


| Basic Information | |
|---|---|
| Family ID | F015337 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 255 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKTITMKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANIDQLEKLGY |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 255 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 20.78 % |
| % of genes from short scaffolds (< 2000 bps) | 69.41 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.706 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.177 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.706 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.157 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 255 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 3.92 |
| PF07728 | AAA_5 | 2.75 |
| PF14528 | LAGLIDADG_3 | 2.75 |
| PF13392 | HNH_3 | 1.57 |
| PF01541 | GIY-YIG | 1.18 |
| PF00271 | Helicase_C | 1.18 |
| PF00216 | Bac_DNA_binding | 1.18 |
| PF12850 | Metallophos_2 | 0.78 |
| PF02562 | PhoH | 0.39 |
| PF01145 | Band_7 | 0.39 |
| PF01734 | Patatin | 0.39 |
| PF01670 | Glyco_hydro_12 | 0.39 |
| PF03167 | UDG | 0.39 |
| PF12728 | HTH_17 | 0.39 |
| PF05656 | DUF805 | 0.39 |
| PF00154 | RecA | 0.39 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.39 |
| PF13455 | MUG113 | 0.39 |
| PF09603 | Fib_succ_major | 0.39 |
| PF13539 | Peptidase_M15_4 | 0.39 |
| PF00085 | Thioredoxin | 0.39 |
| COG ID | Name | Functional Category | % Frequency in 255 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.18 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.39 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.39 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.39 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.39 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.39 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.39 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.39 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.39 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.39 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.39 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.71 % |
| All Organisms | root | All Organisms | 35.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000052|Draft_c016904 | Not Available | 13047 | Open in IMG/M |
| 3300000229|TB_LI09_3DRAFT_1029110 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
| 3300000882|FwDRAFT_10141210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2580 | Open in IMG/M |
| 3300000929|NpDRAFT_10092409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7897 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_105709064 | Not Available | 512 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106743887 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300002408|B570J29032_109694720 | Not Available | 1072 | Open in IMG/M |
| 3300002447|JGI24768J34885_10042314 | All Organisms → Viruses → Predicted Viral | 1514 | Open in IMG/M |
| 3300002835|B570J40625_100019913 | Not Available | 11390 | Open in IMG/M |
| 3300002835|B570J40625_100246081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1870 | Open in IMG/M |
| 3300002835|B570J40625_100587394 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300002835|B570J40625_101112121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300003277|JGI25908J49247_10005870 | Not Available | 3913 | Open in IMG/M |
| 3300003277|JGI25908J49247_10080405 | Not Available | 804 | Open in IMG/M |
| 3300003277|JGI25908J49247_10146883 | Not Available | 551 | Open in IMG/M |
| 3300003393|JGI25909J50240_1019249 | Not Available | 1583 | Open in IMG/M |
| 3300003429|JGI25914J50564_10000003 | Not Available | 83163 | Open in IMG/M |
| 3300003859|Ga0031653_10127066 | Not Available | 666 | Open in IMG/M |
| 3300003860|Ga0031658_1001871 | All Organisms → Viruses → Predicted Viral | 3830 | Open in IMG/M |
| 3300003860|Ga0031658_1004333 | Not Available | 2498 | Open in IMG/M |
| 3300003860|Ga0031658_1045885 | Not Available | 750 | Open in IMG/M |
| 3300004448|Ga0065861_1178628 | Not Available | 839 | Open in IMG/M |
| 3300004481|Ga0069718_15195717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaB.Bin138 | 513 | Open in IMG/M |
| 3300004481|Ga0069718_15246887 | Not Available | 612 | Open in IMG/M |
| 3300005527|Ga0068876_10123676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Poseidonibacter → unclassified Poseidonibacter → Poseidonibacter sp. SJOD-M-33 | 1533 | Open in IMG/M |
| 3300005580|Ga0049083_10103277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
| 3300005581|Ga0049081_10183250 | Not Available | 756 | Open in IMG/M |
| 3300005662|Ga0078894_10852865 | Not Available | 793 | Open in IMG/M |
| 3300005827|Ga0074478_1750113 | Not Available | 589 | Open in IMG/M |
| 3300005941|Ga0070743_10215564 | Not Available | 628 | Open in IMG/M |
| 3300006484|Ga0070744_10026935 | All Organisms → Viruses → Predicted Viral | 1703 | Open in IMG/M |
| 3300006484|Ga0070744_10033992 | Not Available | 1506 | Open in IMG/M |
| 3300006484|Ga0070744_10177312 | Not Available | 609 | Open in IMG/M |
| 3300006803|Ga0075467_10104667 | Not Available | 1680 | Open in IMG/M |
| 3300006805|Ga0075464_10712756 | Not Available | 621 | Open in IMG/M |
| 3300006805|Ga0075464_10964066 | Not Available | 534 | Open in IMG/M |
| 3300006920|Ga0070748_1019640 | Not Available | 2834 | Open in IMG/M |
| 3300006920|Ga0070748_1053222 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1604 | Open in IMG/M |
| 3300006920|Ga0070748_1164298 | Not Available | 822 | Open in IMG/M |
| 3300006920|Ga0070748_1217609 | Not Available | 694 | Open in IMG/M |
| 3300007169|Ga0102976_1174404 | Not Available | 1164 | Open in IMG/M |
| 3300007216|Ga0103961_1396778 | All Organisms → Viruses → Predicted Viral | 1474 | Open in IMG/M |
| 3300007276|Ga0070747_1040028 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae | 1826 | Open in IMG/M |
| 3300007542|Ga0099846_1147904 | Not Available | 846 | Open in IMG/M |
| 3300007545|Ga0102873_1162538 | Not Available | 672 | Open in IMG/M |
| 3300007550|Ga0102880_1099118 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 766 | Open in IMG/M |
| 3300007651|Ga0102900_1133019 | Not Available | 546 | Open in IMG/M |
| 3300008110|Ga0114343_1030383 | Not Available | 4139 | Open in IMG/M |
| 3300008113|Ga0114346_1000103 | Not Available | 110311 | Open in IMG/M |
| 3300008267|Ga0114364_1059809 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300008448|Ga0114876_1011587 | All Organisms → Viruses → Predicted Viral | 4969 | Open in IMG/M |
| 3300008448|Ga0114876_1019386 | All Organisms → Viruses → Predicted Viral | 3572 | Open in IMG/M |
| 3300008450|Ga0114880_1000016 | Not Available | 87909 | Open in IMG/M |
| 3300008450|Ga0114880_1123011 | Not Available | 972 | Open in IMG/M |
| 3300009026|Ga0102829_1053493 | Not Available | 1214 | Open in IMG/M |
| 3300009026|Ga0102829_1304567 | Not Available | 531 | Open in IMG/M |
| 3300009037|Ga0105093_10668477 | Not Available | 593 | Open in IMG/M |
| 3300009081|Ga0105098_10101078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1245 | Open in IMG/M |
| 3300009082|Ga0105099_10680512 | Not Available | 637 | Open in IMG/M |
| 3300009082|Ga0105099_11027382 | Not Available | 526 | Open in IMG/M |
| 3300009085|Ga0105103_10002433 | Not Available | 9689 | Open in IMG/M |
| 3300009085|Ga0105103_10151888 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum | 1223 | Open in IMG/M |
| 3300009085|Ga0105103_10775432 | Not Available | 555 | Open in IMG/M |
| 3300009085|Ga0105103_10795108 | Not Available | 549 | Open in IMG/M |
| 3300009151|Ga0114962_10000939 | Not Available | 25299 | Open in IMG/M |
| 3300009151|Ga0114962_10027823 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3911 | Open in IMG/M |
| 3300009155|Ga0114968_10166593 | Not Available | 1297 | Open in IMG/M |
| 3300009155|Ga0114968_10615701 | Not Available | 574 | Open in IMG/M |
| 3300009159|Ga0114978_10111038 | All Organisms → Viruses → Predicted Viral | 1799 | Open in IMG/M |
| 3300009165|Ga0105102_10698235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300009169|Ga0105097_10013999 | Not Available | 4176 | Open in IMG/M |
| 3300009169|Ga0105097_10016944 | All Organisms → Viruses → Predicted Viral | 3823 | Open in IMG/M |
| 3300009169|Ga0105097_10028779 | All Organisms → Viruses → Predicted Viral | 2961 | Open in IMG/M |
| 3300009169|Ga0105097_10090473 | Not Available | 1669 | Open in IMG/M |
| 3300009169|Ga0105097_10151093 | Not Available | 1277 | Open in IMG/M |
| 3300009169|Ga0105097_10166431 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
| 3300009169|Ga0105097_10548870 | Not Available | 648 | Open in IMG/M |
| 3300009169|Ga0105097_10729907 | Not Available | 562 | Open in IMG/M |
| 3300009169|Ga0105097_10794253 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 539 | Open in IMG/M |
| 3300009170|Ga0105096_10312605 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 802 | Open in IMG/M |
| 3300009180|Ga0114979_10033049 | All Organisms → Viruses → Predicted Viral | 3276 | Open in IMG/M |
| 3300009181|Ga0114969_10704274 | Not Available | 543 | Open in IMG/M |
| 3300009182|Ga0114959_10045250 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2587 | Open in IMG/M |
| 3300009684|Ga0114958_10058155 | Not Available | 2058 | Open in IMG/M |
| 3300010157|Ga0114964_10003503 | Not Available | 10592 | Open in IMG/M |
| 3300010158|Ga0114960_10223030 | Not Available | 974 | Open in IMG/M |
| 3300010160|Ga0114967_10013323 | Not Available | 6032 | Open in IMG/M |
| 3300010368|Ga0129324_10320064 | Not Available | 607 | Open in IMG/M |
| 3300010885|Ga0133913_10294765 | All Organisms → cellular organisms → Bacteria | 4301 | Open in IMG/M |
| 3300010885|Ga0133913_11996382 | Not Available | 1441 | Open in IMG/M |
| 3300010885|Ga0133913_12555672 | Not Available | 1242 | Open in IMG/M |
| 3300010885|Ga0133913_13227671 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1076 | Open in IMG/M |
| 3300010944|Ga0138501_113479 | Not Available | 948 | Open in IMG/M |
| 3300010945|Ga0139174_120520 | Not Available | 778 | Open in IMG/M |
| 3300010966|Ga0137675_1000206 | Not Available | 5112 | Open in IMG/M |
| 3300011184|Ga0136709_1022546 | Not Available | 872 | Open in IMG/M |
| 3300011184|Ga0136709_1065953 | Not Available | 505 | Open in IMG/M |
| 3300011339|Ga0153700_10026 | Not Available | 62426 | Open in IMG/M |
| 3300012663|Ga0157203_1001959 | All Organisms → Viruses → Predicted Viral | 4779 | Open in IMG/M |
| 3300012667|Ga0157208_10000347 | All Organisms → cellular organisms → Bacteria | 13746 | Open in IMG/M |
| 3300012667|Ga0157208_10003354 | All Organisms → Viruses → Predicted Viral | 2856 | Open in IMG/M |
| 3300012667|Ga0157208_10019705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 907 | Open in IMG/M |
| 3300013006|Ga0164294_10110586 | Not Available | 2026 | Open in IMG/M |
| 3300015050|Ga0181338_1013502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 1318 | Open in IMG/M |
| 3300015050|Ga0181338_1061017 | Not Available | 542 | Open in IMG/M |
| 3300015050|Ga0181338_1065697 | Not Available | 518 | Open in IMG/M |
| 3300017716|Ga0181350_1014198 | All Organisms → Viruses → Predicted Viral | 2257 | Open in IMG/M |
| 3300017716|Ga0181350_1032138 | Not Available | 1443 | Open in IMG/M |
| 3300017722|Ga0181347_1040250 | All Organisms → Viruses → Predicted Viral | 1433 | Open in IMG/M |
| 3300017754|Ga0181344_1009170 | All Organisms → Viruses → Predicted Viral | 3214 | Open in IMG/M |
| 3300017754|Ga0181344_1036245 | Not Available | 1498 | Open in IMG/M |
| 3300017754|Ga0181344_1072231 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1017 | Open in IMG/M |
| 3300017754|Ga0181344_1093122 | Not Available | 878 | Open in IMG/M |
| 3300017761|Ga0181356_1139443 | Not Available | 759 | Open in IMG/M |
| 3300017766|Ga0181343_1037379 | All Organisms → Viruses → Predicted Viral | 1453 | Open in IMG/M |
| 3300017766|Ga0181343_1190405 | Not Available | 564 | Open in IMG/M |
| 3300017774|Ga0181358_1083751 | Not Available | 1161 | Open in IMG/M |
| 3300017774|Ga0181358_1101129 | Not Available | 1033 | Open in IMG/M |
| 3300017778|Ga0181349_1087909 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
| 3300017778|Ga0181349_1115387 | Not Available | 993 | Open in IMG/M |
| 3300017780|Ga0181346_1013939 | Not Available | 3412 | Open in IMG/M |
| 3300017780|Ga0181346_1020340 | All Organisms → Viruses → Predicted Viral | 2794 | Open in IMG/M |
| 3300017780|Ga0181346_1295970 | Not Available | 551 | Open in IMG/M |
| 3300017785|Ga0181355_1020586 | All Organisms → Viruses → Predicted Viral | 2879 | Open in IMG/M |
| 3300017785|Ga0181355_1064660 | All Organisms → Viruses → Predicted Viral | 1541 | Open in IMG/M |
| 3300017785|Ga0181355_1077538 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
| 3300017785|Ga0181355_1088317 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300017785|Ga0181355_1120693 | Not Available | 1073 | Open in IMG/M |
| 3300017785|Ga0181355_1368258 | Not Available | 525 | Open in IMG/M |
| 3300018416|Ga0181553_10360236 | Not Available | 797 | Open in IMG/M |
| 3300019781|Ga0181360_110882 | Not Available | 758 | Open in IMG/M |
| 3300019784|Ga0181359_1053127 | All Organisms → Viruses → Predicted Viral | 1560 | Open in IMG/M |
| 3300019784|Ga0181359_1135166 | Not Available | 865 | Open in IMG/M |
| 3300020048|Ga0207193_1030638 | Not Available | 6234 | Open in IMG/M |
| 3300020158|Ga0194038_1082388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 959 | Open in IMG/M |
| 3300020164|Ga0194037_1000617 | Not Available | 27344 | Open in IMG/M |
| 3300020205|Ga0211731_11113371 | Not Available | 923 | Open in IMG/M |
| 3300020229|Ga0194042_1005240 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3780 | Open in IMG/M |
| 3300020495|Ga0208720_1038762 | Not Available | 504 | Open in IMG/M |
| 3300020541|Ga0208359_1009583 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300020549|Ga0207942_1023978 | Not Available | 774 | Open in IMG/M |
| 3300020562|Ga0208597_1004986 | All Organisms → Viruses → Predicted Viral | 4062 | Open in IMG/M |
| 3300020572|Ga0207909_1064725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300021140|Ga0214168_1084377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium | 698 | Open in IMG/M |
| 3300021141|Ga0214163_1086823 | Not Available | 742 | Open in IMG/M |
| 3300021438|Ga0213920_1000076 | Not Available | 114355 | Open in IMG/M |
| 3300021600|Ga0194059_1086029 | Not Available | 990 | Open in IMG/M |
| 3300021602|Ga0194060_10192315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
| 3300022061|Ga0212023_1049978 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 581 | Open in IMG/M |
| 3300022072|Ga0196889_1058222 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 740 | Open in IMG/M |
| 3300022178|Ga0196887_1037259 | Not Available | 1313 | Open in IMG/M |
| 3300022179|Ga0181353_1075990 | Not Available | 853 | Open in IMG/M |
| 3300022190|Ga0181354_1075191 | Not Available | 1118 | Open in IMG/M |
| 3300022407|Ga0181351_1000025 | Not Available | 42994 | Open in IMG/M |
| 3300022407|Ga0181351_1001878 | Not Available | 7070 | Open in IMG/M |
| 3300022407|Ga0181351_1034259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 2155 | Open in IMG/M |
| 3300022407|Ga0181351_1049053 | All Organisms → Viruses → Predicted Viral | 1766 | Open in IMG/M |
| 3300022407|Ga0181351_1076759 | Not Available | 1340 | Open in IMG/M |
| 3300022407|Ga0181351_1081721 | Not Available | 1286 | Open in IMG/M |
| 3300022407|Ga0181351_1092744 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300022407|Ga0181351_1118051 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum | 999 | Open in IMG/M |
| 3300022543|Ga0212119_1010709 | Not Available | 1763 | Open in IMG/M |
| 3300022543|Ga0212119_1033509 | Not Available | 827 | Open in IMG/M |
| 3300022543|Ga0212119_1047535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300023184|Ga0214919_10000284 | Not Available | 86304 | Open in IMG/M |
| 3300023184|Ga0214919_10039828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4692 | Open in IMG/M |
| 3300023184|Ga0214919_10046534 | Not Available | 4211 | Open in IMG/M |
| 3300024343|Ga0244777_10013179 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 5217 | Open in IMG/M |
| 3300024346|Ga0244775_10003811 | Not Available | 15953 | Open in IMG/M |
| 3300024346|Ga0244775_10399071 | Not Available | 1131 | Open in IMG/M |
| 3300024346|Ga0244775_10785431 | Not Available | 762 | Open in IMG/M |
| 3300024346|Ga0244775_11105806 | Not Available | 621 | Open in IMG/M |
| 3300024549|Ga0256308_1000004 | Not Available | 27337 | Open in IMG/M |
| 3300025091|Ga0209616_1015274 | Not Available | 782 | Open in IMG/M |
| 3300025887|Ga0208544_10390698 | Not Available | 521 | Open in IMG/M |
| 3300027126|Ga0255098_1024301 | Not Available | 994 | Open in IMG/M |
| 3300027185|Ga0208672_1018401 | Not Available | 699 | Open in IMG/M |
| 3300027193|Ga0208800_1021146 | Not Available | 860 | Open in IMG/M |
| 3300027193|Ga0208800_1046491 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 589 | Open in IMG/M |
| 3300027240|Ga0208444_1040036 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 624 | Open in IMG/M |
| 3300027468|Ga0209247_1028078 | Not Available | 782 | Open in IMG/M |
| 3300027631|Ga0208133_1105304 | Not Available | 658 | Open in IMG/M |
| 3300027707|Ga0209443_1249400 | Not Available | 607 | Open in IMG/M |
| 3300027708|Ga0209188_1000083 | Not Available | 111668 | Open in IMG/M |
| 3300027708|Ga0209188_1000156 | Not Available | 77341 | Open in IMG/M |
| 3300027708|Ga0209188_1033134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2447 | Open in IMG/M |
| 3300027710|Ga0209599_10013181 | All Organisms → Viruses → Predicted Viral | 2462 | Open in IMG/M |
| 3300027712|Ga0209499_1034791 | All Organisms → Viruses → Predicted Viral | 2183 | Open in IMG/M |
| 3300027721|Ga0209492_1000086 | Not Available | 29210 | Open in IMG/M |
| 3300027721|Ga0209492_1003125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5254 | Open in IMG/M |
| 3300027721|Ga0209492_1006636 | All Organisms → Viruses → Predicted Viral | 3812 | Open in IMG/M |
| 3300027721|Ga0209492_1079143 | Not Available | 1161 | Open in IMG/M |
| 3300027721|Ga0209492_1082238 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. ACAM 123 | 1136 | Open in IMG/M |
| 3300027721|Ga0209492_1311573 | Not Available | 522 | Open in IMG/M |
| 3300027732|Ga0209442_1075697 | Not Available | 1398 | Open in IMG/M |
| 3300027732|Ga0209442_1249077 | Not Available | 635 | Open in IMG/M |
| 3300027743|Ga0209593_10089239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
| 3300027749|Ga0209084_1015767 | All Organisms → Viruses → Predicted Viral | 4263 | Open in IMG/M |
| 3300027754|Ga0209596_1385219 | Not Available | 530 | Open in IMG/M |
| 3300027757|Ga0208671_10170206 | Not Available | 787 | Open in IMG/M |
| 3300027759|Ga0209296_1398142 | Not Available | 516 | Open in IMG/M |
| 3300027763|Ga0209088_10165979 | Not Available | 965 | Open in IMG/M |
| 3300027785|Ga0209246_10009806 | All Organisms → Viruses → Predicted Viral | 3546 | Open in IMG/M |
| 3300027785|Ga0209246_10202403 | Not Available | 775 | Open in IMG/M |
| 3300027792|Ga0209287_10386970 | Not Available | 538 | Open in IMG/M |
| 3300027798|Ga0209353_10140931 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1078 | Open in IMG/M |
| 3300027805|Ga0209229_10004786 | Not Available | 5653 | Open in IMG/M |
| 3300027805|Ga0209229_10366869 | Not Available | 628 | Open in IMG/M |
| 3300027892|Ga0209550_10434367 | Not Available | 804 | Open in IMG/M |
| 3300027896|Ga0209777_10327050 | Not Available | 1175 | Open in IMG/M |
| 3300027899|Ga0209668_10002310 | Not Available | 8381 | Open in IMG/M |
| 3300027899|Ga0209668_10047148 | Not Available | 2301 | Open in IMG/M |
| 3300027900|Ga0209253_10519833 | Not Available | 885 | Open in IMG/M |
| 3300027900|Ga0209253_10570964 | Not Available | 834 | Open in IMG/M |
| 3300027900|Ga0209253_10980732 | Not Available | 586 | Open in IMG/M |
| 3300027956|Ga0209820_1246003 | Not Available | 502 | Open in IMG/M |
| 3300027972|Ga0209079_10081146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1104 | Open in IMG/M |
| 3300027972|Ga0209079_10099025 | Not Available | 995 | Open in IMG/M |
| 3300028392|Ga0304729_1001303 | Not Available | 16720 | Open in IMG/M |
| 3300028392|Ga0304729_1022042 | All Organisms → Viruses → Predicted Viral | 2702 | Open in IMG/M |
| 3300028394|Ga0304730_1185660 | Not Available | 801 | Open in IMG/M |
| 3300031565|Ga0307379_11249600 | Not Available | 612 | Open in IMG/M |
| 3300031707|Ga0315291_10083241 | All Organisms → Viruses → Predicted Viral | 3494 | Open in IMG/M |
| 3300031746|Ga0315293_10061940 | Not Available | 3225 | Open in IMG/M |
| 3300031746|Ga0315293_10077635 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2843 | Open in IMG/M |
| 3300031787|Ga0315900_10588502 | Not Available | 817 | Open in IMG/M |
| 3300031857|Ga0315909_10132396 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum | 2086 | Open in IMG/M |
| 3300031885|Ga0315285_10013820 | Not Available | 8161 | Open in IMG/M |
| 3300031951|Ga0315904_10747184 | Not Available | 814 | Open in IMG/M |
| 3300031999|Ga0315274_10838320 | Not Available | 968 | Open in IMG/M |
| 3300031999|Ga0315274_11291914 | Not Available | 713 | Open in IMG/M |
| 3300032018|Ga0315272_10000189 | Not Available | 29394 | Open in IMG/M |
| 3300032053|Ga0315284_10933785 | Not Available | 986 | Open in IMG/M |
| 3300032116|Ga0315903_10887287 | Not Available | 639 | Open in IMG/M |
| 3300032177|Ga0315276_10823357 | Not Available | 993 | Open in IMG/M |
| 3300032516|Ga0315273_11544005 | Not Available | 814 | Open in IMG/M |
| 3300033816|Ga0334980_0294294 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium | 631 | Open in IMG/M |
| 3300033978|Ga0334977_0072170 | Not Available | 1880 | Open in IMG/M |
| 3300033984|Ga0334989_0109066 | Not Available | 1537 | Open in IMG/M |
| 3300033984|Ga0334989_0147027 | Not Available | 1308 | Open in IMG/M |
| 3300033984|Ga0334989_0207280 | Not Available | 1075 | Open in IMG/M |
| 3300033992|Ga0334992_0281266 | Not Available | 788 | Open in IMG/M |
| 3300033995|Ga0335003_0157509 | Not Available | 1124 | Open in IMG/M |
| 3300033995|Ga0335003_0248489 | Not Available | 824 | Open in IMG/M |
| 3300033996|Ga0334979_0248854 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. ACAM 123 | 1028 | Open in IMG/M |
| 3300034018|Ga0334985_0007193 | Not Available | 8961 | Open in IMG/M |
| 3300034022|Ga0335005_0000015 | Not Available | 117174 | Open in IMG/M |
| 3300034060|Ga0334983_0054891 | All Organisms → Viruses → Predicted Viral | 2596 | Open in IMG/M |
| 3300034061|Ga0334987_0267568 | Not Available | 1154 | Open in IMG/M |
| 3300034068|Ga0334990_0009194 | Not Available | 5286 | Open in IMG/M |
| 3300034093|Ga0335012_0070398 | All Organisms → Viruses → Predicted Viral | 1990 | Open in IMG/M |
| 3300034104|Ga0335031_0000349 | Not Available | 36817 | Open in IMG/M |
| 3300034104|Ga0335031_0315559 | Not Available | 1011 | Open in IMG/M |
| 3300034105|Ga0335035_0353375 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium | 849 | Open in IMG/M |
| 3300034357|Ga0335064_0058882 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum | 2196 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.18% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 11.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.02% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.31% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.31% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.92% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.35% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.57% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.18% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.18% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.78% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.78% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.78% |
| Wastewater | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.39% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.39% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.39% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.39% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.39% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.39% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.39% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.39% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.39% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.39% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.39% |
| Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.39% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000052 | Coal bed methane well microbial communities from Alberta, Canada | Engineered | Open in IMG/M |
| 3300000229 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3 | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010944 | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate Ab1 | Engineered | Open in IMG/M |
| 3300010945 | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C2 | Engineered | Open in IMG/M |
| 3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020158 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6m | Environmental | Open in IMG/M |
| 3300020164 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020229 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-12m | Environmental | Open in IMG/M |
| 3300020495 | Freshwater microbial communities from Lake Mendota, WI - 20APR2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027126 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027185 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027240 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_01690414 | 3300000052 | Hydrocarbon Resource Environments | MKKIKMEPTEFYHFRKLAFAISLAFGCTITHGVYIVEASIDQLEKLGY* |
| TB_LI09_3DRAFT_10291105 | 3300000229 | Groundwater | MKTIKLKPTEFYQFRKLAFSMSIAFMCTISQGVYIVEANINQLYKLGY* |
| FwDRAFT_101412105 | 3300000882 | Freshwater And Marine | MKTITLQPTEFYQFRQLAFAMSIAFACTIAQGVYIVEASIDQLDKLGY* |
| NpDRAFT_100924091 | 3300000929 | Freshwater And Marine | MKTITLQPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANINQLKQLGY* |
| JGIcombinedJ13530_1057090641 | 3300001213 | Wetland | TIKMKTIELKPTEFFQFRQLAFAMCIAFSCTITQGVYIVEANIDQLKQLGY* |
| JGIcombinedJ13530_1067438872 | 3300001213 | Wetland | MKTITMKPTDFYQFRQLAFAMSIAFACTISQGVYIVEANIDQLQQLGY* |
| B570J29032_1096947202 | 3300002408 | Freshwater | MKKIELKPTEFYHFRKLAFAMSLAFGCTIAHGVYIVEASIDQLEQLGY* |
| JGI24768J34885_100423141 | 3300002447 | Freshwater And Sediment | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEAT* |
| B570J40625_10001991325 | 3300002835 | Freshwater | MKTIKLIPTEFYEFRKLAFAMSIAFVCTMAQGVYIVEASIDQLEQLGY* |
| B570J40625_1002460812 | 3300002835 | Freshwater | MKTITLSPTDFWHFRKLALAMSLAFTCSITHSVYIVEANIDQLEKLGY* |
| B570J40625_1005873941 | 3300002835 | Freshwater | MNKTIELQPTEFWHFRKLAFAISLAFGCTISHGVYIVEASIDQLEQLGY* |
| B570J40625_1011121213 | 3300002835 | Freshwater | EMKTIKLSPVEFWHFRQLAIAMSIAFACTIAQGVYIVEANIDQLQKLGY* |
| JGI25908J49247_100058704 | 3300003277 | Freshwater Lake | MKTITMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANINQLHQLGY* |
| JGI25908J49247_100804051 | 3300003277 | Freshwater Lake | MKTIRMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY* |
| JGI25908J49247_101468831 | 3300003277 | Freshwater Lake | MKTIRLQPTEFWQFRQLAFAMCIAFSCTIAQGVYIVEANIDQLKQLGY* |
| JGI25909J50240_10192493 | 3300003393 | Freshwater Lake | MKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANINQLHQLGY* |
| JGI25914J50564_1000000323 | 3300003429 | Freshwater Lake | MKTIKMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY* |
| Ga0031653_101270662 | 3300003859 | Freshwater Lake Sediment | MKTIELSPTDFWHFRKLAFAXSLAFGCTIXHGVYIVEASIDQLEKLGY* |
| Ga0031658_10018712 | 3300003860 | Freshwater Lake Sediment | MKTITMKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANINQLKQLGY* |
| Ga0031658_10043334 | 3300003860 | Freshwater Lake Sediment | MKTIQMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLQQLGY* |
| Ga0031658_10458853 | 3300003860 | Freshwater Lake Sediment | MKKIKMEPTEFYHFRKLAFAMSLAFGCTIAHGVYIVEASIDQLEKLGY* |
| Ga0065861_11786282 | 3300004448 | Marine | MKTIELSPVDFYHFRKLAFAMSIAFACTITQGVYIVEANINQLEKLGY* |
| Ga0069718_151957172 | 3300004481 | Sediment | MKTIELSPTDFWHFRKLAFAISLAFGCTMSHGVYIVEASIDQLEKLGY* |
| Ga0069718_152468873 | 3300004481 | Sediment | MKTITMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLSQLGY* |
| Ga0068876_101236767 | 3300005527 | Freshwater Lake | TIKLQPVEFWQFRKLALAMSIAFVCSITHGVYIVEANIDQLEQLGY* |
| Ga0049083_101032771 | 3300005580 | Freshwater Lentic | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEANIDQLEQLGY* |
| Ga0049081_101832501 | 3300005581 | Freshwater Lentic | MKTIRLQPTEFWQFRQLAFAMCIAFSCTITQGVYIVEANIDQLKQLGY* |
| Ga0078894_108528652 | 3300005662 | Freshwater Lake | MKTITLKPVEFYHFRQLAFAMSIAFACTIAQGVYIVEANIDQLEQLGY* |
| Ga0074478_17501131 | 3300005827 | Sediment (Intertidal) | MKTIKLTPVDFYRFRQLAFAMCVAFSCTITQGVYIVEANIDQLHKLGY* |
| Ga0070743_102155642 | 3300005941 | Estuarine | MKKIEMKPVEFYHFRKLAFAMSIAFACTIAQGVYIVEANIDQLKQLGY* |
| Ga0070744_100269353 | 3300006484 | Estuarine | MKTIEMKPTEFYEFRKLAFAMCIAFVCTMAQGVYIVEANIDQLEKLGY* |
| Ga0070744_100339922 | 3300006484 | Estuarine | MKTIQLQPTEFWQFRQLAFAMCIAFSCTITQGVYIVEANIDQLHKLGY* |
| Ga0070744_101773123 | 3300006484 | Estuarine | MKQIKLSPVEFWQFRKLAFAMCIAFVCTMTQGVYIVEASIDQLDKLGY* |
| Ga0075467_101046674 | 3300006803 | Aqueous | MKTIKLLPTEFYQFRQLAFAMSIAFACTITQGVYIVEANINQLKELGY* |
| Ga0075464_107127564 | 3300006805 | Aqueous | MKTITMKPTEFYQFRQLAFAMSVAFACTIAQGVYIVEANINQLEQLGY* |
| Ga0075464_109640663 | 3300006805 | Aqueous | MKQIKLLPTEFYQFRELAFAMSIVFVCSIAQGVYIVEANINQLEKLGY* |
| Ga0070748_101964010 | 3300006920 | Aqueous | MKTIKLLPTEFYQFRQLAFAMSIAFACSISHGVYIVEANINQLQELGY* |
| Ga0070748_10532225 | 3300006920 | Aqueous | MKTIKLLPTEFFQFRQLAFAMSIAFACSITQGVYIVEANINQLEQLGY* |
| Ga0070748_11642984 | 3300006920 | Aqueous | MKTIKLLPTEFYQFRQLAFAMSIAFACSISHGVYIVEANI |
| Ga0070748_12176093 | 3300006920 | Aqueous | MKTIKLSPTEFWHFRQLAFAMSVAFACTIAQGVYIVEANIDQLQKLGY* |
| Ga0102976_11744043 | 3300007169 | Freshwater Lake | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEANIDQLEKLGY* |
| Ga0103961_13967782 | 3300007216 | Freshwater Lake | MKTLKFKPTDFYEFRKNAFAMCVSFTCTMLNGKYIVEANI |
| Ga0070747_10400282 | 3300007276 | Aqueous | MKTIELKPTEFFKFRKEAFAMSVAFACTIAQGVYIVEASIDQLYKLGY* |
| Ga0099846_11479041 | 3300007542 | Aqueous | MKTITMKPTEFYEFRKLAFAMSIAFACTIAHGVYIVEANIDQLSQLGY* |
| Ga0102873_11625381 | 3300007545 | Estuarine | TIKLTPVDFYRFRQLAFAMCVAFSCTITQGVYIVEANIGQLHKLGY* |
| Ga0102880_10991181 | 3300007550 | Estuarine | MKTIKLTPVDFYRFRQLAFAMCVAFSCTITQGVYIVEAN |
| Ga0102900_11330191 | 3300007651 | Estuarine | KKIELKPTEFYHLRKLAFAMSLAFGCTIAHGMYIVEASIEQLEQLGY* |
| Ga0114343_10303835 | 3300008110 | Freshwater, Plankton | MKTIKLKPTDFYAFRKLALAMSIAFVCSITHGVYIVEANIDQLEQLGY* |
| Ga0114346_100010397 | 3300008113 | Freshwater, Plankton | MKTITMKPVEFYHFRQLAFAMSIAFACTIAQGVYIVEANIDQLEKLGY* |
| Ga0114364_10598091 | 3300008267 | Freshwater, Plankton | NMKTITMKPVEFYHFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY* |
| Ga0114876_101158710 | 3300008448 | Freshwater Lake | MKTIEMKPTEFYEFRKLALGMCVAFMCTMSQGMYIVEASIDQLDKLGY* |
| Ga0114876_10193867 | 3300008448 | Freshwater Lake | MKTITLKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANIDQLKQLGY* |
| Ga0114880_100001691 | 3300008450 | Freshwater Lake | MKQIKMEPTEFYQFRKLALAMCVVFMCTMTQGVYIVEASIDQLDKLGY* |
| Ga0114880_11230112 | 3300008450 | Freshwater Lake | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAHGVYIVEASIDQLDRLGY* |
| Ga0102829_10534933 | 3300009026 | Estuarine | MKTIRLQPTEFWQFRQLAFAMCIAFSCTITQGVYIVEANIDQLHKLGY* |
| Ga0102829_13045671 | 3300009026 | Estuarine | MKTIQMKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANIDQLEQLGY* |
| Ga0105093_106684772 | 3300009037 | Freshwater Sediment | MKTIEMKPTEFYQFRQLAFAMCIAFACTIAHGVYIVEASIDQLDKLGY* |
| Ga0105098_101010782 | 3300009081 | Freshwater Sediment | MKTITMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLKQLGY* |
| Ga0105099_106805121 | 3300009082 | Freshwater Sediment | MKKTIELEPTEFYHFRKLAFAISLAFGCTISHGVYIVEASIDQLEQ |
| Ga0105099_110273822 | 3300009082 | Freshwater Sediment | MKTIKLSPVEFWHFRKLAFAMSIAFACTISQGVYIVEANIDQLHQLGY* |
| Ga0105103_100024331 | 3300009085 | Freshwater Sediment | MKKIKMEPTEFYHFRKLAFAMSLAFGCTITQGVYIVEASIDQLEKLGY* |
| Ga0105103_101518882 | 3300009085 | Freshwater Sediment | MKTIELSPVEFWHFRKLAFAMSIAFACTIAHGVYIVEANINQLQELGY* |
| Ga0105103_107754322 | 3300009085 | Freshwater Sediment | MKTIKLSPVEFWHFRKLAFAMSIAFACTIAHGVYIVEANINQLKELGY* |
| Ga0105103_107951081 | 3300009085 | Freshwater Sediment | MKTIKLSPVDFWHFRQLAFAMSIAFACTIAHGVYIVEANINQLKELGY* |
| Ga0114962_1000093916 | 3300009151 | Freshwater Lake | MKTIKLQPTEFWQFRQLAFAMSIAFACTISQGVYIVEANIDQLQKLGY* |
| Ga0114962_100278239 | 3300009151 | Freshwater Lake | MKTITMKPTEFYLFRQLAFAMSIAFACTIAQGVYIVEANIDQLEKLGY* |
| Ga0114968_101665931 | 3300009155 | Freshwater Lake | MKTIKLTPVDFYRFRKLALAMCIAFVCTMSQGVYIVEASIDQLEQLGY* |
| Ga0114968_106157012 | 3300009155 | Freshwater Lake | EMEPVEFWHFRKLAFAMSIAFVCTMAQGMYIVEANINQLEQLGY* |
| Ga0114978_101110386 | 3300009159 | Freshwater Lake | MKTITLQPTEFYQFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY* |
| Ga0105102_106982352 | 3300009165 | Freshwater Sediment | MKTIQMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLHQLGY* |
| Ga0105097_100139996 | 3300009169 | Freshwater Sediment | MKTIKLSPVDFWHFRQLAFAMSIAFACTISHGVYIVEANINQLQELGY* |
| Ga0105097_100169443 | 3300009169 | Freshwater Sediment | MKTIKLLPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLQQLGY* |
| Ga0105097_100287793 | 3300009169 | Freshwater Sediment | MKTIELQPTEFWHFRKLAFAMCIAFSCTIAQGVYIVEANIDQLKQLGY* |
| Ga0105097_100904736 | 3300009169 | Freshwater Sediment | MKKVEMEPVEFWHFRKLAFAMSIAFVCTIAQGVYIVEANIDQLQQLGY* |
| Ga0105097_101510931 | 3300009169 | Freshwater Sediment | HFRKLAFAMSLAFGCTITHGVYIVEASIDQLDKLGY* |
| Ga0105097_101664311 | 3300009169 | Freshwater Sediment | MKTITMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLQQLGY* |
| Ga0105097_105488702 | 3300009169 | Freshwater Sediment | MKTIELDPVDFYHFRKLAFAISLAFGCTLTHGVYIVEASIDQLEKLGY* |
| Ga0105097_107299071 | 3300009169 | Freshwater Sediment | MKTISLSPVDFWHFRQLAFAMCIAFSCTIAQGVYIVEANIDQLHKLGY* |
| Ga0105097_107942533 | 3300009169 | Freshwater Sediment | MKTITMKPTEFYEFRKLAFAMCIAFVCTMAQGVYIVEANINQLEQLGY* |
| Ga0105096_103126053 | 3300009170 | Freshwater Sediment | MKTITMKPTEFYEFRKLAFAMCIAFVCTMAQGVYIVEANIDQLHKLGY* |
| Ga0114979_100330495 | 3300009180 | Freshwater Lake | MKTIELQPTEFYLFRKLAFAMCIAFACTITQGVYIVEANIDQLEKLGY* |
| Ga0114969_107042742 | 3300009181 | Freshwater Lake | MKQLEMKPTEFYQFRKLALAMCIAFVCTMSQGVYIVEASIDQLDKLGY* |
| Ga0114959_100452503 | 3300009182 | Freshwater Lake | MKTITMKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANIDQLNKLGY* |
| Ga0114958_100581554 | 3300009684 | Freshwater Lake | MKTIELSPTDFWHFRQLAFAMCIAFACTIAHGVYIVEANIDQLEKLGY* |
| Ga0114964_1000350327 | 3300010157 | Freshwater Lake | MKTITLKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANINQLEKLGY* |
| Ga0114960_102230301 | 3300010158 | Freshwater Lake | ITIKMKTITMKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANIDQLNKLGY* |
| Ga0114967_1001332311 | 3300010160 | Freshwater Lake | MKKVEMEPVEFWHFRKLAFAMSIAFVCTMAQGMYIVEANINQLEQLGY* |
| Ga0129324_103200641 | 3300010368 | Freshwater To Marine Saline Gradient | MKTIKLLPTEFYQFRQLAFAMSIAFACTMAQGVYIVEANIDQLSQLGY* |
| Ga0133913_102947658 | 3300010885 | Freshwater Lake | MKTIRLQPTEFWQFRQLAFAMCIAFSCTITHGVYIVEANIDQLHKLGY* |
| Ga0133913_119963825 | 3300010885 | Freshwater Lake | MKTITLKPTDFYQFRQLAFAMCIAFSCTIAHGVYIVEANIDQLEKLGY* |
| Ga0133913_125556721 | 3300010885 | Freshwater Lake | MKTITMKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANIDQLQQLGY* |
| Ga0133913_132276712 | 3300010885 | Freshwater Lake | MKTIELEPTEFWHFRKLAFAMCIAFVCTISQGVYIVEANIDQLEQLGY* |
| Ga0138501_1134791 | 3300010944 | Wastewater | MKKVKMEPTEFYHFRKLAFAISLAFGCTISHGVYIVEASIDQLEKLGY* |
| Ga0139174_1205202 | 3300010945 | Wastewater | YHFRKLAFAISLAFGCTISHGVYIVEASIDQLEKLGY* |
| Ga0137675_10002061 | 3300010966 | Pond Fresh Water | MKTIKLEPTEFYHFRKLAFAMSIAFVCSITHGVYIVEANINQLEQLGY* |
| Ga0136709_10225462 | 3300011184 | Freshwater | MKTIVMKPTEFYQFRQLAFAMCIAFACTISQGVYIVEANIDQLKQLGY* |
| Ga0136709_10659532 | 3300011184 | Freshwater | MKTIELIPTEFYQFRQLAFAMSIAFVCTISQGVYIVEANIDQLQQLGY* |
| Ga0153700_1002658 | 3300011339 | Freshwater | MKTIELSPTDFWHFRKLAFAMSLAFGCTIAHGVYIVEASIDQLEQLGY* |
| Ga0157203_100195911 | 3300012663 | Freshwater | MEPTEFYHFRKLAFAISLAFGCTMSHGVYIVEASIDQLEKLGY* |
| Ga0157208_1000034713 | 3300012667 | Freshwater | MKKIKMEPTEFYHFRKLAFAFSLAFGCTITHGVYIVEASIDQLEKLGY* |
| Ga0157208_100033541 | 3300012667 | Freshwater | MKKIKMEPTEFYHFRKLAFAIKLAFVCTIAQGVYIVEASIDQLEKLGY* |
| Ga0157208_100197051 | 3300012667 | Freshwater | MKQIKLSPVEFWQFRKLAIAMCVAFACTITHGVYIVEASID |
| Ga0164294_101105866 | 3300013006 | Freshwater | MKTIELQPTEFYLFRQLAFAMCIAFACTITQGVYIVEANIDQLEKLGY* |
| Ga0181338_10135022 | 3300015050 | Freshwater Lake | MKTITMKPTEFYQFRKLAFAMSIAFACTIAQGVYIVEANINQLEQLGY* |
| Ga0181338_10610171 | 3300015050 | Freshwater Lake | MKTIRMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANINQLH |
| Ga0181338_10656972 | 3300015050 | Freshwater Lake | MKTITMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY* |
| Ga0181350_10141983 | 3300017716 | Freshwater Lake | MKTIEMKPTEFYQFRKLAFAMCIAFVCTMAQGVYIVE |
| Ga0181350_10321384 | 3300017716 | Freshwater Lake | MKTITLQPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANINQLKQLGY |
| Ga0181347_10402506 | 3300017722 | Freshwater Lake | KTITMKPTEFYQFRKLAFAMSIAFACTIAQGVYIVEANIDQLHKLGY |
| Ga0181344_10091701 | 3300017754 | Freshwater Lake | FYHFRKLAFAMSLAFGCTIAHGVYIVEASIDQLEKLGY |
| Ga0181344_10362454 | 3300017754 | Freshwater Lake | MKKIELKPTEFYHFRKLAFAMSLAFGCTIAHGVYIVEASIDQLEKLGY |
| Ga0181344_10722311 | 3300017754 | Freshwater Lake | MKKIKMEPTEFYHFRKLAFAMSLAFGCTIAHGVYIVEASID |
| Ga0181344_10931222 | 3300017754 | Freshwater Lake | MKTITLKPVEFYHFRKLAFAMSIAFACTIAQGVYIVEANIDQLEQLGY |
| Ga0181356_11394431 | 3300017761 | Freshwater Lake | MKTIEMKPVEFYHFRQLAFAMCIAFVCTMAQGVYIVEASIDQLEQLGY |
| Ga0181343_10373791 | 3300017766 | Freshwater Lake | KNMKTITLKPVEFYHFRQLAFAMSIAFACTIAQGVYIVEANIDQLEQLGY |
| Ga0181343_11904051 | 3300017766 | Freshwater Lake | MKKIELQPVEFYHFRKLAFAISLAFGCTIAHGVYIVEANIDQLEKLGY |
| Ga0181358_10837511 | 3300017774 | Freshwater Lake | TMKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEASIDQLEQLGY |
| Ga0181358_11011293 | 3300017774 | Freshwater Lake | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEAS |
| Ga0181349_10879091 | 3300017778 | Freshwater Lake | TITMKPTEFYEFRKLAFAMCIAFSCSISQGVYIVEANIDQLHKLGY |
| Ga0181349_11153871 | 3300017778 | Freshwater Lake | MKTITMKPTEFYEFRKLAFAMCIAFSCSISQGVYIVEANIDQL |
| Ga0181346_10139392 | 3300017780 | Freshwater Lake | MKTIRLQPTEFWHFRQLAFAMGIAFACTIAQGVYIVEANIDQLHKLGY |
| Ga0181346_10203405 | 3300017780 | Freshwater Lake | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEANI |
| Ga0181346_12959701 | 3300017780 | Freshwater Lake | MKTIRMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEAN |
| Ga0181355_10205861 | 3300017785 | Freshwater Lake | FRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY |
| Ga0181355_10646601 | 3300017785 | Freshwater Lake | KTMKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEASIDQLEQLGY |
| Ga0181355_10775381 | 3300017785 | Freshwater Lake | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEA |
| Ga0181355_10883171 | 3300017785 | Freshwater Lake | MKTIEMKPTEFYQFRQLAFAMCIAFACTMAQGVYIVEANIDQLEQLGY |
| Ga0181355_11206933 | 3300017785 | Freshwater Lake | MKTITMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEDNIKQLQQL |
| Ga0181355_13682583 | 3300017785 | Freshwater Lake | QFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY |
| Ga0181553_103602362 | 3300018416 | Salt Marsh | MKKIEMEPTEFYHFRKLAFAISLAFGCTMSHGVYIVEASIDQLEKLGY |
| Ga0181360_1108821 | 3300019781 | Freshwater Lake | MKTIRMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY |
| Ga0181359_10531275 | 3300019784 | Freshwater Lake | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEASIDQLEQLGY |
| Ga0181359_11351661 | 3300019784 | Freshwater Lake | MKKIELKPTEFYHFRKLAFAMSLAFGCTIAHGVYIVEASIDQLEQLGY |
| Ga0207193_103063812 | 3300020048 | Freshwater Lake Sediment | MKTITMKPTEFYQFRQLAFAMSIAFACSISQGVYIVEASINQLQELGY |
| Ga0194038_10823881 | 3300020158 | Anoxic Zone Freshwater | FRQLAFAMSIAFACTIAHGVYIVEANIDQLHQLGY |
| Ga0194037_10006174 | 3300020164 | Anoxic Zone Freshwater | MKTIKLLPTEFYQFRQLAFAMCIAFSCTIAHGVYIVEANIDQLQQLGY |
| Ga0211731_111133712 | 3300020205 | Freshwater | MKTIELQPTEFWHFRKLAFAMCIAFSCTIAHGVYIVEANIDQLHKLGY |
| Ga0194042_100524010 | 3300020229 | Anoxic Zone Freshwater | MKTIRLQPTEFWQFRQLAFAMCIAFSCTITQGVYIVEANIDQLHQLGY |
| Ga0208720_10387621 | 3300020495 | Freshwater | MKTITMKPTEFYEFRKLAFAMSIAFACTISQGVYIVEANIDQLQQLGY |
| Ga0208359_10095832 | 3300020541 | Freshwater | MNKTIELQPTEFWHFRKLAFAISLAFGCTISHGVYIVEASIDQLEQLGY |
| Ga0207942_10239781 | 3300020549 | Freshwater | MKTIKLIPTEFYEFRKLAFAMSIAFVCTMAQGVYIVEASIDQLEQLGY |
| Ga0208597_10049865 | 3300020562 | Freshwater | MKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLQQLGY |
| Ga0207909_10647252 | 3300020572 | Freshwater | MKTIKLSPVEFWHFRQLAIAMSIAFACTIAQGVYIVEANIDQLQKLGY |
| Ga0214168_10843773 | 3300021140 | Freshwater | MKTIELQPTEFWHFRKLAFAMCIAFSCTIAQGVYIVEANIDQLEQLGY |
| Ga0214163_10868231 | 3300021141 | Freshwater | MKTIKLIPTEFYEFRKLAFAMSIAFVCTMAQGVYIVEASIDQLEQL |
| Ga0213920_100007666 | 3300021438 | Freshwater | MKTIKMKPTEFYQFRQLAFAMSVAFVCTIAHGVYIVEANINQLEKLGY |
| Ga0194059_10860292 | 3300021600 | Anoxic Zone Freshwater | MKTIELKPTDFYHFRELAFAMCIAFACTMAQGVYIVTANIDQLEQLGY |
| Ga0194060_101923153 | 3300021602 | Anoxic Zone Freshwater | MKTIKLQPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLYKLGY |
| Ga0212023_10499782 | 3300022061 | Aqueous | LPTEFYQFRQLAFAMSIVFACSISHGVYIVEANINQLQELGY |
| Ga0196889_10582222 | 3300022072 | Aqueous | MKTIKLLPTEFYQFRQLAFAMSIVFACSISHGVYIVEANINQLQELGY |
| Ga0196887_10372592 | 3300022178 | Aqueous | MKTIKLLPTEFYQFRQLAFAMSIAFACSISHGVYIVEANINQLQELGY |
| Ga0181353_10759901 | 3300022179 | Freshwater Lake | HFRKLAFAISLAFGCTISHGVYIVEASIDQLEQLGY |
| Ga0181354_10751913 | 3300022190 | Freshwater Lake | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEANIDQLDKLGY |
| Ga0181351_100002561 | 3300022407 | Freshwater Lake | MKTIKMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY |
| Ga0181351_10018789 | 3300022407 | Freshwater Lake | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEANIDQLEQLGY |
| Ga0181351_10342592 | 3300022407 | Freshwater Lake | MKTITMKPTEFYQFRKLAFAMSIAFACTIAQGVYIVEANINQLEQLGY |
| Ga0181351_10490534 | 3300022407 | Freshwater Lake | MKTIELKPTEFFQFRQLAFAMCIAFSCTITQGVYIVEANIDQLKQLGY |
| Ga0181351_10767591 | 3300022407 | Freshwater Lake | MKTITMKPTEFYEFRKLAFAMCIAFSCTIAQGVYIVEANIDQLHKLGY |
| Ga0181351_10817211 | 3300022407 | Freshwater Lake | MKTITMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY |
| Ga0181351_10927444 | 3300022407 | Freshwater Lake | MKTIRLQPTEFWQFRQLAFAMCIAFSCTIAQGVYIVEANIDQLKQLGY |
| Ga0181351_11180511 | 3300022407 | Freshwater Lake | MKTITMKPTEFYEFRKLAFAMCIAFSCSISQGVYIVEANIDQLHQLGY |
| Ga0212119_10107091 | 3300022543 | Freshwater | MKTITLKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANIDQLKQLGY |
| Ga0212119_10335092 | 3300022543 | Freshwater | MKTIELQPTEFWHFRKLAFAMCIAFSCTIAQGVYIVEANIDQLKQLGY |
| Ga0212119_10475354 | 3300022543 | Freshwater | MKTITMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLHQLGY |
| Ga0214919_1000028479 | 3300023184 | Freshwater | MKTIELQPTEFYQFRQLAFAMCIAFACTIAHGVYIVEANIDQLEKLGY |
| Ga0214919_100398283 | 3300023184 | Freshwater | MKTISLSPVDFWHFRKLAFAMSIAFTCTIAQSVYIVEANIDQLAKLGY |
| Ga0214919_1004653411 | 3300023184 | Freshwater | MKTIELQPTEFYLFRKLAFAMCIAFACTITQGVYIVEANIDQLEKLGY |
| Ga0244777_100131798 | 3300024343 | Estuarine | MKTIKLTPVDFYRFRQLAFAMCVAFSCTITQGVYIVEANIDQLHKLGY |
| Ga0244775_100038113 | 3300024346 | Estuarine | MKKIEMKPVEFYHFRKLAFAMSIAFACTIAQGVYIVEANIDQLKQLGY |
| Ga0244775_103990712 | 3300024346 | Estuarine | MKTIEMKPTEFYEFRKLAFAMCIAFVCTMAQGVYIVEANIDQLEKLGY |
| Ga0244775_107854314 | 3300024346 | Estuarine | MKTIRLQPTEFWQFRQLAFAMCIAFSCTITQGVYIVEANIDQLHKLGY |
| Ga0244775_111058061 | 3300024346 | Estuarine | MKQLEMKPTEFYQFRKLALAMCIAFVCTMTQGVYIVEASIDQLDKLGY |
| Ga0256308_100000455 | 3300024549 | Freshwater | MKKTIELEPTEFWHFRKLAFAISLAFGCTISHGVYIVEASIDQLEQLGY |
| Ga0209616_10152742 | 3300025091 | Freshwater | MKTIVMKPTEFYQFRQLAFAMCIAFACTISQGVYIVEANIDQLKQLGY |
| Ga0208544_103906981 | 3300025887 | Aqueous | MKTIKLLPTEFYQFRQLAFAMSIAFACTITQGVYIVEANINQLKELGY |
| Ga0255098_10243011 | 3300027126 | Freshwater | MKTIELDPVDFYHFRKLAFAISLAFGCTISHGVYIVEASIDQLEQLGY |
| Ga0208672_10184011 | 3300027185 | Estuarine | EMKTIKLTPVDFYRFRQLAFAMCVAFSCTITQGVYIVEANIDQLHKLGY |
| Ga0208800_10211461 | 3300027193 | Estuarine | LITIEMKTIQLQPTEFWQFRQLAFAMCIAFSCTITQGVYIVEANIDQLHKLGY |
| Ga0208800_10464912 | 3300027193 | Estuarine | MKTIRLQPTEFWQFRQLAFAMCIAFSCTITQGVYIVEANIDQLHKL |
| Ga0208444_10400362 | 3300027240 | Estuarine | MKTIKLTPVDFYRFRQLAFAMCVAFSCTITQGVYIVEANIDQLHKLG |
| Ga0209247_10280781 | 3300027468 | Freshwater Lake | MKTIRLQPTEFWQFRQLAFAMCIAFSCTIAQGVYIVEANIDQLEQLGY |
| Ga0208133_11053042 | 3300027631 | Estuarine | MKQIKLSPVEFWQFRKLAFAMCIAFVCTMTQGVYIVEASIDQLDKLGY |
| Ga0209443_12494001 | 3300027707 | Freshwater Lake | MKTITMKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANINQLKQLGY |
| Ga0209188_100008380 | 3300027708 | Freshwater Lake | MKTIKLQPTEFWQFRQLAFAMSIAFACTISQGVYIVEANIDQLQKLGY |
| Ga0209188_100015620 | 3300027708 | Freshwater Lake | MKTITLKPTDFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLEKLGY |
| Ga0209188_10331344 | 3300027708 | Freshwater Lake | MKTITMKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANIDQLEKLGY |
| Ga0209599_100131814 | 3300027710 | Deep Subsurface | MKTIKLSPVEFWHFRKLAFAMSIAFACTIAQGVYIVEANIDQLQQLGY |
| Ga0209499_10347916 | 3300027712 | Freshwater Lake | MKTIELSPTDFWHFRQLAFAMCIAFACTIAHGVYIVEANIDQLEKLGY |
| Ga0209492_100008619 | 3300027721 | Freshwater Sediment | MKTIKLSPVDFWHFRQLAFAMSIAFACTISHGVYIVEANINQLQELGY |
| Ga0209492_100312513 | 3300027721 | Freshwater Sediment | MKTITMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLHKLGY |
| Ga0209492_10066368 | 3300027721 | Freshwater Sediment | MKTIKLLPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLQQLGY |
| Ga0209492_10791431 | 3300027721 | Freshwater Sediment | MKKVEMEPVEFWHFRKLAFAMSIAFVCTIAQGVYIVEANIDQLQQLGY |
| Ga0209492_10822381 | 3300027721 | Freshwater Sediment | MKTITMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLQQLGY |
| Ga0209492_13115731 | 3300027721 | Freshwater Sediment | MKTISLSPVDFWHFRQLAFAMCIAFSCTIAQGVYIVEANIDQLHKLGY |
| Ga0209442_10756972 | 3300027732 | Freshwater Lake | MKTITMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANINQLHQLGY |
| Ga0209442_12490771 | 3300027732 | Freshwater Lake | MKKIELEPTEFWHFRKLAFAMCIAFSCTIAQGVYIVEANIDQLK |
| Ga0209593_100892392 | 3300027743 | Freshwater Sediment | MKTIELSPVEFWHFRKLAFAMSIAFACTIAHGVYIVEANINQLQELGY |
| Ga0209084_10157673 | 3300027749 | Freshwater Lake | MKTITMKPTEFYLFRQLAFAMSIAFACTIAQGVYIVEANIDQLEKLGY |
| Ga0209596_13852192 | 3300027754 | Freshwater Lake | MKQLEMKPTEFYQFRKLALAMCIAFVCTMSQGVYIVEASIDQLDKLGY |
| Ga0208671_101702063 | 3300027757 | Estuarine | IKLTPVDFYRFRQLAFAMCVAFSCTITQGVYIVEANIDQLHKLGY |
| Ga0209296_13981422 | 3300027759 | Freshwater Lake | MKTIEMKPTEFYQFRKLAFAMSIAFACTIAQGVYIVEANINQLEKLGY |
| Ga0209088_101659792 | 3300027763 | Freshwater Lake | MKTITLQPTEFYQFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY |
| Ga0209246_100098061 | 3300027785 | Freshwater Lake | NMKTIRMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANIKQLQQLGY |
| Ga0209246_102024033 | 3300027785 | Freshwater Lake | MKTITMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANIKQLQQL |
| Ga0209287_103869702 | 3300027792 | Freshwater Sediment | MKTIKLSPVEFWHFRKLAFAMSIAFACTISQGVYIVEANIDQLHQLGY |
| Ga0209353_101409315 | 3300027798 | Freshwater Lake | EFWQFRQLAFAMCIAFSCTIAQGVYIVEANIDQLKQLGY |
| Ga0209229_100047862 | 3300027805 | Freshwater And Sediment | MKTITMKPVEFYHFRQLAFAMSIAFACTIAQGVYIVEANIDQLEKLGY |
| Ga0209229_103668691 | 3300027805 | Freshwater And Sediment | MKTIKLQPTEFYQFRQLAFAMCIAFACTISQGVYIVEANIDQLKQLGY |
| Ga0209550_104343671 | 3300027892 | Freshwater Lake | YHFRQLAFAMSIAFACTISQGVYIVEANINQLKQLGY |
| Ga0209777_103270502 | 3300027896 | Freshwater Lake Sediment | MKTIKLIPTDFYRFRQLAFAMSIAFACTISQGVYIVEANINQLEKLGY |
| Ga0209668_100023107 | 3300027899 | Freshwater Lake Sediment | MKTIQMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLQQLGY |
| Ga0209668_100471483 | 3300027899 | Freshwater Lake Sediment | MKTIRLQPTEFWQFRQLAFAMCIAFSCTIAQGVYIVEANIDQLHKLGY |
| Ga0209253_105198333 | 3300027900 | Freshwater Lake Sediment | MKTIELSPTDFWHFRKLAFAMSLAFGCTIAHGVYIVEASIDQLEKLGY |
| Ga0209253_105709641 | 3300027900 | Freshwater Lake Sediment | FYQFRQLAFAMSIAFACTIAHGVYIVEANINQLEQLGY |
| Ga0209253_109807321 | 3300027900 | Freshwater Lake Sediment | EPTEFYHFRKLAFAMSLAFGCTIAHGVYIVEASIDQLEQLGY |
| Ga0209820_12460031 | 3300027956 | Freshwater Sediment | MKTITMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANIDQLKQLGY |
| Ga0209079_100811462 | 3300027972 | Freshwater Sediment | MKKIKMEPTEFYHFRKLAFAISLAFGCTITQGVYIVEASIDQLEKLGY |
| Ga0209079_100990252 | 3300027972 | Freshwater Sediment | MKTIKLSPVEFWHFRKLAFAMSIAFACTIAHGVYIVEANINQLQELGY |
| Ga0304729_10013033 | 3300028392 | Freshwater Lake | MKTIKLKPTEFYQFRQLAFAMSIAFVCSIAHGVYIVEANINQLKQLGY |
| Ga0304729_10220426 | 3300028392 | Freshwater Lake | MKTITLKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANINQLEKLGY |
| Ga0304730_11856601 | 3300028394 | Freshwater Lake | MKKVEMEPVEFWHFRKLAFAMSIAFVCTMAQGMYIVEANINQLEQLGY |
| Ga0307379_112496001 | 3300031565 | Soil | MKKIEMEPTEFYHFRKLAFAISLAFGCTISHGVYIVEASIDQLEKLGY |
| Ga0315291_1008324110 | 3300031707 | Sediment | MKTITMKPTEFYHFRKLAFAMSLAFGCTIAHGVYIVEASIDQLEKLGY |
| Ga0315293_100619401 | 3300031746 | Sediment | MKTITMKPTEFYEFRKLAFAMSIAFACTIAHGVYIVEANINQLKQLGY |
| Ga0315293_100776358 | 3300031746 | Sediment | MKTISLSPVDFWHFRKLAFAMSIAFACTMSQGVYIVEANIDQLAKLGY |
| Ga0315900_105885021 | 3300031787 | Freshwater | MKTIKLKPTDFYAFRKLALAMSIAFVCSITHGVYIVEANIDQLEQLGY |
| Ga0315909_101323965 | 3300031857 | Freshwater | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEANIDQLEKLGY |
| Ga0315285_1001382019 | 3300031885 | Sediment | MKTITMKPTEFYQFRQLAFAMSIAFACTISQGVYIVEANINQLKQLGY |
| Ga0315904_107471841 | 3300031951 | Freshwater | MKTIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEASIDQLDKLGY |
| Ga0315274_108383203 | 3300031999 | Sediment | MKTITMKPTEFYEFRKLAFAMCIAFSCTIAQGVYIVEANIDQLHQLGY |
| Ga0315274_112919142 | 3300031999 | Sediment | MKTITLQPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANIDQLKQLGY |
| Ga0315272_1000018911 | 3300032018 | Sediment | MKTIRLQPTEFWQFRQLAFAMCIAFSCTITHGVYIVEANINQLEKLGY |
| Ga0315284_109337853 | 3300032053 | Sediment | MKTIELKPTEFYEFRKLAFAMCIAFVCTMAQGVYIVEANIDQLEKLGY |
| Ga0315903_108872871 | 3300032116 | Freshwater | MKKIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEASIDQLEQLGY |
| Ga0315276_108233571 | 3300032177 | Sediment | MKTITMKPTEFYQFRQLAFAMSIAFACTIAQGVYIVEANIDQLKQLGY |
| Ga0315273_115440051 | 3300032516 | Sediment | MKTITMKPTEFYEFRKLAFAMSIAFACTISHGVYIVEANINQ |
| Ga0334980_0294294_201_347 | 3300033816 | Freshwater | MKTITLKPVEFYHFRQLAFAMSIAFACTIAQGVYIVEANIDQLEQLGY |
| Ga0334977_0072170_1279_1425 | 3300033978 | Freshwater | MKKIELQPVEFYHFRKLAFAISLAFGCTISHGVYIVEASIDQLEQLGY |
| Ga0334989_0109066_1_120 | 3300033984 | Freshwater | EFWHFRKLAFAMSIAFVCTIAQGVYIVEANIDQLQQLGY |
| Ga0334989_0147027_954_1100 | 3300033984 | Freshwater | MKTITMKPTEFYQFRQLAFAISIAFACTIAHGVYIVEANIDQLHQLGY |
| Ga0334989_0207280_569_715 | 3300033984 | Freshwater | MKKVEMEPVEFWHFRKLAFAMSIAFACTIAHGVYIVEANIDQLQKLGY |
| Ga0334992_0281266_597_746 | 3300033992 | Freshwater | MKKTIELEPTEFYHFRKLAFAISLAFGCTISHGVYIVEASIDQLEQLGY |
| Ga0335003_0157509_325_471 | 3300033995 | Freshwater | MKTIQLQPTEFWQFRQLAFAMCIAFSCTITQGVYIVEANIDQLHKLGY |
| Ga0335003_0248489_322_468 | 3300033995 | Freshwater | MKTIKLQPTEFWQFRKLAFAMCIAFSCTIAHGVYIVEANIDQLHKLGY |
| Ga0334979_0248854_614_760 | 3300033996 | Freshwater | MKTIELSPVEFWHFRKLAFAISLAFGCTIAHGVYIVEASIDQLEKLGY |
| Ga0334985_0007193_7603_7749 | 3300034018 | Freshwater | MKKIKMEPTEFYHFRKLAFAISLAFGCTMTHGVYIVEASIDQLEKLGY |
| Ga0335005_0000015_22592_22738 | 3300034022 | Freshwater | MKKVEMEPVEFWHFRKLAFAMSIAFACTIAHGVYIVEANIDQLQQLGY |
| Ga0334983_0054891_1978_2124 | 3300034060 | Freshwater | MKQIEMKPTEFYQFRQLAFAMCIAFVCTMAQGVYIVEANIDQLDKLGY |
| Ga0334987_0267568_94_240 | 3300034061 | Freshwater | MKTITLKPVEFYHFRQLAFAMSIAFACTIAHGVYIVEASIDQLEKLGY |
| Ga0334990_0009194_959_1105 | 3300034068 | Freshwater | MKTITMKPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANINQLEQLGY |
| Ga0335012_0070398_280_426 | 3300034093 | Freshwater | MKTITMKPTEFYQFRQLALAMSIAFACTIAHGVYIVEANIDQLHQLGY |
| Ga0335031_0000349_34986_35132 | 3300034104 | Freshwater | MKTIELSPVEFWQFRKLAFAMCIAFVCTMAQGVYIVEANIDQLEQLGY |
| Ga0335031_0315559_630_776 | 3300034104 | Freshwater | MKTITLQPTEFYQFRQLAFAMSIAFACTIAHGVYIVEANINQLEKLGY |
| Ga0335035_0353375_663_809 | 3300034105 | Freshwater | MKKIELEPTEFWHFRKLAFAMCIAFSCTIAHGVYIVEANIDQLHKLGY |
| Ga0335064_0058882_947_1093 | 3300034357 | Freshwater | MKTIQLQPTEFWQFRQLAFAMCIAFSCTIAQGVYIVEANIDQLHKLGY |
| ⦗Top⦘ |