


| Basic Information | |
|---|---|
| Family ID | F015477 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 254 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MEMEIAKAQNELRCARADVEKASNRIAFCLSAIHNLTDRDIKE |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 254 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 64.96 % |
| % of genes near scaffold ends (potentially truncated) | 32.68 % |
| % of genes from short scaffolds (< 2000 bps) | 61.81 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.276 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (46.850 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.740 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.732 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 254 Family Scaffolds |
|---|---|---|
| PF09718 | Tape_meas_lam_C | 5.51 |
| PF00583 | Acetyltransf_1 | 2.36 |
| PF13550 | Phage-tail_3 | 1.57 |
| PF10145 | PhageMin_Tail | 1.57 |
| PF16778 | Phage_tail_APC | 1.18 |
| PF13578 | Methyltransf_24 | 1.18 |
| PF03237 | Terminase_6N | 0.79 |
| PF12518 | DUF3721 | 0.79 |
| PF01555 | N6_N4_Mtase | 0.39 |
| PF05065 | Phage_capsid | 0.39 |
| PF00856 | SET | 0.39 |
| PF02195 | ParBc | 0.39 |
| COG ID | Name | Functional Category | % Frequency in 254 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.39 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.39 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.39 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.39 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.72 % |
| Unclassified | root | N/A | 45.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10011866 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 5536 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10169135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10181881 | Not Available | 727 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10019254 | All Organisms → Viruses → Predicted Viral | 3356 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10072115 | Not Available | 1400 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10075425 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10145273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
| 3300000928|OpTDRAFT_10049495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
| 3300000949|BBAY94_10094283 | Not Available | 821 | Open in IMG/M |
| 3300004097|Ga0055584_100370705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1478 | Open in IMG/M |
| 3300004097|Ga0055584_100589879 | Not Available | 1160 | Open in IMG/M |
| 3300004097|Ga0055584_101964888 | Not Available | 600 | Open in IMG/M |
| 3300004461|Ga0066223_1044209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8935 | Open in IMG/M |
| 3300005747|Ga0076924_1390331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
| 3300005837|Ga0078893_14523729 | All Organisms → Viruses → Predicted Viral | 3924 | Open in IMG/M |
| 3300006025|Ga0075474_10000431 | All Organisms → cellular organisms → Bacteria | 15734 | Open in IMG/M |
| 3300006025|Ga0075474_10040156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1612 | Open in IMG/M |
| 3300006025|Ga0075474_10069540 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300006026|Ga0075478_10135912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300006026|Ga0075478_10139526 | Not Available | 760 | Open in IMG/M |
| 3300006026|Ga0075478_10154749 | Not Available | 714 | Open in IMG/M |
| 3300006027|Ga0075462_10000656 | Not Available | 10832 | Open in IMG/M |
| 3300006027|Ga0075462_10001921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6759 | Open in IMG/M |
| 3300006027|Ga0075462_10004085 | All Organisms → Viruses → Predicted Viral | 4727 | Open in IMG/M |
| 3300006027|Ga0075462_10129876 | Not Available | 775 | Open in IMG/M |
| 3300006030|Ga0075470_10231460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300006357|Ga0075502_1365306 | Not Available | 1040 | Open in IMG/M |
| 3300006401|Ga0075506_1729105 | Not Available | 1056 | Open in IMG/M |
| 3300006401|Ga0075506_1779130 | Not Available | 759 | Open in IMG/M |
| 3300006402|Ga0075511_1726685 | Not Available | 530 | Open in IMG/M |
| 3300006750|Ga0098058_1201876 | Not Available | 517 | Open in IMG/M |
| 3300006752|Ga0098048_1000590 | Not Available | 17107 | Open in IMG/M |
| 3300006752|Ga0098048_1004022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5858 | Open in IMG/M |
| 3300006752|Ga0098048_1166622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300006752|Ga0098048_1217212 | Not Available | 562 | Open in IMG/M |
| 3300006754|Ga0098044_1172956 | Not Available | 858 | Open in IMG/M |
| 3300006789|Ga0098054_1000457 | Not Available | 25584 | Open in IMG/M |
| 3300006790|Ga0098074_1051842 | Not Available | 1145 | Open in IMG/M |
| 3300006802|Ga0070749_10000456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27828 | Open in IMG/M |
| 3300006802|Ga0070749_10001705 | Not Available | 14856 | Open in IMG/M |
| 3300006802|Ga0070749_10011141 | All Organisms → cellular organisms → Bacteria | 5808 | Open in IMG/M |
| 3300006802|Ga0070749_10018062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4488 | Open in IMG/M |
| 3300006802|Ga0070749_10132584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1458 | Open in IMG/M |
| 3300006802|Ga0070749_10230245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1054 | Open in IMG/M |
| 3300006802|Ga0070749_10250063 | Not Available | 1004 | Open in IMG/M |
| 3300006802|Ga0070749_10367126 | Not Available | 798 | Open in IMG/M |
| 3300006802|Ga0070749_10547629 | Not Available | 627 | Open in IMG/M |
| 3300006802|Ga0070749_10550780 | Not Available | 625 | Open in IMG/M |
| 3300006802|Ga0070749_10770147 | Not Available | 512 | Open in IMG/M |
| 3300006803|Ga0075467_10538026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300006810|Ga0070754_10011104 | Not Available | 5642 | Open in IMG/M |
| 3300006810|Ga0070754_10018060 | All Organisms → cellular organisms → Bacteria | 4190 | Open in IMG/M |
| 3300006810|Ga0070754_10038424 | All Organisms → Viruses → Predicted Viral | 2614 | Open in IMG/M |
| 3300006810|Ga0070754_10052422 | Not Available | 2150 | Open in IMG/M |
| 3300006810|Ga0070754_10221058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300006867|Ga0075476_10005833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5694 | Open in IMG/M |
| 3300006867|Ga0075476_10037261 | All Organisms → Viruses → Predicted Viral | 2013 | Open in IMG/M |
| 3300006869|Ga0075477_10006538 | All Organisms → cellular organisms → Bacteria | 5525 | Open in IMG/M |
| 3300006870|Ga0075479_10190728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300006916|Ga0070750_10018602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3547 | Open in IMG/M |
| 3300006916|Ga0070750_10019372 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3471 | Open in IMG/M |
| 3300006916|Ga0070750_10027883 | Not Available | 2821 | Open in IMG/M |
| 3300006916|Ga0070750_10043209 | All Organisms → Viruses → Predicted Viral | 2204 | Open in IMG/M |
| 3300006916|Ga0070750_10305568 | Not Available | 679 | Open in IMG/M |
| 3300006916|Ga0070750_10323668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300006916|Ga0070750_10377224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300006919|Ga0070746_10010200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5338 | Open in IMG/M |
| 3300006919|Ga0070746_10017973 | Not Available | 3906 | Open in IMG/M |
| 3300006919|Ga0070746_10024877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3263 | Open in IMG/M |
| 3300006919|Ga0070746_10326881 | Not Available | 699 | Open in IMG/M |
| 3300006919|Ga0070746_10350513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300006920|Ga0070748_1293376 | Not Available | 579 | Open in IMG/M |
| 3300006924|Ga0098051_1013087 | All Organisms → Viruses → Predicted Viral | 2481 | Open in IMG/M |
| 3300006990|Ga0098046_1136102 | Not Available | 531 | Open in IMG/M |
| 3300007234|Ga0075460_10000089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29231 | Open in IMG/M |
| 3300007234|Ga0075460_10028977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2152 | Open in IMG/M |
| 3300007236|Ga0075463_10046948 | Not Available | 1402 | Open in IMG/M |
| 3300007280|Ga0101452_118141 | All Organisms → Viruses → Predicted Viral | 3890 | Open in IMG/M |
| 3300007344|Ga0070745_1099079 | Not Available | 1142 | Open in IMG/M |
| 3300007345|Ga0070752_1144611 | Not Available | 982 | Open in IMG/M |
| 3300007345|Ga0070752_1190471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300007345|Ga0070752_1263780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300007345|Ga0070752_1403078 | Not Available | 504 | Open in IMG/M |
| 3300007346|Ga0070753_1121482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
| 3300007539|Ga0099849_1005894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5599 | Open in IMG/M |
| 3300007540|Ga0099847_1000514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13214 | Open in IMG/M |
| 3300007640|Ga0070751_1058506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1668 | Open in IMG/M |
| 3300007640|Ga0070751_1207123 | Not Available | 760 | Open in IMG/M |
| 3300008012|Ga0075480_10147011 | Not Available | 1282 | Open in IMG/M |
| 3300009001|Ga0102963_1002818 | Not Available | 7674 | Open in IMG/M |
| 3300009056|Ga0102860_1236954 | Not Available | 527 | Open in IMG/M |
| 3300009079|Ga0102814_10380739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300009080|Ga0102815_10894133 | Not Available | 508 | Open in IMG/M |
| 3300009425|Ga0114997_10164504 | Not Available | 1300 | Open in IMG/M |
| 3300009425|Ga0114997_10542411 | Not Available | 617 | Open in IMG/M |
| 3300009433|Ga0115545_1082323 | Not Available | 1185 | Open in IMG/M |
| 3300009435|Ga0115546_1144556 | Not Available | 841 | Open in IMG/M |
| 3300009435|Ga0115546_1203319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300009705|Ga0115000_10024241 | Not Available | 4315 | Open in IMG/M |
| 3300009705|Ga0115000_10732606 | Not Available | 609 | Open in IMG/M |
| 3300010296|Ga0129348_1075698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
| 3300010296|Ga0129348_1108871 | Not Available | 973 | Open in IMG/M |
| 3300010296|Ga0129348_1307536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300010300|Ga0129351_1078591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1335 | Open in IMG/M |
| 3300010354|Ga0129333_10089105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2854 | Open in IMG/M |
| 3300010368|Ga0129324_10023294 | Not Available | 3029 | Open in IMG/M |
| 3300010368|Ga0129324_10205371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300010368|Ga0129324_10362294 | Not Available | 563 | Open in IMG/M |
| 3300010370|Ga0129336_10170170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
| 3300010883|Ga0133547_11806560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300012953|Ga0163179_10046664 | All Organisms → Viruses → Predicted Viral | 2970 | Open in IMG/M |
| 3300017697|Ga0180120_10002651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9002 | Open in IMG/M |
| 3300017697|Ga0180120_10160566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300017719|Ga0181390_1002299 | Not Available | 7938 | Open in IMG/M |
| 3300017719|Ga0181390_1006755 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 4211 | Open in IMG/M |
| 3300017719|Ga0181390_1009309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3506 | Open in IMG/M |
| 3300017719|Ga0181390_1010736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3219 | Open in IMG/M |
| 3300017719|Ga0181390_1137101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300017724|Ga0181388_1152937 | Not Available | 548 | Open in IMG/M |
| 3300017728|Ga0181419_1140365 | Not Available | 582 | Open in IMG/M |
| 3300017738|Ga0181428_1089176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300017741|Ga0181421_1008927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2798 | Open in IMG/M |
| 3300017742|Ga0181399_1110670 | Not Available | 675 | Open in IMG/M |
| 3300017746|Ga0181389_1044142 | Not Available | 1316 | Open in IMG/M |
| 3300017746|Ga0181389_1184210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300017749|Ga0181392_1191997 | Not Available | 589 | Open in IMG/M |
| 3300017749|Ga0181392_1237053 | Not Available | 516 | Open in IMG/M |
| 3300017755|Ga0181411_1000704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12326 | Open in IMG/M |
| 3300017757|Ga0181420_1222020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300017758|Ga0181409_1193093 | Not Available | 588 | Open in IMG/M |
| 3300017770|Ga0187217_1186748 | Not Available | 687 | Open in IMG/M |
| 3300017776|Ga0181394_1000710 | Not Available | 14505 | Open in IMG/M |
| 3300017776|Ga0181394_1235302 | Not Available | 551 | Open in IMG/M |
| 3300017781|Ga0181423_1289524 | Not Available | 605 | Open in IMG/M |
| 3300017782|Ga0181380_1126041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300017782|Ga0181380_1189651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300017950|Ga0181607_10017249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5552 | Open in IMG/M |
| 3300017950|Ga0181607_10055065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2676 | Open in IMG/M |
| 3300017950|Ga0181607_10713591 | Not Available | 520 | Open in IMG/M |
| 3300017951|Ga0181577_10122072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1788 | Open in IMG/M |
| 3300017956|Ga0181580_10020937 | All Organisms → cellular organisms → Bacteria | 5132 | Open in IMG/M |
| 3300017962|Ga0181581_10021597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4771 | Open in IMG/M |
| 3300017967|Ga0181590_10053306 | Not Available | 3224 | Open in IMG/M |
| 3300017969|Ga0181585_10289649 | Not Available | 1143 | Open in IMG/M |
| 3300018048|Ga0181606_10286837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300018048|Ga0181606_10337239 | Not Available | 822 | Open in IMG/M |
| 3300018421|Ga0181592_10110977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2124 | Open in IMG/M |
| 3300018421|Ga0181592_10320882 | Not Available | 1115 | Open in IMG/M |
| 3300018424|Ga0181591_10213810 | Not Available | 1510 | Open in IMG/M |
| 3300018426|Ga0181566_10874465 | Not Available | 610 | Open in IMG/M |
| 3300018428|Ga0181568_10123702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2167 | Open in IMG/M |
| 3300020173|Ga0181602_10316557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300020174|Ga0181603_10361543 | Not Available | 541 | Open in IMG/M |
| 3300020191|Ga0181604_10109954 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300020191|Ga0181604_10117464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1397 | Open in IMG/M |
| 3300021085|Ga0206677_10001010 | Not Available | 26515 | Open in IMG/M |
| 3300021371|Ga0213863_10068303 | Not Available | 1779 | Open in IMG/M |
| 3300021373|Ga0213865_10010695 | Not Available | 5289 | Open in IMG/M |
| 3300021375|Ga0213869_10006454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7374 | Open in IMG/M |
| 3300021378|Ga0213861_10295394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300021378|Ga0213861_10533617 | Not Available | 550 | Open in IMG/M |
| 3300021425|Ga0213866_10195075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1054 | Open in IMG/M |
| 3300021957|Ga0222717_10015609 | Not Available | 5171 | Open in IMG/M |
| 3300021957|Ga0222717_10017590 | All Organisms → Viruses → Predicted Viral | 4832 | Open in IMG/M |
| 3300021958|Ga0222718_10038824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3113 | Open in IMG/M |
| 3300021958|Ga0222718_10347890 | Not Available | 755 | Open in IMG/M |
| 3300021958|Ga0222718_10366187 | Not Available | 729 | Open in IMG/M |
| 3300021962|Ga0222713_10178691 | Not Available | 1438 | Open in IMG/M |
| 3300021964|Ga0222719_10420940 | Not Available | 825 | Open in IMG/M |
| 3300022050|Ga0196883_1020760 | Not Available | 790 | Open in IMG/M |
| 3300022050|Ga0196883_1030349 | Not Available | 657 | Open in IMG/M |
| 3300022057|Ga0212025_1016668 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
| 3300022057|Ga0212025_1031104 | Not Available | 899 | Open in IMG/M |
| 3300022065|Ga0212024_1062083 | Not Available | 661 | Open in IMG/M |
| 3300022068|Ga0212021_1001260 | Not Available | 2913 | Open in IMG/M |
| 3300022068|Ga0212021_1059025 | Not Available | 783 | Open in IMG/M |
| 3300022072|Ga0196889_1064416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300022159|Ga0196893_1029710 | Not Available | 513 | Open in IMG/M |
| 3300022167|Ga0212020_1029207 | Not Available | 918 | Open in IMG/M |
| 3300022168|Ga0212027_1023572 | Not Available | 833 | Open in IMG/M |
| 3300022183|Ga0196891_1009929 | Not Available | 1892 | Open in IMG/M |
| 3300022183|Ga0196891_1016557 | All Organisms → Viruses → Predicted Viral | 1420 | Open in IMG/M |
| 3300022183|Ga0196891_1024965 | Not Available | 1133 | Open in IMG/M |
| 3300022187|Ga0196899_1130901 | Not Available | 714 | Open in IMG/M |
| 3300022200|Ga0196901_1247362 | Not Available | 554 | Open in IMG/M |
| 3300022926|Ga0255753_1170235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300024248|Ga0228676_1074813 | Not Available | 752 | Open in IMG/M |
| 3300024348|Ga0244776_10276119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
| 3300025070|Ga0208667_1000259 | All Organisms → Viruses | 24665 | Open in IMG/M |
| 3300025083|Ga0208791_1005984 | All Organisms → Viruses → Predicted Viral | 3251 | Open in IMG/M |
| 3300025084|Ga0208298_1014490 | All Organisms → Viruses → Predicted Viral | 1851 | Open in IMG/M |
| 3300025103|Ga0208013_1007703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 3619 | Open in IMG/M |
| 3300025108|Ga0208793_1024579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2075 | Open in IMG/M |
| 3300025120|Ga0209535_1002116 | Not Available | 13011 | Open in IMG/M |
| 3300025120|Ga0209535_1017234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3770 | Open in IMG/M |
| 3300025137|Ga0209336_10006417 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 5095 | Open in IMG/M |
| 3300025137|Ga0209336_10013350 | All Organisms → cellular organisms → Bacteria | 3149 | Open in IMG/M |
| 3300025543|Ga0208303_1096540 | Not Available | 631 | Open in IMG/M |
| 3300025610|Ga0208149_1141782 | Not Available | 553 | Open in IMG/M |
| 3300025630|Ga0208004_1086096 | Not Available | 768 | Open in IMG/M |
| 3300025632|Ga0209194_1084079 | Not Available | 832 | Open in IMG/M |
| 3300025653|Ga0208428_1021864 | All Organisms → Viruses → Predicted Viral | 2103 | Open in IMG/M |
| 3300025671|Ga0208898_1001768 | All Organisms → cellular organisms → Bacteria | 13915 | Open in IMG/M |
| 3300025671|Ga0208898_1002520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11193 | Open in IMG/M |
| 3300025671|Ga0208898_1038874 | All Organisms → Viruses → Predicted Viral | 1845 | Open in IMG/M |
| 3300025671|Ga0208898_1111511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300025674|Ga0208162_1033093 | Not Available | 1870 | Open in IMG/M |
| 3300025674|Ga0208162_1035777 | All Organisms → Viruses → Predicted Viral | 1772 | Open in IMG/M |
| 3300025751|Ga0208150_1046642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1484 | Open in IMG/M |
| 3300025759|Ga0208899_1000675 | Not Available | 25426 | Open in IMG/M |
| 3300025759|Ga0208899_1002431 | Not Available | 12428 | Open in IMG/M |
| 3300025759|Ga0208899_1028387 | Not Available | 2659 | Open in IMG/M |
| 3300025759|Ga0208899_1039807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2109 | Open in IMG/M |
| 3300025759|Ga0208899_1066817 | All Organisms → Viruses → Predicted Viral | 1459 | Open in IMG/M |
| 3300025759|Ga0208899_1073445 | Not Available | 1361 | Open in IMG/M |
| 3300025759|Ga0208899_1096461 | Not Available | 1113 | Open in IMG/M |
| 3300025769|Ga0208767_1036063 | Not Available | 2478 | Open in IMG/M |
| 3300025769|Ga0208767_1043347 | All Organisms → Viruses → Predicted Viral | 2171 | Open in IMG/M |
| 3300025769|Ga0208767_1251643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300025810|Ga0208543_1051360 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300025816|Ga0209193_1035358 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
| 3300025818|Ga0208542_1108724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300025818|Ga0208542_1152503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300025828|Ga0208547_1048511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1485 | Open in IMG/M |
| 3300025853|Ga0208645_1028961 | All Organisms → Viruses → Predicted Viral | 2905 | Open in IMG/M |
| 3300025889|Ga0208644_1014412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5214 | Open in IMG/M |
| 3300025889|Ga0208644_1021040 | All Organisms → Viruses → Predicted Viral | 4108 | Open in IMG/M |
| 3300025889|Ga0208644_1023866 | All Organisms → Viruses → Predicted Viral | 3796 | Open in IMG/M |
| 3300025889|Ga0208644_1034323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2997 | Open in IMG/M |
| 3300025889|Ga0208644_1209233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
| 3300025889|Ga0208644_1350259 | Not Available | 564 | Open in IMG/M |
| 3300027753|Ga0208305_10298722 | Not Available | 564 | Open in IMG/M |
| 3300027779|Ga0209709_10333627 | Not Available | 630 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10018041 | All Organisms → Viruses → Predicted Viral | 2795 | Open in IMG/M |
| 3300027917|Ga0209536_100141917 | Not Available | 3036 | Open in IMG/M |
| 3300028282|Ga0256413_1018897 | All Organisms → Viruses → Predicted Viral | 2138 | Open in IMG/M |
| 3300028282|Ga0256413_1118609 | Not Available | 960 | Open in IMG/M |
| 3300031519|Ga0307488_10012028 | Not Available | 7012 | Open in IMG/M |
| 3300031675|Ga0302122_10336690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300031766|Ga0315322_10290625 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
| 3300031851|Ga0315320_10002742 | All Organisms → Viruses | 14502 | Open in IMG/M |
| 3300031851|Ga0315320_10020690 | Not Available | 5242 | Open in IMG/M |
| 3300031851|Ga0315320_10173160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1607 | Open in IMG/M |
| 3300032088|Ga0315321_10110071 | Not Available | 1870 | Open in IMG/M |
| 3300032088|Ga0315321_10376710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
| 3300034101|Ga0335027_0120120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1973 | Open in IMG/M |
| 3300034374|Ga0348335_001710 | All Organisms → cellular organisms → Bacteria | 15862 | Open in IMG/M |
| 3300034374|Ga0348335_004636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8687 | Open in IMG/M |
| 3300034374|Ga0348335_004975 | All Organisms → cellular organisms → Bacteria | 8335 | Open in IMG/M |
| 3300034374|Ga0348335_006051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7360 | Open in IMG/M |
| 3300034374|Ga0348335_017618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3567 | Open in IMG/M |
| 3300034418|Ga0348337_002914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12323 | Open in IMG/M |
| 3300034418|Ga0348337_021476 | All Organisms → Viruses → Predicted Viral | 3237 | Open in IMG/M |
| 3300034418|Ga0348337_082758 | Not Available | 1114 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 46.85% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.24% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.06% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.87% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.33% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.54% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.76% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.76% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.76% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.97% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.97% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.18% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.39% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.39% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.39% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.39% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.39% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.39% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.39% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.39% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.39% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.39% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007280 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ18 time point | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031675 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCM | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100118667 | 3300000101 | Marine | MSMEMEIAKAQNEVKCAKRDVEKASNRLAFVNSAIHNLKERMSEDIQL* |
| DelMOSum2010_101691353 | 3300000101 | Marine | MEIAKAKNELNCAEADIAKAHKRMAFCLSALHNIKNRDIEETEI* |
| DelMOSum2010_101818811 | 3300000101 | Marine | MKDILKSMETEIAKAKNELGCAEGDIAKAQRRIAFCLSALHNLKNRDIEDKQI* |
| DelMOSpr2010_100192545 | 3300000116 | Marine | MKDILKSMETEIAKAKNELGCAXGDISKAQRRIAFCLSALHNLKNRDIEDKQI* |
| DelMOSpr2010_100721155 | 3300000116 | Marine | MEIAKAQNEVRCAKADVEKASNRLAFCLSAVHNLKDRLDKDIQE* |
| DelMOSpr2010_100754255 | 3300000116 | Marine | AKAKNELNCAEADIAKAHKRMAFCLSALHNLKNRDIEETEI* |
| DelMOWin2010_101452731 | 3300000117 | Marine | IAKAKNELNCAEADIAKAHKRMAFCLSALHNLKNRDIEETEI* |
| OpTDRAFT_100494955 | 3300000928 | Freshwater And Marine | AKAQNELRCAKADVEKASNRIAFCLSAIHNLNDRDLKE* |
| BBAY94_100942831 | 3300000949 | Macroalgal Surface | MDILKSMEMEIAKAQNEVKCAKRDVEKASNRLAFVSSAIQHLNNRDIKE* |
| Ga0055584_1003707054 | 3300004097 | Pelagic Marine | MEIAKAKNEIKCAEGDIQKANNRIAFCLSAIHNLTNRDIKE* |
| Ga0055584_1005898793 | 3300004097 | Pelagic Marine | MEIAKAQNEIRCAKADVEKASNRLAFCLSAVHNLKDRLDKDIQE* |
| Ga0055584_1019648883 | 3300004097 | Pelagic Marine | MEMEIAKAQNEVKCAKADVEKASNRLAFVSSAIQHLNNRDIKE* |
| Ga0066223_104420912 | 3300004461 | Marine | MQIWNNKTPVEILKSMNTELAKAQNELKSARADVEKASNRIAFCLSAIHNLNDRDLKE* |
| Ga0076924_13903315 | 3300005747 | Marine | SMEMEIAKAQNEIRCARADVEKASNRIAFCLSAVHNIKDRLDKDIKE* |
| Ga0078893_145237294 | 3300005837 | Marine Surface Water | MNMEMAKAQNEIKCAKADAEKASNRIAFCLSALYHLKDRDLKEK* |
| Ga0075474_1000043118 | 3300006025 | Aqueous | MEIAKAQNEIRCARADVEKASSRLAFTLSAVHNLKDRLDKDQ* |
| Ga0075474_100401564 | 3300006025 | Aqueous | MKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLTAIHALKNRDIKE* |
| Ga0075474_100695402 | 3300006025 | Aqueous | MEMEIAKSQNEIRCAEADISKAQKRIAFCLSALHNLKHRDIKETKI* |
| Ga0075478_101359122 | 3300006026 | Aqueous | MKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLSAVHHLKNRDIKE* |
| Ga0075478_101395261 | 3300006026 | Aqueous | KVMKIWNQHSHQDILKSLEMEIAKAQNEVKCAEKDIQKAKGRITFCLSAILNLQTRNEDIKE* |
| Ga0075478_101547493 | 3300006026 | Aqueous | ILKSMEMEIAKSQNEIRCAEADISKAQKRIAFCLSALHNLKHRDIKETKI* |
| Ga0075462_1000065610 | 3300006027 | Aqueous | MESEIAKAQNEVRCAEGDIRKAQNRIAFCLSAIHNLKDRDIKE* |
| Ga0075462_100019219 | 3300006027 | Aqueous | MEMEIAKAKNELNCAEADIAKAHKRMAFCLSALHNIKNRDIEETEI* |
| Ga0075462_100040853 | 3300006027 | Aqueous | MEAEIAKAQNELRCARGDVEKASSRIAFCLSAIHSLKDRDIKE* |
| Ga0075462_101298761 | 3300006027 | Aqueous | MNTELAKAQNELKCARADVEKASNRIAFCLSAIHNLNDRDLKE* |
| Ga0075470_102314602 | 3300006030 | Aqueous | MAKAQNELRCAEADVQKAKNRIAFAISAIHNLRDRDLKE* |
| Ga0075502_13653063 | 3300006357 | Aqueous | MEIWDKHQTIEVLKSMETEIAKAQNELRCAGGDIAKAHKRIAFCLSALHNLKKRDIKE* |
| Ga0075506_17291054 | 3300006401 | Aqueous | MEIAKAQNEVRCAKADVEKASNRLAFCLSAVHNLKDRLD |
| Ga0075506_17791303 | 3300006401 | Aqueous | KIWNQHSHQDILKSLEMEIAKAQNEVKCAEKDIQKAKGRITFCLSAILNLQTRNEDIKE* |
| Ga0075511_17266852 | 3300006402 | Aqueous | MEIAKAQNEVKCAEKDIQKAKGRITFCLSAILNLQTRNEDIKE* |
| Ga0098058_12018762 | 3300006750 | Marine | MEIAKAKNGLRCAEKDMSKAQNRIAFTLSAIHNLNDRDIKD* |
| Ga0098048_100059022 | 3300006752 | Marine | MEMEIAKAQNEVKCAKADVVKASNRLAFVSSAIHNLKKRCPQDIKL* |
| Ga0098048_10040227 | 3300006752 | Marine | MEMEIAKAQNELRCAERDIRKAQSRIAFTLSAIHNLNDRDIKD* |
| Ga0098048_11666221 | 3300006752 | Marine | EIAKAKNELRCAEKDMSKAQNRIAFTLSAIHNLKDRDIKE* |
| Ga0098048_12172121 | 3300006752 | Marine | SMEMEIAKAQNEVKCAKADVVKASNRLAFITSAIHNLKNRCPQDIEL* |
| Ga0098044_11729564 | 3300006754 | Marine | METEIAKSQNELRCARGDIAKAQSRIAFCLSAIHNLNNRDMRSITNRDIKE* |
| Ga0098054_100045715 | 3300006789 | Marine | MEIAKAKNELRCAEKDMSKAQNRIAFTLSAIHNLKDRDIKE* |
| Ga0098074_10518424 | 3300006790 | Marine | MEIAKAQNEIRCAEGDITKAQKRMAFCLSALHSLKDRDIEDKQI* |
| Ga0070749_1000045618 | 3300006802 | Aqueous | MEMEIAKAQNEIKCAYADIDKANKRLAFTLSAIHNLKDRTEDLKK* |
| Ga0070749_1000170517 | 3300006802 | Aqueous | MEIAKAQNEVRCAYKDVEKASNRLAFCLSAVHNLKDRLDKDLQE* |
| Ga0070749_100111416 | 3300006802 | Aqueous | MEIAKAQNEVRCARKDVEKASNRLAFCLSAVHNLKDRIDKDQ* |
| Ga0070749_100180627 | 3300006802 | Aqueous | MEIAKAQNEIRCAKADVEKASNRIAFCLTAIHDLKNRDLEE* |
| Ga0070749_101325841 | 3300006802 | Aqueous | KSLQDIMKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLSAVHHLKNRDIKE* |
| Ga0070749_102302451 | 3300006802 | Aqueous | SQNEIRCAEADISKAQKRIAFCLSAIHNLKNRDIKETKI* |
| Ga0070749_102500631 | 3300006802 | Aqueous | QHTIQEILKSMEMEIAKAKNEVKCAEGDIQKANNRIAFCLSAIHNLTNRDIKE* |
| Ga0070749_103671263 | 3300006802 | Aqueous | MEMEIAKAQNEIRCAKADVEKASNRLAFVSSAILHLNDRDIKE* |
| Ga0070749_105476291 | 3300006802 | Aqueous | MKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLSAVHHLKN |
| Ga0070749_105507801 | 3300006802 | Aqueous | MEQEIAKAQNEIRCAEGDISKAQKRIAFALSALHNLHHRDIKE* |
| Ga0070749_107701472 | 3300006802 | Aqueous | MEIAKAQNELRCAERDIRKAQNRIAFTLSAIHNLNERDIKE* |
| Ga0075467_105380262 | 3300006803 | Aqueous | MEAEIAKAQNELRCAKGDVEKASSRIAFCLSAIHSLKDRDIKE* |
| Ga0070754_100111046 | 3300006810 | Aqueous | MEQEIAKAQNEIRCAEGDISKAQKRIAFALSALHNLHHRDIKD* |
| Ga0070754_100180601 | 3300006810 | Aqueous | IMQIWNNHSIQEILKSMEMEIAKSQNEIRCAEADISKAQKRIAFCLSALHNLKHRDIKETKI* |
| Ga0070754_100384242 | 3300006810 | Aqueous | MEVLKSMETEIAKAQNELRCAGGDIAKAHKRIAFCLSALHNLKKRDIKE* |
| Ga0070754_100524225 | 3300006810 | Aqueous | MEMEIAKSQNEIRCAEADISKAQKRIAFCLSAIHNLKNRDIKETKI* |
| Ga0070754_102210582 | 3300006810 | Aqueous | MEMEIAKAQNEIRCAEGDIAKAQRRIAFCLSALHNLHDRDIKETKI* |
| Ga0075476_100058335 | 3300006867 | Aqueous | MEIAKALNEISCARKDVEKASSRLAFTLSAVHNLKDRLDKDE* |
| Ga0075476_100372611 | 3300006867 | Aqueous | MKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLTAI |
| Ga0075477_100065389 | 3300006869 | Aqueous | MQIWNNHSIQEILKSMEMEIAKSQNEIRCAEADISKAQKRIAFCLSALHNLKHRDIKETKI* |
| Ga0075479_101907281 | 3300006870 | Aqueous | KSLQDIMKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLTAIHALKNRDIKE* |
| Ga0070750_100186026 | 3300006916 | Aqueous | MEILKSMEMEIAKAKNEVKCAEGDIAKANNRIAFCLSAIHNLTNRDIKE* |
| Ga0070750_100193723 | 3300006916 | Aqueous | MEIAKAQNELRCAERDIRKAQNRIAFTLSAIHNLNDRDIKE* |
| Ga0070750_100278835 | 3300006916 | Aqueous | SMEMEIAKAQNELRCAERDIRKAQNRIAFTLSAIHNLNERDIKE* |
| Ga0070750_100432095 | 3300006916 | Aqueous | MEMEIAKAQNEISCAKGDIAKAQKRIAFCLSALHNLHNRDIKETEI* |
| Ga0070750_103055681 | 3300006916 | Aqueous | VLKSMEMEIAKAQNEIRCAKADVEKASNRLAFCLSAVHNLKDRLDKDIQE* |
| Ga0070750_103236681 | 3300006916 | Aqueous | NCAEADIAKAHKRMAFCLSALHNIKNRDIEETEI* |
| Ga0070750_103772242 | 3300006916 | Aqueous | MKDILKSMEMEIAKAKNELGCAEGDIIKAQKRIAFCLSALHNLKNRDIEEK* |
| Ga0070746_100102009 | 3300006919 | Aqueous | MDILKSMEMEIAKAKNEVKCAQGDIAKANNRIAFCLSAIHNLTNRDIKE* |
| Ga0070746_100179738 | 3300006919 | Aqueous | MEIAKALNEISCARKDVEKASSRLAFTLSAVHNLKDRLDKDQ* |
| Ga0070746_100248775 | 3300006919 | Aqueous | MEIAKAQNEIRCAKKDVEKASNRLAFCLSAVHNLKDRLDKDE* |
| Ga0070746_103268813 | 3300006919 | Aqueous | EMEIAKAKNELGCAEGDITKAQRRIAFCLSALHNLKNRDIEDKQI* |
| Ga0070746_103505131 | 3300006919 | Aqueous | NEIRCAKKDVEKASNRLAFCLSAVHNLKDRLDKDQ* |
| Ga0070748_12933762 | 3300006920 | Aqueous | MKDILKSMEMEIAKAKNELGCAEGDITKAQRRIAFCLSALHNLKNRDIEEK* |
| Ga0098051_10130874 | 3300006924 | Marine | MEMEIAKAKNELRCAEKDMSKAQNRIAFTLSAIHNLKDRDIKE* |
| Ga0098046_11361022 | 3300006990 | Marine | EIIKSMEMEIAKAQNELRCAERDIRKAQSRIAFTLSAIHNLNDRDIKD* |
| Ga0075460_1000008917 | 3300007234 | Aqueous | MEIAKAQNEIKCAYADIDKANKRLAFTLSAIHNLKDRTEDLKK* |
| Ga0075460_100289771 | 3300007234 | Aqueous | ILKSMEMEIAKAQNEIKCAKADVEKASNRIAFCLSAIHNLTNRDIKE* |
| Ga0075463_100469481 | 3300007236 | Aqueous | KALNEISCARKDVEKASSRLAFTLSAVHNLKDRLDKDQ* |
| Ga0101452_1181414 | 3300007280 | Marine Surface Water | MAKAQNEIKCAKADAEKASNRIAFCLSALYHLKDRDLKEK* |
| Ga0070745_10990795 | 3300007344 | Aqueous | KSMEMEIAKAQNEIRCAKADVEKASNRLAFCLSAVHNLKDRLDKDIQE* |
| Ga0070752_11446113 | 3300007345 | Aqueous | MEIAKAQNEVRCAKADVEKASNRLAFCLSAVHNLKDRLDKDLQE* |
| Ga0070752_11904714 | 3300007345 | Aqueous | KSMEMEIAKAQNEIRCAKADVEKASNRIAFCLTALHDLKNRDLEE* |
| Ga0070752_12637801 | 3300007345 | Aqueous | QEVLKSMEMEIAKAQNEIRCAKKDVEKASNRLAFCLSAVHNLKDRLDKDE* |
| Ga0070752_14030781 | 3300007345 | Aqueous | IAKSQNELRCAKADVEKASKRISFCLSAIHNIKDRLEKDM* |
| Ga0070753_11214824 | 3300007346 | Aqueous | EIAKAQNEIRCAKADVEKASNRIAFCLTAIHDLKNRDIEE* |
| Ga0099849_10058946 | 3300007539 | Aqueous | MEIAKAQNELKCAKADVDKASSRIAFCLSAIHALKNRDIKE* |
| Ga0099847_10005145 | 3300007540 | Aqueous | MEIAKAKNELKCAEGDIQKANNRIAFCLSAIHNLTNRDIKE* |
| Ga0070751_10585065 | 3300007640 | Aqueous | EVLKSMEMEIAKALNEISCARKDVEKASSRLAFTLSAVHNLKDRLDKDE* |
| Ga0070751_12071232 | 3300007640 | Aqueous | MEIAKAQNEIRCARADVEKASNRLAFCLSAVHNLKDRLDKDE* |
| Ga0075480_101470114 | 3300008012 | Aqueous | MEMEIAKSQNELRCAKADVEKASKRISFCLSAIHNIKDRLEKDM* |
| Ga0102963_10028185 | 3300009001 | Pond Water | MEIAKAQNEIRCARADVEKASNRMAFVLSAVHNLKDRLDKDIQE* |
| Ga0102860_12369542 | 3300009056 | Estuarine | MELAKAQNELRCAEADVVKAKNRMAFVISAVHHLKDKGIKE* |
| Ga0102814_103807393 | 3300009079 | Estuarine | MEAEIAKAKNELSCAEGDIQKAKGRITFIISAIHNLNSRDIEE* |
| Ga0102815_108941331 | 3300009080 | Estuarine | MEQEIAKAQNELRCAERDVRKAQNRIAFTLSAIHNLNDRDIKE* |
| Ga0114997_101645045 | 3300009425 | Marine | EIAKAQNELRCAEGDIAKAKSRIAFSLSAIHNLNDRDIKE* |
| Ga0114997_105424111 | 3300009425 | Marine | METEIAKAQNELRCAEGDIAKAKSRIAFSLSAIHNLNDRDIEE* |
| Ga0115545_10823233 | 3300009433 | Pelagic Marine | MEIAKAKNELSCAEADIAKAHKRMAFCLSALHNIKNRDIEETEI* |
| Ga0115546_11445561 | 3300009435 | Pelagic Marine | NHTIKDILKSMEMEIAKAKNELSCAEADIAKAHKRMAFCLSALHNIKNRDIEETEI* |
| Ga0115546_12033191 | 3300009435 | Pelagic Marine | KDILKSMEMEIAKAKNELGCAEGDIIKAQKRIAFCLSALHNLKNRDIEEK* |
| Ga0115000_100242418 | 3300009705 | Marine | METEIAKAQNELRCAEGDIAKAKSRIAFSLSAIHNLNDRDIKE |
| Ga0115000_107326061 | 3300009705 | Marine | MEIAKAQNELRCAEGDIAKAKSRIAFSLSAIHNLNDRDIKE |
| Ga0129348_10756982 | 3300010296 | Freshwater To Marine Saline Gradient | MEIAKAQNEIKCAKADVDKASSRIAFCLTAIHALKNRDIKE* |
| Ga0129348_11088713 | 3300010296 | Freshwater To Marine Saline Gradient | MEIAKAQNELKCAKADVDKASSRIAFCLTAIHALKNR |
| Ga0129348_13075362 | 3300010296 | Freshwater To Marine Saline Gradient | MEIAKAKNELNCAEADVAKAHKRMAFCLSALHNIKNRDIEETEI* |
| Ga0129351_10785911 | 3300010300 | Freshwater To Marine Saline Gradient | NMQIWNTKSLQDIIKSLEMEIAKAQNELKCAKADVDKASSRIAFCLTAIHALKNRDIKE* |
| Ga0129333_100891055 | 3300010354 | Freshwater To Marine Saline Gradient | MELAKAQNELRCAESDVVKAKNRIAFVISAVHNLKDRDLQEKKV* |
| Ga0129324_100232944 | 3300010368 | Freshwater To Marine Saline Gradient | QNEVKCAKADVEKASNRLAFVSSAIQHLNNRDIEE* |
| Ga0129324_102053713 | 3300010368 | Freshwater To Marine Saline Gradient | MEIAKAKNELNCAEADIAKAHKRMAFCLSALHNLKNRDIEETEI* |
| Ga0129324_103622941 | 3300010368 | Freshwater To Marine Saline Gradient | QNEIRCAKADVEKASNRLAFCLSAVHNLKDRLDKDIQE* |
| Ga0129336_101701704 | 3300010370 | Freshwater To Marine Saline Gradient | MELAKAQNELRCAESDVVKAKNRIAFVISAVHNLKDRDLQEKQV* |
| Ga0133547_118065602 | 3300010883 | Marine | MEAEIAKAKNELSCAEGDIQKAKGRITFIISAIHNLNNRDIEE* |
| Ga0163179_100466644 | 3300012953 | Seawater | MEIAKAKNELRCAEKDMNKAQNRIAFTLSAIHHLNDRDIKE* |
| Ga0180120_1000265112 | 3300017697 | Freshwater To Marine Saline Gradient | MKDILKSMETEIAKAKNELGCAEGDISKAQRRIAFCLSALHNLKNRDIEDKQI |
| Ga0180120_101605663 | 3300017697 | Freshwater To Marine Saline Gradient | MEIAKAKNELKCAEGDIQKANNRIAFCLSAIHNLTNRDIKE |
| Ga0181390_10022996 | 3300017719 | Seawater | MEMEIAKAQNEVKCAKRDVEKASNRLAFVSSAIHNLKQRMPDDIQL |
| Ga0181390_10067551 | 3300017719 | Seawater | AKNELGCAEGDISKAQRRIAFCLSALHNLKNRDIEEK |
| Ga0181390_10093093 | 3300017719 | Seawater | MEMEIAKAKNELNCAEADVAKAHKRMAFCLSALHNIKNRDIEETKI |
| Ga0181390_10107365 | 3300017719 | Seawater | MEIAKAKNELGCAEGDIAKAHKRIAFCLSALHNLKNRDIEENKI |
| Ga0181390_11371011 | 3300017719 | Seawater | KAQNEIRCAEKDLLKAQGRLQFALSGLHNLQDRDIQEK |
| Ga0181388_11529371 | 3300017724 | Seawater | MEMEIAKAQNEVKCAKRDVEKASNRLAFVSSAIHNLKSRLNDDTNIEL |
| Ga0181419_11403653 | 3300017728 | Seawater | MEMEIAKAQNEVKCARADVEKASNRLAFVSSAIHNLKGRLSDDTDIEL |
| Ga0181428_10891762 | 3300017738 | Seawater | MEMEIAKAQNEVKCARADVDKASNRLAFVSSAIHNLKDRLQDDIEL |
| Ga0181421_10089273 | 3300017741 | Seawater | MEMEIAKAQSEIRCARADVEKASNRLAFCLSAVHNIKDRLDKDIKE |
| Ga0181399_11106703 | 3300017742 | Seawater | MEMEIAKAQNEVKCAKRDVEKASNRLAFVSSAIHNLKQ |
| Ga0181389_10441422 | 3300017746 | Seawater | MRDILKSMEMEIAKAKNELGCAEGDISKAQRRIAFCLSALHNLKNRDIEEK |
| Ga0181389_11842101 | 3300017746 | Seawater | IVMQIWNNHTIKDILKSMEMEIAKAKNELGCAEGDIAKAHKRIAFCLSALHNLKNRDIEENKI |
| Ga0181392_11919971 | 3300017749 | Seawater | ISMEMEIAKAQNEVKCAKRDVEKASNRLAFVSSAIHNLKQRMPDDIQL |
| Ga0181392_12370531 | 3300017749 | Seawater | QNEIRCAKADVEKASNRMAFVSSAIQHLNNKDIKE |
| Ga0181411_100070421 | 3300017755 | Seawater | MEMEIAKAQNEVKCARADVEKASNRLAFVSSAIHNLKDRLQDDIEL |
| Ga0181420_12220202 | 3300017757 | Seawater | MEMEIAKAQNEVKCARADVEKASNRLAFVSSAIHNLKHRLEDDIEL |
| Ga0181409_11930931 | 3300017758 | Seawater | IAKAQNEIRCAKADVEKASNRMAFVSSAIQHLNNKDIKE |
| Ga0187217_11867482 | 3300017770 | Seawater | MEVLKSMEMEIAKAQNELRCAYKDVEKASKRIAFTISAIHNLKERLDKDIQE |
| Ga0181394_10007105 | 3300017776 | Seawater | MQIWDNHPTKDILKSIEQEVAKAQNEISCARGDISKAQKRMAFALSALHNIKNRDIKE |
| Ga0181394_12353021 | 3300017776 | Seawater | MEIWEKHSTKEVLRSMETEIAKAQNELRCANGDIAKAHKRIAFCLSALHNLKKRDIKE |
| Ga0181423_12895241 | 3300017781 | Seawater | ILKSMEMEIAKAQNEVKCAKRDVEKASNRLAFVTSAIHNLKQRMPDDIQL |
| Ga0181380_11260414 | 3300017782 | Seawater | KIWNNHTIQEILKSMEMEIAKAKNELKCAEGDIAKANSRIAFCISAIHNLTDRDIKE |
| Ga0181380_11896511 | 3300017782 | Seawater | MQIWNNHTIKEILKSMEMEIAKAKNELNCAEADVAKAHKRMAFCLSALHNIKNRDIEETK |
| Ga0181607_100172494 | 3300017950 | Salt Marsh | MEMEIAKAQNEVKCAKADVEKASNRLAFVSSAIQHLNNRDIKE |
| Ga0181607_100550653 | 3300017950 | Salt Marsh | MEMEIAKAQNEIRCARADVEKASNRMAFCLSAVHNIKDRLDKDIKE |
| Ga0181607_107135911 | 3300017950 | Salt Marsh | VDVLKSMETEIAKAQNELRCAGGDIAKAHKRIAFCLSALHNLKKRDIKE |
| Ga0181577_101220725 | 3300017951 | Salt Marsh | MEMEIAKAQNEISCAKGDIAKAQKRIAFCLSALHNLHERDIKE |
| Ga0181580_100209373 | 3300017956 | Salt Marsh | MEIAKAQNEIRCAKADVEKASNRIAFCLTAIHDLKNRDLEE |
| Ga0181581_100215975 | 3300017962 | Salt Marsh | MEIAKAQNEIRCAKADVEKASNRIAFCLTAIHDLKNRDIEE |
| Ga0181590_100533067 | 3300017967 | Salt Marsh | MEIAKAQNEVRCAKADVEKASNRLAFCLSAVHNLK |
| Ga0181585_102896492 | 3300017969 | Salt Marsh | MEIAKAQNEVRCAKADVEKESNRLAFCLSAVHNLKDRLDKDIQE |
| Ga0181606_102868371 | 3300018048 | Salt Marsh | QNEIRCARADVEKASNRMAFCLSAVHNIKDRLDKDIKE |
| Ga0181606_103372392 | 3300018048 | Salt Marsh | MEIAKAQNEIRCAKADVEKASNRLAFCLSAVHNLKDRLDKDIQE |
| Ga0181592_101109774 | 3300018421 | Salt Marsh | MEIAKAKNELKCAEGDIAKANSRIAFCLSAINNLNDRDIKE |
| Ga0181592_103208822 | 3300018421 | Salt Marsh | MEIAKAQNELRCARADVEKASNRLAFCLSAVHNLKDRLDKDIQE |
| Ga0181591_102138103 | 3300018424 | Salt Marsh | MEIAKAQNEVRCAKADVEKASNRLAFCLSAVHNLKDRLDKDIQE |
| Ga0181566_108744651 | 3300018426 | Salt Marsh | MEMEIAKAQNEIRCAQGDILKAQKRIAFCLSALHNLHDRDIRE |
| Ga0181568_101237022 | 3300018428 | Salt Marsh | MEMEIAKAQNEIRCAQGDILKAQKRIAFCLSALHNLHDRDIKE |
| Ga0181602_103165572 | 3300020173 | Salt Marsh | MEMEIAKAQNEVKCAKADVVKASNRLAFITSAIHNLKTRCPQDIEL |
| Ga0181603_103615431 | 3300020174 | Salt Marsh | MEMEIAKAQNEVKCAKADVVKASNRLAFITSAIHNLK |
| Ga0181604_101099541 | 3300020191 | Salt Marsh | NEVKCAKADVVKASNRLAFITSAIHNLKTRCPQDIEL |
| Ga0181604_101174645 | 3300020191 | Salt Marsh | HTIQEILKSMEMEIAKAQNEIRCARADVEKASNRMAFCLSAVHNIKDRLDKDIKE |
| Ga0206677_1000101026 | 3300021085 | Seawater | MEAEIAKAQNELRCARGDVEKASSRIAFCLSAIHNLKDRDIKE |
| Ga0213863_100683031 | 3300021371 | Seawater | MEKEIAKAQNEINCAHGDIKKASSRLAFCLSALHHLKDRDIKE |
| Ga0213865_100106956 | 3300021373 | Seawater | MEMEIAKAQNEIRCAKADVEKASNRMAFVSSAILHLNNRDIKE |
| Ga0213869_100064549 | 3300021375 | Seawater | MEMEIAKAKNELNCAEADIAKAHKRMAFCLSALHNIKNRDIEETEI |
| Ga0213861_102953944 | 3300021378 | Seawater | AKAQNELKCAQADAKKASNRLAFCISAIHNLTDRDIKE |
| Ga0213861_105336172 | 3300021378 | Seawater | MEIAKAKNELKCAEGDIAKANSRIAFCISAIHNLTDRDIKE |
| Ga0213866_101950754 | 3300021425 | Seawater | MEMEVAKAQNEVKCAKRDVEKASNRLAFVNSAIHNLKDRTKNDIEL |
| Ga0222717_100156097 | 3300021957 | Estuarine Water | MEIAKAQNEIRCAGADVKKASNRLAFCLSAVHNLKDRLDKDIQE |
| Ga0222717_100175906 | 3300021957 | Estuarine Water | MEMEIAKAQNEIRCAKADVEKASNRMAFVSSAIQHLNNRDIKE |
| Ga0222718_100388245 | 3300021958 | Estuarine Water | MEIAKAQNEIRCARADVEKASNRMAFVLSAVHNLKDRLDKDIQE |
| Ga0222718_103478901 | 3300021958 | Estuarine Water | QNEIRCAGADVKKASNRIAFCLSAVHNIKDRLDKDIQE |
| Ga0222718_103661872 | 3300021958 | Estuarine Water | METEIAKAQNELRCAYKDVEKASKRIAFTLSAVHNLKERLDKDIQE |
| Ga0222713_101786912 | 3300021962 | Estuarine Water | MELAKAQNELRCAEADVVKAKNRMAFVISAVHHLKDKGIKE |
| Ga0222719_104209403 | 3300021964 | Estuarine Water | MEIAKAKNEVKCAEGDIAKANNRIAFCLSAIHNLTNRDIKE |
| Ga0196883_10207603 | 3300022050 | Aqueous | MEQEIAKAQNEIRCAEGDISKAQKRIAFALSALHNLHHRDIKE |
| Ga0196883_10303491 | 3300022050 | Aqueous | GNNHSIQEILKSMEMEIAKSQNEIRCAEADISKAQKRIAFCLSALHNLKHRDIKETKI |
| Ga0212025_10166683 | 3300022057 | Aqueous | MEMEIAKSQNEIRCAEADISKAQKRIAFCLSALHNLKHRDIKETKI |
| Ga0212025_10311042 | 3300022057 | Aqueous | MEIAKAQNEVKCAEKDIQKAKGRITFCLSAILNLQTRNEDIKE |
| Ga0212024_10620831 | 3300022065 | Aqueous | LKSMETEIAKAQNEIRCASADVKKASNRLAFCLSAVHNLKDRQDKDIKE |
| Ga0212021_10012605 | 3300022068 | Aqueous | MEMEIAKAQNELRCARADVEKASNRIAFCLSAIHNLTDRDIKE |
| Ga0212021_10590252 | 3300022068 | Aqueous | MEIAKAQNEIRCARADVEKASSRLAFTLSAVHNLKDRLDKDQ |
| Ga0196889_10644162 | 3300022072 | Aqueous | MEAEIAKAQNELRCARGDVEKASSRIAFCLSAIHSLKDRDIKE |
| Ga0196893_10297102 | 3300022159 | Aqueous | GTKIMQIWNNHSIQEILKSMEMEIAKSQNEIRCAEADISKAQKRIAFCLSALHNLKHRDIKETKI |
| Ga0212020_10292073 | 3300022167 | Aqueous | MEQEIAKAQNEIRCAEGDISKAQKRIAFALSALHNLHHRDIKD |
| Ga0212027_10235724 | 3300022168 | Aqueous | KVLKSMEMEIAKAQNEVRCAKADVEKASNRLAFCLSAVHNLKDRLDKDIQE |
| Ga0196891_10099295 | 3300022183 | Aqueous | IQEILKSMEMEIAKAQNELRCARADVEKASNRIAFCLSAIHNLTDRDIKE |
| Ga0196891_10165572 | 3300022183 | Aqueous | MESEIAKAQNEVRCAEGDIRKAQNRIAFCLSAIHNLKDRDIKE |
| Ga0196891_10249651 | 3300022183 | Aqueous | MEMEIAKAQNELRCARADVEKASNRIAFCLSAIHNLTDRDIK |
| Ga0196899_11309013 | 3300022187 | Aqueous | HSIQEILKSMEMEIAKSQNEIRCAEADISKAQKRIAFCLSAIHNLKNRDIKETKI |
| Ga0196901_12473622 | 3300022200 | Aqueous | MEIAKALNEISCARKDVEKASSRLAFTLSAVHNLKDRLDKDE |
| Ga0255753_11702354 | 3300022926 | Salt Marsh | EILKSMEMEIAKAQNEIRCARADVEKASNRMAFCLSAVHNIKDRLDKDIKE |
| Ga0228676_10748132 | 3300024248 | Seawater | MEMEIAKAQNELRCAERDIRKAQNRVAFTISALHNLKERDIKD |
| Ga0244776_102761194 | 3300024348 | Estuarine | MNTEIAKAQNELRCAKADVEKASNRIAFCLSAIHNLNDRDLKE |
| Ga0208667_100025913 | 3300025070 | Marine | MEMEIAKAQNEVKCAKADVVKASNRLAFVSSAIHNLKKRCPQDIKL |
| Ga0208791_10059845 | 3300025083 | Marine | MEMEIAKAQNELRCAERDIRKAQSRIAFTLSAIHNLNDRDIKD |
| Ga0208298_10144905 | 3300025084 | Marine | MEMEIAKAKNELRCAEKDMSKAQNRIAFTLSAIHNLKDRDIKE |
| Ga0208013_10077032 | 3300025103 | Marine | MEIAKAKNELRCAEKDMSKAQNRIAFTLSAIHNLKDRDIKE |
| Ga0208793_10245795 | 3300025108 | Marine | MQIWKEKTIPEIIQSMEMEIAKAKNELRCAEKDMSKAQNRIAFTLSAIHNLKDRDIKE |
| Ga0209535_10021165 | 3300025120 | Marine | MEMEIAKAQNEVKCAKRDVEKASNRLAFVSSAIHNLKDRDLKE |
| Ga0209535_10172345 | 3300025120 | Marine | MEIAKAKNELRCAEGDVAKANNRIAFCLSAIHNLNNRDIKE |
| Ga0209336_100064178 | 3300025137 | Marine | MEMEIAKAQNEVKCAKRDVEKASNRLAFIQSAIHNLKERMSEDIQL |
| Ga0209336_100133506 | 3300025137 | Marine | MEIAKAKNELKCAEGDITKANNRIAFCLSAIHNLTDRDIKE |
| Ga0208303_10965402 | 3300025543 | Aqueous | MEMEIAKAQNEVKCAKADVEKASNRLAFVSSAIQHLNNRDIEE |
| Ga0208149_11417823 | 3300025610 | Aqueous | MKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLTAIH |
| Ga0208004_10860963 | 3300025630 | Aqueous | MEMEIAKAQNEIKCAYADIDKANKRLAFTLSAIHNLKDRTEDLKK |
| Ga0209194_10840794 | 3300025632 | Pelagic Marine | KDILKSMEMEIAKAKNELSCAEADIAKAHKRMAFCLSALHNIKNRDIEETEI |
| Ga0208428_10218644 | 3300025653 | Aqueous | MKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLSAVHHLKNRDIKE |
| Ga0208898_100176817 | 3300025671 | Aqueous | MEIAKAQNEIRCARADVEKASSRLAFTLSAVHNSRLAFTLSAVHNLKDRLDKDQ |
| Ga0208898_10025206 | 3300025671 | Aqueous | MEIAKAQNEVRCAYKDVEKASNRLAFCLSAVHNLKDRLDKDLQE |
| Ga0208898_10388744 | 3300025671 | Aqueous | MEIAKAQNEVRCARKDVEKASNRLAFCLSAVHNLKDRIDKDQ |
| Ga0208898_11115113 | 3300025671 | Aqueous | MEMEIAKAQNEIRCAEGDIAKAQRRIAFCLSALHNLHDRDIKETKI |
| Ga0208162_10330935 | 3300025674 | Aqueous | MEIAKAQNEVRCAYKDVEKASNRIAFCLTAIHDLKNRDIEE |
| Ga0208162_10357775 | 3300025674 | Aqueous | MKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLSAIHALKNRDIKE |
| Ga0208150_10466423 | 3300025751 | Aqueous | MKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLTAIHALKNRDIKE |
| Ga0208899_100067527 | 3300025759 | Aqueous | MEIAKAKNELNCAEADIAKAHKRMAFCLSALHNIKNRDIEETEI |
| Ga0208899_100243114 | 3300025759 | Aqueous | MQIWTSKTTLEILKSMEAEIAKAQNELRCARGDVEKASSRIAFCLSAIHSLKDRDIKE |
| Ga0208899_10283871 | 3300025759 | Aqueous | IIKSMEMEIAKAQNELRCAERDIRKAQNRIAFTLSAIHNLNERDIKE |
| Ga0208899_10398071 | 3300025759 | Aqueous | NHTTMEILKSMEMEIAKAKNEVKCAEGDIAKANNRIAFCLSAIHNLTNRDIKE |
| Ga0208899_10668174 | 3300025759 | Aqueous | MEIAKAQNELRCAERDIRKAQNRIAFTLSAIHNLNDRDIKE |
| Ga0208899_10734454 | 3300025759 | Aqueous | MEIAKALNEISCARKDVEKASSRLAFTLSAVHNLKDRLDKDQ |
| Ga0208899_10964611 | 3300025759 | Aqueous | MKDILKSMETEIAKAKNELGCAEGDIAKAQRRIAFCLSALHNLKNRDIEEN |
| Ga0208767_10360635 | 3300025769 | Aqueous | MKDILKSMETEIAKAKNELGCAEGDIAKAQRRIAFCLSALHNLKNRDIEDKQI |
| Ga0208767_10433471 | 3300025769 | Aqueous | MKSLEMEIAKAQNEIKCAKADVDKASSRIAFCLTAIHAL |
| Ga0208767_12516432 | 3300025769 | Aqueous | ILKSMNTELAKAQNELKCARADVEKASNRIAFCLSAIHNLNDRDLKE |
| Ga0208543_10513601 | 3300025810 | Aqueous | IAKAQNEIKCAEGDVRKAQSRLAFILSAIHNLKTRDIKE |
| Ga0209193_10353584 | 3300025816 | Pelagic Marine | MEIAKAKNELSCAEADIAKAHKRMAFCLSALHNIKNRDIEETEI |
| Ga0208542_11087243 | 3300025818 | Aqueous | MQIWNNHSIQDILKSMEMEIAKAQNEISCAKGDIAKAQKRIAFCLSALHNLHNRDIKETE |
| Ga0208542_11525032 | 3300025818 | Aqueous | MQIWTSKTTLEILKSMEAEIAKAQNELRCAKGDVEKASSRIAFCLSAIHSLKDRDIKE |
| Ga0208547_10485114 | 3300025828 | Aqueous | MEMEIAKSQNEIRCAEADISKAQKRIAFCLSAIHNLKNRDIKETKI |
| Ga0208645_10289616 | 3300025853 | Aqueous | MSQKIKTLEAEIAKAKNELGCAEGDIAKAQRRIAFCLSALHNLKNRDIEDKQI |
| Ga0208644_10144124 | 3300025889 | Aqueous | MEIAKAQNEIRCAKKDVEKASNRLAFCLSAVHNLKDRLDKDE |
| Ga0208644_10210406 | 3300025889 | Aqueous | MEIAKAQNEIKCAKADVDKASSRIAFCLTAIHALKNRDIKE |
| Ga0208644_10238663 | 3300025889 | Aqueous | MEMEIAKAQNEISCAKGDIAKAQKRIAFCLSALHNLHNRDIKETEI |
| Ga0208644_10343231 | 3300025889 | Aqueous | QNEIRCARADVEKASSRLAFTLSAVHNLKDRLDKDQ |
| Ga0208644_12092333 | 3300025889 | Aqueous | MEMEIAKAQNEIRCAKKDVEKASNRLAFCLSAVHNLKDRLDKDQ |
| Ga0208644_13502591 | 3300025889 | Aqueous | MEMEIAKAQNEIRCAKADVEKASSRMAFVSSAIQHLNNRDI |
| Ga0208305_102987222 | 3300027753 | Estuarine | MEAEIAKAKNELSCAEGDIQKAKGRITFIISAIHNLNSRDIEE |
| Ga0209709_103336271 | 3300027779 | Marine | IAKAQNELRCAEGDIAKAKSRIAFSLSAIHNLNDRDIKE |
| (restricted) Ga0233415_100180412 | 3300027861 | Seawater | MEMEIAKAQNEVKCAKRDVDKASNRLAFVSSAIQHLNNKDIKE |
| Ga0209536_1001419175 | 3300027917 | Marine Sediment | MEIWDKHKTKAILQSLEQECAKAQNELNCAQKDVDKAQKRVAFCLSAIHNLKNRDIKE |
| Ga0256413_10188976 | 3300028282 | Seawater | MEIAKAKNELRCAEKDMSKAQNRIAFTLSAIHNLKDR |
| Ga0256413_11186091 | 3300028282 | Seawater | EIAKAQNELRCAERDIRKAQNRVAFTISALHNLKERDIKD |
| Ga0307488_100120281 | 3300031519 | Sackhole Brine | MEMEIAKAQNEIRCAKADVEKASNRLAFVTSAIHNLKDRLDTPNIEL |
| Ga0302122_103366902 | 3300031675 | Marine | KAQNELRCAEGDIAKAKSRIAFSLSAIHNLNDRDIKE |
| Ga0315322_102906253 | 3300031766 | Seawater | MEIAKAKNELNCAEADVAKAHKRMAFCLSALHNIKNRDIEETKI |
| Ga0315320_1000274213 | 3300031851 | Seawater | MEMEIAKAQNEVKCAKRDVVKASNRLAFVSSAIHNLKSRLNDDTNIEL |
| Ga0315320_100206908 | 3300031851 | Seawater | MEMEIAKAKNELGCAEGDIAKAHKRIAFCLSALHNLKNRDIEENKI |
| Ga0315320_101731605 | 3300031851 | Seawater | ELGCAEGDIAKAHKRIAFCLSALHNLKNRDIEETKI |
| Ga0315321_101100715 | 3300032088 | Seawater | MEMEIAKAKNELGCAEGDISKAQRRIAFCLSALHNLKNRDIEEK |
| Ga0315321_103767103 | 3300032088 | Seawater | MKDILKSMEMEIAKAKNELGCAEGDIAKAHKRIAFCLSALHNLKNRDIEENKI |
| Ga0335027_0120120_496_621 | 3300034101 | Freshwater | MELAKAQNELRCAEADVVKAKNRMAFVISAVHHLKDKGIKI |
| Ga0348335_001710_7319_7453 | 3300034374 | Aqueous | MEMEIAKAQNEIRCARADVEKASSRLAFTLSAVHNLKDRLDKDQ |
| Ga0348335_004636_2335_2469 | 3300034374 | Aqueous | MEMEIAKALNEISCARKDVEKASSRLAFTLSAVHNLKDRLDKDE |
| Ga0348335_004975_3927_4058 | 3300034374 | Aqueous | MEMEIAKAQNEIRCAKADVEKASNRIAFCLTAIHDLKNRDLEE |
| Ga0348335_006051_4135_4269 | 3300034374 | Aqueous | MEIAKAQNEIRCAEGDIAKAQRRIAFCLSALHNLHDRDIKETKI |
| Ga0348335_017618_2953_3078 | 3300034374 | Aqueous | MEIAKAQNEIKCAKADVDKASSRIAFCLSAVHHLKNRDIKE |
| Ga0348337_002914_4022_4156 | 3300034418 | Aqueous | MEMEIAKSQNELRCAKADVEKASKRISFCLSAIHNIKDRLEKDM |
| Ga0348337_021476_15_149 | 3300034418 | Aqueous | MEMEIAKALNEISCARKDVEKASSRLAFTLSAVHNLKDRLDKDQ |
| Ga0348337_082758_580_714 | 3300034418 | Aqueous | MEIAKAQNENRCAEGDIAKAQRRIAFCLSALHNLHDRDIKETKI |
| ⦗Top⦘ |