic Marine | MIPLGQLRLLLTKAGLEYVITRVEGNVAHVNILVAEQPDVQR |
| Ga0209555_100668654 | 3300025879 | Marine | MIPVGQLRLLLTKVGLEYVITRIEGNVAHVNILVAEGSDVHS |
| Ga0228622_10427031 | 3300026479 | Seawater | MIPIGQLRLLLTKAGLEFVITRVDGNVAHVNILVGDQPDVH |
| Ga0208950_10167887 | 3300027413 | Marine | MIPVGQLKLLLTKAGLEFKIVRVEGSVAHVNILVAEV |
| Ga0209037_10053725 | 3300027612 | Marine | MIPVGQLRLLLTKAGLEYRIIRVEGNVAHVNILVAEGSDVHS |
| Ga0209037_10205154 | 3300027612 | Marine | MIPVGQLRLLLTKAGLDYVITRVEGNVAHVNILVAEQPDVHS |
| Ga0208304_100766291 | 3300027751 | Estuarine | MIPIGQLRLLLTKAGLEYVITRVEGNIAHVNILVAEQPDVHSXV |
| (restricted) Ga0233415_100342232 | 3300027861 | Seawater | MIPVGQLKLLLTKAGLEYKITRVEGNVAHVNILVAEQPDVHS |
| (restricted) Ga0233415_101948252 | 3300027861 | Seawater | MIPVGQLRLLLTKAGLEYKITRVEGNVAHVNILVAEQPDVQR |
| Ga0228674_11102803 | 3300028008 | Seawater | MIPVGQLRLLLTKAGLEYVITRIEGNVAHVNILVAEGSDVHS |
| Ga0256368_10103453 | 3300028125 | Sea-Ice Brine | MIPIGQLRLALTKLGLNYVIARVEGKVAIVHVLVREDEDVHS |
| Ga0256368_10151024 | 3300028125 | Sea-Ice Brine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNIIVADQPDVQR |
| Ga0257114_13377043 | 3300028196 | Marine | MIPVGQLRLLLTKAGLEYVITRVEGNVAHVNIIVAEQPDVQR |
| Ga0257126_10336305 | 3300028287 | Marine | MIPVGQLKLLLTKAGLEYKIIRVEGNVAHVNILVAEQPDVQR |
| Ga0308025_10119721 | 3300031143 | Marine | MIPVGQLRLLLTKAGLDYVITHVDGRVAHVNILVTAEDKNVHS |
| Ga0308014_10465361 | 3300031628 | Marine | MIPVGQLRLLLTKAGLDYVITHVDGRVAHVNILVTAE |
| Ga0315320_100079085 | 3300031851 | Seawater | MIPVGQLRLLLTKAGLEYIITRVEGNVAHVNILVADQPDVHS |
| Ga0316202_100306374 | 3300032277 | Microbial Mat | MIPVGQLRLLLTKAGLNYIITRVDGNVAHVNILVMEGSDVHS |
| Ga0316202_103712143 | 3300032277 | Microbial Mat | MIPVGQLRLLLIKAGLEFKITRVEGNIAHVNILVAEGSDVHS |
| ⦗Top⦘ |