


| Basic Information | |
|---|---|
| Family ID | F015244 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 256 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLT |
| Number of Associated Samples | 173 |
| Number of Associated Scaffolds | 256 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.69 % |
| % of genes near scaffold ends (potentially truncated) | 23.05 % |
| % of genes from short scaffolds (< 2000 bps) | 80.86 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.578 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.609 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.938 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.281 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 256 Family Scaffolds |
|---|---|---|
| PF04551 | GcpE | 10.16 |
| PF01904 | DUF72 | 7.03 |
| PF11154 | DUF2934 | 2.34 |
| PF11528 | DUF3224 | 1.95 |
| PF00072 | Response_reg | 1.56 |
| PF00188 | CAP | 1.56 |
| PF02371 | Transposase_20 | 1.17 |
| PF12704 | MacB_PCD | 1.17 |
| PF04542 | Sigma70_r2 | 0.78 |
| PF02163 | Peptidase_M50 | 0.78 |
| PF07238 | PilZ | 0.78 |
| PF04191 | PEMT | 0.78 |
| PF00248 | Aldo_ket_red | 0.78 |
| PF01148 | CTP_transf_1 | 0.78 |
| PF12681 | Glyoxalase_2 | 0.78 |
| PF07883 | Cupin_2 | 0.78 |
| PF01663 | Phosphodiest | 0.78 |
| PF00873 | ACR_tran | 0.39 |
| PF02737 | 3HCDH_N | 0.39 |
| PF04055 | Radical_SAM | 0.39 |
| PF00856 | SET | 0.39 |
| PF05598 | DUF772 | 0.39 |
| PF04024 | PspC | 0.39 |
| PF00156 | Pribosyltran | 0.39 |
| PF02646 | RmuC | 0.39 |
| PF00135 | COesterase | 0.39 |
| PF03544 | TonB_C | 0.39 |
| PF07045 | DUF1330 | 0.39 |
| PF02661 | Fic | 0.39 |
| PF00133 | tRNA-synt_1 | 0.39 |
| PF01850 | PIN | 0.39 |
| PF00144 | Beta-lactamase | 0.39 |
| PF00239 | Resolvase | 0.39 |
| PF07589 | PEP-CTERM | 0.39 |
| PF07676 | PD40 | 0.39 |
| PF13751 | DDE_Tnp_1_6 | 0.39 |
| PF03704 | BTAD | 0.39 |
| PF13520 | AA_permease_2 | 0.39 |
| PF01255 | Prenyltransf | 0.39 |
| PF02355 | SecD_SecF | 0.39 |
| PF02738 | MoCoBD_1 | 0.39 |
| PF04014 | MazE_antitoxin | 0.39 |
| PF00308 | Bac_DnaA | 0.39 |
| PF01527 | HTH_Tnp_1 | 0.39 |
| PF13365 | Trypsin_2 | 0.39 |
| PF08808 | RES | 0.39 |
| COG ID | Name | Functional Category | % Frequency in 256 Family Scaffolds |
|---|---|---|---|
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 10.16 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 7.03 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 1.56 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.17 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.78 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.78 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.78 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.78 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.39 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.39 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.39 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.39 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.39 |
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 0.39 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.39 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.39 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.39 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.39 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.39 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.39 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.39 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.39 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.39 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.39 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.39 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.39 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.39 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.39 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.39 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.39 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.39 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.39 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.97 % |
| Unclassified | root | N/A | 32.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10520951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300001867|JGI12627J18819_10052555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1700 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100012381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7020 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100196295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1909 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100878841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Jiella → unclassified Jiella → Jiella sp. CBK1P-4 | 778 | Open in IMG/M |
| 3300002908|JGI25382J43887_10146866 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300002911|JGI25390J43892_10013498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1926 | Open in IMG/M |
| 3300005167|Ga0066672_10451534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 839 | Open in IMG/M |
| 3300005172|Ga0066683_10464806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 774 | Open in IMG/M |
| 3300005172|Ga0066683_10613319 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005186|Ga0066676_10386368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 942 | Open in IMG/M |
| 3300005187|Ga0066675_11110723 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005439|Ga0070711_100952290 | Not Available | 735 | Open in IMG/M |
| 3300005445|Ga0070708_100123188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2393 | Open in IMG/M |
| 3300005445|Ga0070708_100297578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1519 | Open in IMG/M |
| 3300005468|Ga0070707_101677220 | Not Available | 603 | Open in IMG/M |
| 3300005518|Ga0070699_100172572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1916 | Open in IMG/M |
| 3300005518|Ga0070699_100606054 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300005518|Ga0070699_101166970 | Not Available | 706 | Open in IMG/M |
| 3300005529|Ga0070741_10015170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 13133 | Open in IMG/M |
| 3300005529|Ga0070741_10547582 | Not Available | 1040 | Open in IMG/M |
| 3300005536|Ga0070697_100150424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1962 | Open in IMG/M |
| 3300005536|Ga0070697_100628732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300005538|Ga0070731_10153176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1530 | Open in IMG/M |
| 3300005538|Ga0070731_10355535 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300005540|Ga0066697_10285932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 972 | Open in IMG/M |
| 3300005547|Ga0070693_100757227 | Not Available | 716 | Open in IMG/M |
| 3300005548|Ga0070665_100135277 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300005552|Ga0066701_10483862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 768 | Open in IMG/M |
| 3300005554|Ga0066661_10004681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 6284 | Open in IMG/M |
| 3300005554|Ga0066661_10005957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5738 | Open in IMG/M |
| 3300005554|Ga0066661_10017918 | All Organisms → cellular organisms → Bacteria | 3705 | Open in IMG/M |
| 3300005554|Ga0066661_10165175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1360 | Open in IMG/M |
| 3300005561|Ga0066699_10477157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 892 | Open in IMG/M |
| 3300005568|Ga0066703_10346744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 893 | Open in IMG/M |
| 3300005575|Ga0066702_10341957 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300005575|Ga0066702_10880078 | Not Available | 534 | Open in IMG/M |
| 3300005598|Ga0066706_11166616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 586 | Open in IMG/M |
| 3300005718|Ga0068866_11305017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300005764|Ga0066903_104819978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300005764|Ga0066903_108783374 | Not Available | 513 | Open in IMG/M |
| 3300005921|Ga0070766_10133662 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300005944|Ga0066788_10057023 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300005983|Ga0081540_1054544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1953 | Open in IMG/M |
| 3300006028|Ga0070717_10035281 | All Organisms → cellular organisms → Bacteria | 4048 | Open in IMG/M |
| 3300006028|Ga0070717_11401394 | Not Available | 635 | Open in IMG/M |
| 3300006034|Ga0066656_10076220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1993 | Open in IMG/M |
| 3300006046|Ga0066652_101691064 | Not Available | 577 | Open in IMG/M |
| 3300006047|Ga0075024_100710016 | Not Available | 553 | Open in IMG/M |
| 3300006050|Ga0075028_100005408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4968 | Open in IMG/M |
| 3300006052|Ga0075029_100039642 | Not Available | 2699 | Open in IMG/M |
| 3300006052|Ga0075029_100167950 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300006059|Ga0075017_100896225 | Not Available | 688 | Open in IMG/M |
| 3300006173|Ga0070716_101227358 | Not Available | 603 | Open in IMG/M |
| 3300006354|Ga0075021_10160244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1363 | Open in IMG/M |
| 3300006791|Ga0066653_10712502 | Not Available | 520 | Open in IMG/M |
| 3300006800|Ga0066660_10888466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300006804|Ga0079221_10546234 | Not Available | 766 | Open in IMG/M |
| 3300006854|Ga0075425_102274992 | Not Available | 603 | Open in IMG/M |
| 3300006871|Ga0075434_100168056 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
| 3300006893|Ga0073928_11130262 | Not Available | 530 | Open in IMG/M |
| 3300006893|Ga0073928_11130651 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300007265|Ga0099794_10442247 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300007788|Ga0099795_10176111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300009038|Ga0099829_10035481 | All Organisms → cellular organisms → Bacteria | 3594 | Open in IMG/M |
| 3300009038|Ga0099829_10083156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2456 | Open in IMG/M |
| 3300009038|Ga0099829_10206668 | Not Available | 1590 | Open in IMG/M |
| 3300009038|Ga0099829_10390496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1149 | Open in IMG/M |
| 3300009038|Ga0099829_10518593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
| 3300009038|Ga0099829_10607687 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300009038|Ga0099829_10611268 | Not Available | 906 | Open in IMG/M |
| 3300009038|Ga0099829_10621787 | Not Available | 898 | Open in IMG/M |
| 3300009038|Ga0099829_10853178 | Not Available | 756 | Open in IMG/M |
| 3300009038|Ga0099829_10888131 | Not Available | 740 | Open in IMG/M |
| 3300009038|Ga0099829_11073353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300009038|Ga0099829_11628577 | Not Available | 532 | Open in IMG/M |
| 3300009088|Ga0099830_10062286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2674 | Open in IMG/M |
| 3300009088|Ga0099830_10171302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1683 | Open in IMG/M |
| 3300009088|Ga0099830_10183289 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300009088|Ga0099830_10318446 | Not Available | 1245 | Open in IMG/M |
| 3300009089|Ga0099828_10162276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1980 | Open in IMG/M |
| 3300009089|Ga0099828_10276911 | Not Available | 1507 | Open in IMG/M |
| 3300009089|Ga0099828_11306177 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300009089|Ga0099828_11790577 | Not Available | 539 | Open in IMG/M |
| 3300009090|Ga0099827_10195486 | Not Available | 1680 | Open in IMG/M |
| 3300009092|Ga0105250_10564713 | Not Available | 523 | Open in IMG/M |
| 3300009101|Ga0105247_10018504 | All Organisms → cellular organisms → Bacteria | 4178 | Open in IMG/M |
| 3300009162|Ga0075423_12677351 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009176|Ga0105242_11082853 | Not Available | 814 | Open in IMG/M |
| 3300009616|Ga0116111_1038136 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300010047|Ga0126382_12479363 | Not Available | 505 | Open in IMG/M |
| 3300010329|Ga0134111_10469006 | Not Available | 548 | Open in IMG/M |
| 3300010339|Ga0074046_10151181 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300010358|Ga0126370_11565630 | Not Available | 629 | Open in IMG/M |
| 3300010359|Ga0126376_11437960 | Not Available | 716 | Open in IMG/M |
| 3300010360|Ga0126372_11031781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300010366|Ga0126379_12927288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300010858|Ga0126345_1196696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300010861|Ga0126349_1084721 | Not Available | 532 | Open in IMG/M |
| 3300011120|Ga0150983_11218620 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300011120|Ga0150983_11425493 | Not Available | 704 | Open in IMG/M |
| 3300011120|Ga0150983_12808976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 796 | Open in IMG/M |
| 3300011120|Ga0150983_14446657 | Not Available | 574 | Open in IMG/M |
| 3300011269|Ga0137392_10479574 | Not Available | 1033 | Open in IMG/M |
| 3300011269|Ga0137392_11517221 | Not Available | 529 | Open in IMG/M |
| 3300011270|Ga0137391_10665885 | Not Available | 867 | Open in IMG/M |
| 3300011271|Ga0137393_11278409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300011444|Ga0137463_1042940 | Not Available | 1676 | Open in IMG/M |
| 3300012096|Ga0137389_10115829 | Not Available | 2152 | Open in IMG/M |
| 3300012096|Ga0137389_11255382 | Not Available | 634 | Open in IMG/M |
| 3300012189|Ga0137388_10386155 | Not Available | 1295 | Open in IMG/M |
| 3300012189|Ga0137388_10671621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300012189|Ga0137388_11088254 | Not Available | 736 | Open in IMG/M |
| 3300012198|Ga0137364_10903143 | Not Available | 668 | Open in IMG/M |
| 3300012198|Ga0137364_11308607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300012200|Ga0137382_10560610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 814 | Open in IMG/M |
| 3300012200|Ga0137382_10793053 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012200|Ga0137382_10996573 | Not Available | 601 | Open in IMG/M |
| 3300012202|Ga0137363_10454113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300012203|Ga0137399_10483762 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300012203|Ga0137399_11525290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300012205|Ga0137362_10853921 | Not Available | 779 | Open in IMG/M |
| 3300012207|Ga0137381_10100208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2456 | Open in IMG/M |
| 3300012285|Ga0137370_10328077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300012356|Ga0137371_10909520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300012359|Ga0137385_10059980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3391 | Open in IMG/M |
| 3300012362|Ga0137361_11220502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012362|Ga0137361_11697448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300012363|Ga0137390_10279883 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300012469|Ga0150984_121703878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300012683|Ga0137398_10401847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300012917|Ga0137395_10529507 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300012918|Ga0137396_10549471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300012922|Ga0137394_10193270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1737 | Open in IMG/M |
| 3300012923|Ga0137359_10511566 | Not Available | 1059 | Open in IMG/M |
| 3300012930|Ga0137407_10107769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 2400 | Open in IMG/M |
| 3300012941|Ga0162652_100036518 | Not Available | 758 | Open in IMG/M |
| 3300012957|Ga0164303_10627294 | Not Available | 712 | Open in IMG/M |
| 3300012980|Ga0168315_111902 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300014968|Ga0157379_10388269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300014969|Ga0157376_12721916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 534 | Open in IMG/M |
| 3300015264|Ga0137403_11337046 | Not Available | 563 | Open in IMG/M |
| 3300015371|Ga0132258_10014352 | All Organisms → cellular organisms → Bacteria | 16844 | Open in IMG/M |
| 3300015373|Ga0132257_102187210 | Not Available | 716 | Open in IMG/M |
| 3300017823|Ga0187818_10024301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2594 | Open in IMG/M |
| 3300017823|Ga0187818_10035175 | Not Available | 2151 | Open in IMG/M |
| 3300017823|Ga0187818_10115219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
| 3300017934|Ga0187803_10231793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300017966|Ga0187776_10224313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1191 | Open in IMG/M |
| 3300018027|Ga0184605_10094609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
| 3300018060|Ga0187765_11290484 | Not Available | 516 | Open in IMG/M |
| 3300018431|Ga0066655_10048568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2175 | Open in IMG/M |
| 3300018431|Ga0066655_10069292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1885 | Open in IMG/M |
| 3300018431|Ga0066655_10780458 | Not Available | 649 | Open in IMG/M |
| 3300018433|Ga0066667_11790326 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300018468|Ga0066662_10029911 | All Organisms → cellular organisms → Bacteria | 3215 | Open in IMG/M |
| 3300018468|Ga0066662_11712356 | Not Available | 657 | Open in IMG/M |
| 3300018468|Ga0066662_12416481 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300019361|Ga0173482_10310762 | Not Available | 698 | Open in IMG/M |
| 3300019877|Ga0193722_1112406 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300019879|Ga0193723_1034457 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300019879|Ga0193723_1052674 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300020002|Ga0193730_1023707 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300020004|Ga0193755_1003195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5198 | Open in IMG/M |
| 3300020004|Ga0193755_1018448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2301 | Open in IMG/M |
| 3300020004|Ga0193755_1025335 | Not Available | 1965 | Open in IMG/M |
| 3300020006|Ga0193735_1106501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300020199|Ga0179592_10323735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300020579|Ga0210407_10027870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4201 | Open in IMG/M |
| 3300020580|Ga0210403_10768936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300020581|Ga0210399_10801386 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300020583|Ga0210401_10061071 | All Organisms → cellular organisms → Bacteria | 3550 | Open in IMG/M |
| 3300020583|Ga0210401_10065752 | All Organisms → cellular organisms → Bacteria | 3415 | Open in IMG/M |
| 3300020583|Ga0210401_10345137 | Not Available | 1350 | Open in IMG/M |
| 3300021086|Ga0179596_10593611 | Not Available | 562 | Open in IMG/M |
| 3300021178|Ga0210408_10025792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4667 | Open in IMG/M |
| 3300021344|Ga0193719_10158242 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300021407|Ga0210383_10957356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 728 | Open in IMG/M |
| 3300021407|Ga0210383_10984583 | Not Available | 716 | Open in IMG/M |
| 3300021432|Ga0210384_10013768 | All Organisms → cellular organisms → Bacteria | 8047 | Open in IMG/M |
| 3300021559|Ga0210409_10167357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2010 | Open in IMG/M |
| 3300021861|Ga0213853_10600761 | Not Available | 536 | Open in IMG/M |
| 3300025885|Ga0207653_10190559 | Not Available | 770 | Open in IMG/M |
| 3300025898|Ga0207692_10721814 | Not Available | 648 | Open in IMG/M |
| 3300025905|Ga0207685_10611668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300025906|Ga0207699_10676189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 755 | Open in IMG/M |
| 3300025920|Ga0207649_11524603 | Not Available | 529 | Open in IMG/M |
| 3300025922|Ga0207646_10023610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5647 | Open in IMG/M |
| 3300025922|Ga0207646_11488397 | Not Available | 587 | Open in IMG/M |
| 3300025945|Ga0207679_10351498 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
| 3300026297|Ga0209237_1236167 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026300|Ga0209027_1196792 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300026312|Ga0209153_1013619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2596 | Open in IMG/M |
| 3300026328|Ga0209802_1014778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4449 | Open in IMG/M |
| 3300026328|Ga0209802_1194206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300026360|Ga0257173_1006434 | Not Available | 1242 | Open in IMG/M |
| 3300026529|Ga0209806_1308730 | Not Available | 531 | Open in IMG/M |
| 3300026552|Ga0209577_10047366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3647 | Open in IMG/M |
| 3300026557|Ga0179587_10063645 | Not Available | 2156 | Open in IMG/M |
| 3300027565|Ga0209219_1153002 | Not Available | 554 | Open in IMG/M |
| 3300027603|Ga0209331_1111778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300027645|Ga0209117_1090038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300027651|Ga0209217_1148175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300027654|Ga0209799_1123126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300027667|Ga0209009_1092899 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300027846|Ga0209180_10417600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300027854|Ga0209517_10030912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4495 | Open in IMG/M |
| 3300027862|Ga0209701_10071342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2198 | Open in IMG/M |
| 3300027862|Ga0209701_10142045 | Not Available | 1471 | Open in IMG/M |
| 3300027862|Ga0209701_10638029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300027869|Ga0209579_10171065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300027882|Ga0209590_10132372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1528 | Open in IMG/M |
| 3300027894|Ga0209068_10049568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2128 | Open in IMG/M |
| 3300027894|Ga0209068_10076355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1738 | Open in IMG/M |
| 3300027911|Ga0209698_10023331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5807 | Open in IMG/M |
| 3300027911|Ga0209698_10763818 | Not Available | 732 | Open in IMG/M |
| 3300027915|Ga0209069_10083789 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300030974|Ga0075371_10848232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300031231|Ga0170824_118810566 | Not Available | 711 | Open in IMG/M |
| 3300031469|Ga0170819_12975114 | Not Available | 520 | Open in IMG/M |
| 3300031474|Ga0170818_102326636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300031720|Ga0307469_10115605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1926 | Open in IMG/M |
| 3300031720|Ga0307469_10571064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300031720|Ga0307469_10633419 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300031720|Ga0307469_10984974 | Not Available | 786 | Open in IMG/M |
| 3300031720|Ga0307469_11005404 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031740|Ga0307468_101591741 | Not Available | 610 | Open in IMG/M |
| 3300031820|Ga0307473_10273746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1048 | Open in IMG/M |
| 3300031820|Ga0307473_10634680 | Not Available | 742 | Open in IMG/M |
| 3300031938|Ga0308175_100159104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2176 | Open in IMG/M |
| 3300031954|Ga0306926_11516233 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300031962|Ga0307479_10040289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4485 | Open in IMG/M |
| 3300031962|Ga0307479_10241763 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300032180|Ga0307471_100064089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3126 | Open in IMG/M |
| 3300032180|Ga0307471_100135435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2332 | Open in IMG/M |
| 3300032180|Ga0307471_100462009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1411 | Open in IMG/M |
| 3300032180|Ga0307471_100482108 | Not Available | 1385 | Open in IMG/M |
| 3300032180|Ga0307471_100605097 | Not Available | 1255 | Open in IMG/M |
| 3300032180|Ga0307471_102021921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300032180|Ga0307471_103280932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300032205|Ga0307472_100101386 | Not Available | 1981 | Open in IMG/M |
| 3300032205|Ga0307472_100610557 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300032770|Ga0335085_11792859 | Not Available | 629 | Open in IMG/M |
| 3300032783|Ga0335079_10179964 | All Organisms → cellular organisms → Bacteria | 2356 | Open in IMG/M |
| 3300032829|Ga0335070_10000286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 58919 | Open in IMG/M |
| 3300032829|Ga0335070_10010122 | All Organisms → cellular organisms → Bacteria | 11029 | Open in IMG/M |
| 3300032829|Ga0335070_10081813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3433 | Open in IMG/M |
| 3300032829|Ga0335070_10345107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1434 | Open in IMG/M |
| 3300033004|Ga0335084_10549927 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300033004|Ga0335084_11013374 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300033004|Ga0335084_11255632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 739 | Open in IMG/M |
| 3300033004|Ga0335084_12149621 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300033158|Ga0335077_10363889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1564 | Open in IMG/M |
| 3300033433|Ga0326726_11168312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300033513|Ga0316628_101951375 | Not Available | 780 | Open in IMG/M |
| 3300033806|Ga0314865_119801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.95% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.17% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.39% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.39% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.39% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.39% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.39% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.39% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.39% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.39% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.39% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.39% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.39% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.39% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012980 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCW15 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_105209512 | 3300001593 | Forest Soil | ESGVMDAKYNYIIDSVKWRIVLNLAGFGLWLAASVVLLRLT* |
| JGI12627J18819_100525553 | 3300001867 | Forest Soil | MDAKYNYIIDSMKWRIALNLAGFAVWLVASVVLLRAAA* |
| JGIcombinedJ26739_1000123816 | 3300002245 | Forest Soil | MDAKYNYIIDXMKWRIVLNLAGFGLWLAASVVLLRLT* |
| JGIcombinedJ26739_1001962953 | 3300002245 | Forest Soil | MDAKYNYIIDSMKWRIMLNLAGFGLWLAASVVLLRLTTL* |
| JGIcombinedJ26739_1008788411 | 3300002245 | Forest Soil | MDAKYNYIIDSMKWRIMLNVAGFGLWLAASVVLLRLTF* |
| JGI25382J43887_101468661 | 3300002908 | Grasslands Soil | VMDAKYNYIIDSMTWRIALNLAGFAAWLAAAVALLRAAA* |
| JGI25390J43892_100134983 | 3300002911 | Grasslands Soil | MDAKYNYIIDSMKWRIALNMAGFTLWLVTAFSLLNVAVR* |
| Ga0066672_104515342 | 3300005167 | Soil | MDAKYNYIIDSMKWRIGLNMAGFALWLITALALLKVAVR* |
| Ga0066683_104648062 | 3300005172 | Soil | RWIMDAKYNYIIDSMRWRIILNLVGFGLWLAASAALLRLAS* |
| Ga0066683_106133191 | 3300005172 | Soil | MDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKAAVR* |
| Ga0066676_103863681 | 3300005186 | Soil | VMDAKYNYIIDSMRWRIILNLVGFGLWLAASAALLRLAS* |
| Ga0066675_111107232 | 3300005187 | Soil | MDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKVAVR* |
| Ga0070711_1009522902 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKYNYIIDSMKWRIVLNLAGFGLWLATGVVMLRLTSGNALIAT |
| Ga0070708_1001231882 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKYNYIIDSMKWRIALNMAGFTLWLVTALALLKVAVR* |
| Ga0070708_1002975785 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | WVMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLHLA* |
| Ga0070707_1016772202 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | WVMDAKYNYIIDSMKWRIMLNLVAFGLWLAASVVLLRLAGS* |
| Ga0070699_1001725721 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IKKRGEWVMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVALLHLA* |
| Ga0070699_1006060543 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKYNYIIDSMKWRIALNMAGFALWLVTALALLKVAVR* |
| Ga0070699_1011669701 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IKKRGEWVMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLHLA* |
| Ga0070741_100151705 | 3300005529 | Surface Soil | MDAKYNYIIDSVKWRVALNLAGFALWLAASLALLRAAA* |
| Ga0070741_105475821 | 3300005529 | Surface Soil | MDAKYNYIMVSAKWRIALNIAGFALWFAVAVGLLAA |
| Ga0070697_1001504242 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKYNYIIDSMKWRIALNMAGFTLWLVTAFALLKVAVR* |
| Ga0070697_1006287321 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RGEWVMDAKYNYIIDSMKWRIMLNLGAFGLWLAASLVLLRLA* |
| Ga0070731_101531762 | 3300005538 | Surface Soil | MDAKYNYIIDSIKWRIALNLAGFGLWLATSVVLLRLT* |
| Ga0070731_103555352 | 3300005538 | Surface Soil | MDAKYNFIIDSITWRIALNLAGFGVWLAISLALIKVAA* |
| Ga0066697_102859322 | 3300005540 | Soil | MDAKYNYIIDSMRWRIILNLVGFGLWLAASAALLRLAS* |
| Ga0070693_1007572271 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GLAVQFGNEESGVMDAKYNYIIDSMKWRIGINLAGFGLWLAAGMVLLRLT* |
| Ga0070665_1001352774 | 3300005548 | Switchgrass Rhizosphere | MDAKYNYIIDSMKWRIGINLAGFGLWLAAGMVLLRLT* |
| Ga0066701_104838622 | 3300005552 | Soil | MDAKYNYIIDSMKWRIALNVVGFGVWLAVAVGLLRAAA* |
| Ga0066661_100046812 | 3300005554 | Soil | MDAKYNYIIDSVKWRIALNVTGFAAWVAAAFVLLKTAG* |
| Ga0066661_100059572 | 3300005554 | Soil | MDAKYNYIIDSVKWRLVLNVSGFAVWLAAAFVLLKTAG* |
| Ga0066661_100179182 | 3300005554 | Soil | MDAKYNYIIDSMKWRIALNLAGFAVWLAVSVALLRAAA* |
| Ga0066661_101651751 | 3300005554 | Soil | TTGEWVMDAKYNYIIDSMKWRIGLNMAGFALWLITALALLKVAVR* |
| Ga0066699_104771571 | 3300005561 | Soil | MEAKYNYIMDSMKWRIGLNLAGFAVWIVAAVALLKAGA* |
| Ga0066703_103467441 | 3300005568 | Soil | MDAKYNYIIDSMKWRIALNLAGFAVWLAASVALLRAVA* |
| Ga0066702_103419572 | 3300005575 | Soil | MDAKYNYIIDSMKWRIALNLAGFAVWLAASVALLRAAA* |
| Ga0066702_108800782 | 3300005575 | Soil | MDSKYNHIIDSMKWRIALNMAGFALWLVTAFALLKVAAR* |
| Ga0066706_111666162 | 3300005598 | Soil | RWLMDAKYNYIIDSVKWRIALNVTGFAAWVAAAFVLLKTAG* |
| Ga0068866_113050171 | 3300005718 | Miscanthus Rhizosphere | MDAKYNYIIDSMKWRIVLNLAGFVLWLATGVVMLRLT* |
| Ga0066903_1048199782 | 3300005764 | Tropical Forest Soil | MDAKYNYIIDSMKWRILLNVTGFAVWLAVSAALLKAA |
| Ga0066903_1087833742 | 3300005764 | Tropical Forest Soil | MDAKYNYIIDSIKWRIVLNLAGFGLWLAASVALLRLT* |
| Ga0070766_101336621 | 3300005921 | Soil | MDAKYNYIIDSMKWRIGLNLAGFSLWLATTVVLLRLT* |
| Ga0066788_100570231 | 3300005944 | Soil | VPSNERAKESVMDAKYNFIIDSWKWRIALNVAGFAVWLTAVVGLIKLAA* |
| Ga0081540_10545444 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MDAKYNYVIDSMKWRIVLNLAGFGLWLAASVALLRLI* |
| Ga0070717_100352815 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKYNYIIDSMKWRIMLNLVAFGLWLAASVVLLRLAGS* |
| Ga0070717_114013942 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VDAKYNYIIDSMKWRIMLNLAGFGLWLAAVVVLLRLTF* |
| Ga0066656_100762201 | 3300006034 | Soil | MDAKYNYIIDSMRWRIVLNLAGFGLWLAASVVLLRLT* |
| Ga0066652_1016910642 | 3300006046 | Soil | MDSKYNHIIDSMKWRIALNMAGFTLWLVTAFALLKVAVR* |
| Ga0075024_1007100161 | 3300006047 | Watersheds | MDAKYNYIIDSMKWRIVLNLAGFGLWLAAGVFLLRLT* |
| Ga0075028_1000054083 | 3300006050 | Watersheds | MDAKWNGFIDSMGWRIVLNLAGFVVWLAATVGILWVSV* |
| Ga0075029_1000396422 | 3300006052 | Watersheds | MGAKYNYIIDSVTWRVGLNLAGFALWLATVVVLLAAAYL* |
| Ga0075029_1001679503 | 3300006052 | Watersheds | MDAKYNYIIDSMNWRIALNVAGFAVWLALGLALLRVAGA* |
| Ga0075017_1008962252 | 3300006059 | Watersheds | MDAKYNYIIDSMQWRIALNVAGFALWLALGLALLRIAGA* |
| Ga0070716_1012273581 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKYNYIIDSVKWRIALNMAGFTLWLVSALALLKVAVR* |
| Ga0075021_101602442 | 3300006354 | Watersheds | MDAKHNYIIDSMKWRIGLNLAGFGLWLATAVVLLRLT* |
| Ga0066653_107125021 | 3300006791 | Soil | MDAKYNYIIDSIKWRIALNMAGFTLWLVTAFTLLKVAGR* |
| Ga0066660_108884661 | 3300006800 | Soil | DAKYNYIIDSMRWRIILNVVGFGLWLAASAALLRLAS* |
| Ga0079221_105462342 | 3300006804 | Agricultural Soil | MDARYNYIIDSMSWRIVLNVTGFSLWLAASMALLRLT* |
| Ga0075425_1022749921 | 3300006854 | Populus Rhizosphere | MDAKYNYIIDSMKWRIMLNLAGFGLWLATSVVLLRLT* |
| Ga0075434_1001680563 | 3300006871 | Populus Rhizosphere | MDAKYNYIIDSMKWRIVLNLAGFSLWLAATVVLLRLT* |
| Ga0073928_111302622 | 3300006893 | Iron-Sulfur Acid Spring | MDAKYNYIIDSMKWRIMLNLAGFGLWLAASVVLLRLT* |
| Ga0073928_111306511 | 3300006893 | Iron-Sulfur Acid Spring | MDAKYNYIIDSVKWRIVLNLAGFGLWLGASLVLLRLT* |
| Ga0099794_104422471 | 3300007265 | Vadose Zone Soil | GEWVMDAKYNYIIDSMKWRIGLNMAGFALWLITALALLKVAVR* |
| Ga0099795_101761111 | 3300007788 | Vadose Zone Soil | MDAKYNYIIDSMKWRIGLNLAGFGLWLATAVVLLRLT* |
| Ga0099829_100354813 | 3300009038 | Vadose Zone Soil | MDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLT* |
| Ga0099829_100831565 | 3300009038 | Vadose Zone Soil | VDAKYNYIIDSMKWRIVLNLAGFGLWLAASAVLLRLTTL* |
| Ga0099829_102066682 | 3300009038 | Vadose Zone Soil | MDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLQLAAVD* |
| Ga0099829_103904962 | 3300009038 | Vadose Zone Soil | MDAKYNYIIDSMKWRIGLNLAGFGLWLATTVVLLRLT* |
| Ga0099829_105185931 | 3300009038 | Vadose Zone Soil | ERWIMDAKYNYIIDSMRWRIILNLVGFGLWLAASAALLRLAS* |
| Ga0099829_106076872 | 3300009038 | Vadose Zone Soil | DAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT* |
| Ga0099829_106112681 | 3300009038 | Vadose Zone Soil | MDAKYNYIIDSMRWRIGLNLAGFGLWLATAVVLLRLT* |
| Ga0099829_106217871 | 3300009038 | Vadose Zone Soil | VDAKYNYIIDSMKWRIMLNLAGFGLWLAASVVLLRLTTL* |
| Ga0099829_108531781 | 3300009038 | Vadose Zone Soil | MDAKYNYVIDSMKWRIMLNLGVFGLWLAASVVLLRLA* |
| Ga0099829_108881312 | 3300009038 | Vadose Zone Soil | MDAKYNYIIDSMKWRIMLNLAGFSLWLAASVALLLAAGSFS* |
| Ga0099829_110733532 | 3300009038 | Vadose Zone Soil | MDAKYNYIIDSMTWRIALNLAGFAAWLAAAVALLRAAA* |
| Ga0099829_116285771 | 3300009038 | Vadose Zone Soil | MDAKYNYIIDSMKWRIMLNLGVFGLWLAASVILLHLA* |
| Ga0099830_100622865 | 3300009088 | Vadose Zone Soil | VDAKYNYIIDSTKWRIVLNLAGFGLWLAASAVLLRLTTL* |
| Ga0099830_101713022 | 3300009088 | Vadose Zone Soil | MDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT* |
| Ga0099830_101832892 | 3300009088 | Vadose Zone Soil | MDAKYNYIIDSMKWRIALNLVGFAVWLATAVALLRA* |
| Ga0099830_103184462 | 3300009088 | Vadose Zone Soil | MDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLRLA* |
| Ga0099828_101622763 | 3300009089 | Vadose Zone Soil | MDAKYNYIVDSMKWRIMLNLGVFGLWLAASVILLHLA* |
| Ga0099828_102769113 | 3300009089 | Vadose Zone Soil | MDAKYNYIIDSMKWRIMLNLGAFGLWLAASLVLLRLA* |
| Ga0099828_113061772 | 3300009089 | Vadose Zone Soil | VDAKYNYIIDSTKWRIMLNVAGFGLWLAASVVLLRLTTL* |
| Ga0099828_117905772 | 3300009089 | Vadose Zone Soil | MDAKYNYIIDSMTWRIVLNLGVFGLWLAASVVLLHLA* |
| Ga0099827_101954861 | 3300009090 | Vadose Zone Soil | EWVMDAKYNYIIDSMTWRIALNLAGFAAWLAAAVALLRAAA* |
| Ga0105250_105647131 | 3300009092 | Switchgrass Rhizosphere | MDAKYNYIIDSMKWRIVLNLAGFALWLATGVVMLRLT* |
| Ga0105247_100185043 | 3300009101 | Switchgrass Rhizosphere | MDAKYNYIIDSMKWRIGINLAGFGLWLATSVVLLRLT* |
| Ga0075423_126773511 | 3300009162 | Populus Rhizosphere | EWVMDAKYNHIIDSMKWRIALNMAGFALWLVTALELLKVAVR* |
| Ga0105242_110828531 | 3300009176 | Miscanthus Rhizosphere | MDAKYNYIIDSMKWRIVMNLAGFGLWLAASMVLLRLT* |
| Ga0116111_10381363 | 3300009616 | Peatland | MDAKYNYIIDSVTWRIGLNLAGFALWLAAIAGLLAAVQL* |
| Ga0126382_124793631 | 3300010047 | Tropical Forest Soil | MDAKYNYIIDSMKWRIVLNLAAFGLWLATSVALLRVT* |
| Ga0134111_104690061 | 3300010329 | Grasslands Soil | MDAKYNYIIDSMRWRIILNVVGFFLWLAASAALLRLAT* |
| Ga0074046_101511812 | 3300010339 | Bog Forest Soil | MSAKYNYIIDSMKWRVWLNLVGFALWLAAVVGLFAAAEL* |
| Ga0126370_115656301 | 3300010358 | Tropical Forest Soil | MDAKYNYIIDSIPWRIILNLVGFGLWLAASAALLHLAS* |
| Ga0126376_114379601 | 3300010359 | Tropical Forest Soil | MDAKYNYIIDSMKWRIVLNLAGFGLWLVASVTLLRLT* |
| Ga0126372_110317811 | 3300010360 | Tropical Forest Soil | KRWVMDAKYNYIIDSIPWRIILNLVGFGLWLAASAALLHLAS* |
| Ga0126379_129272881 | 3300010366 | Tropical Forest Soil | MDAKYNYIIDSMKWRIALNLAGFSLWLATAIVLMK |
| Ga0126345_11966962 | 3300010858 | Boreal Forest Soil | AKYNYIIDSMKWRILLNLAGFGVWLATSIVLLRLT* |
| Ga0126349_10847211 | 3300010861 | Boreal Forest Soil | MDAKYNYIIDSMKWRVMLNLAGFGLWLAASVVLLRLTTL* |
| Ga0150983_112186201 | 3300011120 | Forest Soil | MDAKYNYIIDSMKWRIMLNLAGFGLWLATSVALLRLT* |
| Ga0150983_114254932 | 3300011120 | Forest Soil | AKYNYIIDSMKWRITLNLAGFGLWLAAVVVLLRLTF* |
| Ga0150983_128089762 | 3300011120 | Forest Soil | MDAKYNNIIDSMKWRIVLNLTGFGLWLAASVVLLRLT* |
| Ga0150983_144466571 | 3300011120 | Forest Soil | MDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLLTF* |
| Ga0137392_104795741 | 3300011269 | Vadose Zone Soil | VDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLT* |
| Ga0137392_115172211 | 3300011269 | Vadose Zone Soil | VDAKYNYIIDSMKWRVMLNLAGFGLWLAASVVLLRLTTL* |
| Ga0137391_106658851 | 3300011270 | Vadose Zone Soil | MDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVFLRLT* |
| Ga0137393_112784092 | 3300011271 | Vadose Zone Soil | VDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT* |
| Ga0137463_10429402 | 3300011444 | Soil | MVMDAKYNYIIDSMKWRIALNLAGFAVWLAVTVALFKAAT* |
| Ga0137389_101158293 | 3300012096 | Vadose Zone Soil | MDARYNYIIDSMKWRIMLNLGAFGLWLAASLVLLRLA* |
| Ga0137389_112553822 | 3300012096 | Vadose Zone Soil | MDAEYNYIIDSMKWRIMLNLGVFGLWLAASVILLHLA* |
| Ga0137388_103861551 | 3300012189 | Vadose Zone Soil | MDAKYNYIIDSMKWRIMLNLGGFGLWLAASVVLLRLA* |
| Ga0137388_106716211 | 3300012189 | Vadose Zone Soil | KYNYIIDSMRWRIGLNLAGFGLWLATAVVLLRLT* |
| Ga0137388_110882541 | 3300012189 | Vadose Zone Soil | MDAKYNYIIDSMKWRIMLNVAVFGLWLAASVALLLLS* |
| Ga0137364_109031431 | 3300012198 | Vadose Zone Soil | MDAKYNYIIDSMRWRIILNVVGFGLWLAASAALLRLAS* |
| Ga0137364_113086071 | 3300012198 | Vadose Zone Soil | MDAKYNYIIDSVKWRIGLNMAGFTLWLVTAIALLNVAAR* |
| Ga0137382_105606101 | 3300012200 | Vadose Zone Soil | MDAKYNYIMDSIKWRIGLNMAGFALWLVTAFALLKVAV |
| Ga0137382_107930532 | 3300012200 | Vadose Zone Soil | DSKYNHIIDSMKWRIALNMAGFTLWLVTAFALLKVAVR* |
| Ga0137382_109965731 | 3300012200 | Vadose Zone Soil | MDAKYNHIIDSMKWRIALNMAGFTLWLVTALALLKVAVR* |
| Ga0137363_104541131 | 3300012202 | Vadose Zone Soil | MDARYNYIIDSMKWRIALNLTGFGLWLVASVVLLRLT* |
| Ga0137399_104837622 | 3300012203 | Vadose Zone Soil | MDAKYNYIIDSMKWRIGLNMAGFTLWLVTAFALLKAAGR* |
| Ga0137399_115252902 | 3300012203 | Vadose Zone Soil | MDAKYNYIMDSIKWRIGLNMAGFALWLVTAFALLKVAVR* |
| Ga0137362_108539212 | 3300012205 | Vadose Zone Soil | MDAKYNYIIDSVTWRIVLNLAGFGLWLAASVVLLRLT* |
| Ga0137381_101002083 | 3300012207 | Vadose Zone Soil | MDAKYNYIIDSMRWRIILNLVGLGLWLAASAALLRLAS* |
| Ga0137370_103280772 | 3300012285 | Vadose Zone Soil | MDSKYNHIIDSMKWRIALNMAGFTLWLVTALALLKVAVR |
| Ga0137371_109095201 | 3300012356 | Vadose Zone Soil | MDAKYNYIIDSMKWRIALNMAGFTLWLVTAFALLKAAVR* |
| Ga0137385_100599802 | 3300012359 | Vadose Zone Soil | MDAKYNYIIDSMRWRIILNVVGFGLWLATSAALLRLAS* |
| Ga0137361_112205021 | 3300012362 | Vadose Zone Soil | MDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKVAGR* |
| Ga0137361_116974481 | 3300012362 | Vadose Zone Soil | SGVMDARYNYIIDSMKWRIALNLTGFGLWLVASVVLLRLT* |
| Ga0137390_102798831 | 3300012363 | Vadose Zone Soil | MDAKYNHIIDSMKWRIGLNLAGFSLWLATTVVLLRLT* |
| Ga0150984_1217038783 | 3300012469 | Avena Fatua Rhizosphere | MDAKYNYIIDSMRWRIVLNLAGFGLWLAASVVLLQLT* |
| Ga0137398_104018472 | 3300012683 | Vadose Zone Soil | MDAKYNYIIDSVTWRIVLNLTGFGLWLAASVVLLRLT* |
| Ga0137395_105295072 | 3300012917 | Vadose Zone Soil | MDAKYNYIIDSMRWRIGLNLAGFGLWLATGVVLLRLT* |
| Ga0137396_105494711 | 3300012918 | Vadose Zone Soil | MDAKYNYIIDSMKWRIALNLAGFGLWLATAVVLLRLT* |
| Ga0137394_101932703 | 3300012922 | Vadose Zone Soil | MDAKYNYIIDSVKWRIALNMAGFTLWLVTAVALLNVAAR* |
| Ga0137359_105115661 | 3300012923 | Vadose Zone Soil | MDAKYNYIIDSMRWRIILNVVGFGLWLAASAALLRL |
| Ga0137407_101077694 | 3300012930 | Vadose Zone Soil | MDAKYNYIIDSIKWRIVLNLTGFGLWLAVSMVLLRLT* |
| Ga0162652_1000365182 | 3300012941 | Soil | MDAKYNHIIDSMKWRIVLNLAGFGLWLAASMVLLRLT* |
| Ga0164303_106272942 | 3300012957 | Soil | MDAKYNYIIDSIKWRIALNMAGFTLWLVTAFTLLKVAAR* |
| Ga0168315_1119023 | 3300012980 | Weathered Mine Tailings | VGWVMDAIYNYIIDSMNWRIALNVAGFAVWLALGLALLRVAGA* |
| Ga0157379_103882691 | 3300014968 | Switchgrass Rhizosphere | MDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLR |
| Ga0157376_127219161 | 3300014969 | Miscanthus Rhizosphere | KYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT* |
| Ga0137403_113370461 | 3300015264 | Vadose Zone Soil | MDAKYNHIIDSMKWRIVLNLAGFGLWLATSVILLRLT* |
| Ga0132258_1001435212 | 3300015371 | Arabidopsis Rhizosphere | MDAKYNYIIDSMKWRIVLNLAGFSLWLGGTGVFLRLT* |
| Ga0132257_1021872101 | 3300015373 | Arabidopsis Rhizosphere | MDAKYNYIIDSMKWRIVMNLVGFGLWLAAGMALLRLT* |
| Ga0187818_100243016 | 3300017823 | Freshwater Sediment | MSAKYNYIIDSMKWRVWLNLVGFALWLAAVVGLFAAAEV |
| Ga0187818_100351752 | 3300017823 | Freshwater Sediment | YNYIIDSMKWRVWLNLVGFALWLAAVVGLFVAAEL |
| Ga0187818_101152192 | 3300017823 | Freshwater Sediment | MDAKYNYIIDSVAWRVAMNVAGFALWMAAVVGLLGTAA |
| Ga0187803_102317931 | 3300017934 | Freshwater Sediment | MDAKYNYIIDSMKWRIMLNLAGFGLWLGASLVLLRLTF |
| Ga0187776_102243133 | 3300017966 | Tropical Peatland | MDAKYNYIIDSMKWRIALNLAGFSLWLATAIVLLRMAA |
| Ga0184605_100946091 | 3300018027 | Groundwater Sediment | MDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKVAVR |
| Ga0187765_112904842 | 3300018060 | Tropical Peatland | MDAKYNYIIDSMNWRIALNVAGFVVWLAAGLALLHVAGA |
| Ga0066655_100485681 | 3300018431 | Grasslands Soil | MDAKYNYIIDSMRWRIILNVVGFGLWLAASAALLRLAS |
| Ga0066655_100692922 | 3300018431 | Grasslands Soil | MDAKYNYIIDSMRWRIVLNLVGFGLWLAASVVLLRLT |
| Ga0066655_107804581 | 3300018431 | Grasslands Soil | MDAKYNYIIDSMRWRIILNLVGFGLWLAASAALLRLAS |
| Ga0066667_117903261 | 3300018433 | Grasslands Soil | TTGEWVMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFSLLNVAVR |
| Ga0066662_100299112 | 3300018468 | Grasslands Soil | MDAKYNYIIDSVKWRIALNVTGFAAWVAAAFVLLKTAG |
| Ga0066662_117123562 | 3300018468 | Grasslands Soil | MDAKYNYIIDSVKWRLVLNVSGFAVWLAAAFVLLKTAG |
| Ga0066662_124164811 | 3300018468 | Grasslands Soil | MDAKYNYIIDSMKWRIGLNMAGFALWLITALALLKVAVR |
| Ga0173482_103107622 | 3300019361 | Soil | MDAKYNYIIDSMKWRIGINLAGFGLWLAAGMVLLRLT |
| Ga0193722_11124061 | 3300019877 | Soil | MDAKYNYIIDSMKWRIALNMAGFTLWLVTALALLKVAVR |
| Ga0193723_10344571 | 3300019879 | Soil | MDAKYNYIIDSMKWRIGLNLAGFGLWLATAVVLLRLT |
| Ga0193723_10526742 | 3300019879 | Soil | MDSKYNYIIDSMKWRIALNMAGFTLWLVTAFSLLNVAVR |
| Ga0193730_10237072 | 3300020002 | Soil | MDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKVAAR |
| Ga0193755_10031954 | 3300020004 | Soil | MDAKYIIDSIKWRIALNMAGFTLWLATAFTLLKVAAR |
| Ga0193755_10184482 | 3300020004 | Soil | MDAKYNYIIDSMKWRIALNMAGFTLWLVTALVLLKVAVR |
| Ga0193755_10253352 | 3300020004 | Soil | MDAKYNYIIDSMKWRIALNMAGFTLWLVTAFSLLNVAVR |
| Ga0193735_11065012 | 3300020006 | Soil | MDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKAAVR |
| Ga0179592_103237352 | 3300020199 | Vadose Zone Soil | KVKRSEVMDAKYNYIIDSVTWRIVLNLTGFGLWLAASVVLLRLT |
| Ga0210407_100278704 | 3300020579 | Soil | MGAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLT |
| Ga0210403_107689361 | 3300020580 | Soil | MDAKYNNIIDSMKWRIVLNLTGFGLWLAASVVLLRLT |
| Ga0210399_108013862 | 3300020581 | Soil | MDAKYNYIIDSMKWRIMLNLAGFGLWLATSVALLRLT |
| Ga0210401_100610712 | 3300020583 | Soil | MDAKYNYIIDSMKWRIGLNLAGFSLWLATTVVLLRLT |
| Ga0210401_100657523 | 3300020583 | Soil | MDAKYNYIIDSAKWRILLNLAGFGLWLAASVVLLRLT |
| Ga0210401_103451372 | 3300020583 | Soil | MDAKYNYIIDSMKWRIMLNLAGFGLWLAAIVVLLRLTF |
| Ga0179596_105936112 | 3300021086 | Vadose Zone Soil | MDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLT |
| Ga0210408_100257928 | 3300021178 | Soil | MDAKYNYIIDSVKWRIILNLAGFGLWLAASVLLLR |
| Ga0193719_101582421 | 3300021344 | Soil | EWVMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKVAVR |
| Ga0210383_109573561 | 3300021407 | Soil | DAKYNDIIDSMKWRIVLNLTGFGLWLAASVVLLRLT |
| Ga0210383_109845831 | 3300021407 | Soil | MDAKYNYIIDSIKWRIALNLAGFGLWLATSVALLRLT |
| Ga0210384_100137681 | 3300021432 | Soil | MDAKYNYIIDSMKWRIGLNLAGFILWLATTVALLRLT |
| Ga0210409_101673572 | 3300021559 | Soil | MDAKYNYYIDSMKWRIMLNLAGFGLWLAAMVVLLRLTF |
| Ga0213853_106007611 | 3300021861 | Watersheds | MGAKYNYIIDSVTWRVGLNLAGFALWLATVVVLLAAAYL |
| Ga0207653_101905591 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKYNYIIDSMKWRIVLNLAGFALWLATGVVMLRLT |
| Ga0207692_107218141 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKYNYIIDSMKWRIALNLAGFGLWLATSVVLLRLT |
| Ga0207685_106116682 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MDARYNYIIDSMKWRIVLNLAGFGLWLATGVVMLRLT |
| Ga0207699_106761892 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | IMDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT |
| Ga0207649_115246031 | 3300025920 | Corn Rhizosphere | QFGNEESGVMDAKYNYIIDSMKWRIGINLAGFGLWLAAGMVLLRLT |
| Ga0207646_100236102 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKYNYIIDSMTWRIALNLAGFAAWLVAAVALLRAAA |
| Ga0207646_114883972 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GGWVMDAKYNYIIDSMKWRIMLNLVAFGLWLAASVVLLRLAGS |
| Ga0207679_103514983 | 3300025945 | Corn Rhizosphere | MDAKYNYIIDSMKWRIGINLAGFGLWLAAGMVLLR |
| Ga0209237_12361672 | 3300026297 | Grasslands Soil | MDAKYNYIIDSMTWRIALNLAGFAAWLAAAVALLRAAA |
| Ga0209027_11967922 | 3300026300 | Grasslands Soil | MDAKYNYIIDSIKWRIALNMAGFTLWLVTAFTLLK |
| Ga0209153_10136195 | 3300026312 | Soil | MDAKYNYIIDSMRWRIVLNLAGFGLWLAASVVLLRLT |
| Ga0209802_10147785 | 3300026328 | Soil | MDAKYNYIIDSMKWRIALNVVGFGVWLAVAVGLLRAAA |
| Ga0209802_11942062 | 3300026328 | Soil | LDAKYNYIIDSMTWRIALNLAGFAAWLASALALLSAAA |
| Ga0257173_10064341 | 3300026360 | Soil | MDAKYNYIIDSMKWRIVLNLAGFGLWLAASAVLLRLTTL |
| Ga0209806_13087301 | 3300026529 | Soil | MDAKYNYIIDSMKWRIALNLAGFAVWLAASVALLRAVA |
| Ga0209577_100473662 | 3300026552 | Soil | MEAKYNYIMDSMKWRIGLNLAGFAVWIVAAVALLKAGA |
| Ga0179587_100636452 | 3300026557 | Vadose Zone Soil | MDAKYNYIIDSVTWRIVLNLTGFGLWLAASVVLLRLT |
| Ga0209219_11530022 | 3300027565 | Forest Soil | MDAKYNYIIDSMKWRIMLNLAGFGLWLAASVVLLRLT |
| Ga0209331_11117782 | 3300027603 | Forest Soil | MDAKYNYIIDSMKWRIMLNLAGFGLWLAASVVLLRLTTL |
| Ga0209117_10900382 | 3300027645 | Forest Soil | MDAKYNYIIDSVKWRIVLNLAGFGLWLAASVVLLRLT |
| Ga0209217_11481752 | 3300027651 | Forest Soil | MDAKYNHIIDSMKWRIVLNLGGFGLWLAASAALLRGG |
| Ga0209799_11231262 | 3300027654 | Tropical Forest Soil | SRKRRWVMDAKYNYIIDSMKWRIVLNLAGFGLWLVASVALLRLT |
| Ga0209009_10928992 | 3300027667 | Forest Soil | MDAKYNYIIDSVKWRIVLNVAGFGLWLGASLVLLRLT |
| Ga0209180_104176002 | 3300027846 | Vadose Zone Soil | VDAKYNYIIDSMKWRIVLNLAGFGLWLAASAVLLRLTTL |
| Ga0209517_100309125 | 3300027854 | Peatlands Soil | MSAKYNYIIDSMKWRVWLNLVGFALWLAAVVGLFAAAEL |
| Ga0209701_100713421 | 3300027862 | Vadose Zone Soil | MDAKYNYIIDSMKWRIALNLVGFAVWLATAVALLRA |
| Ga0209701_101420451 | 3300027862 | Vadose Zone Soil | VVDAKYNYIIDSMKWRIVLNLAGFGLWLAASAVLLRLTTL |
| Ga0209701_106380292 | 3300027862 | Vadose Zone Soil | MDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLRLA |
| Ga0209579_101710652 | 3300027869 | Surface Soil | MDAKYNYIIDSIKWRIALNLAGFGLWLATSVVLLRLT |
| Ga0209590_101323723 | 3300027882 | Vadose Zone Soil | ERSVMDAKYNYIIDSMRWRIILNVVGFGLWLAASAALLRLAS |
| Ga0209068_100495683 | 3300027894 | Watersheds | MDAKWNGFIDSMGWRIVLNLAGFVVWLAATVGILWVSV |
| Ga0209068_100763552 | 3300027894 | Watersheds | MDAKHNYIIDSMKWRIGLNLAGFGLWLATAVVLLRLT |
| Ga0209698_100233314 | 3300027911 | Watersheds | MDAKYNYIIDSMNWRIALNVAGFAVWLALGLALLRVAGA |
| Ga0209698_107638182 | 3300027911 | Watersheds | MDAKYNYIIDSMQWRIALNVAGFALWLALGLALLRIAGA |
| Ga0209069_100837892 | 3300027915 | Watersheds | VDAKYNYIIDSMKWRIVLNLAGFGLWLAAGVFLLRLT |
| Ga0075371_108482321 | 3300030974 | Soil | VDAKYNYIIDSMKWRLILNLAGFGLWLAASMVLLRLTTL |
| Ga0170824_1188105662 | 3300031231 | Forest Soil | MDAKYNYIIDSMKWRIVLNLAGFGLWMAASMVVLRLT |
| Ga0170819_129751141 | 3300031469 | Forest Soil | MDAKYNYIIDSMKWRIVLNLAGFSLWLAASVVLLRLT |
| Ga0170818_1023266362 | 3300031474 | Forest Soil | AKYNYIIDSLKWRIVLNVAGFGLWLAASVVLLRLT |
| Ga0307469_101156053 | 3300031720 | Hardwood Forest Soil | MDAKYNYIIDSVKWRIALNMAGFTLWLVSALALLKVAVR |
| Ga0307469_105710642 | 3300031720 | Hardwood Forest Soil | MDAKYNHIIDSMKWRIALNMAGFALWLVTALALLKVAVR |
| Ga0307469_106334191 | 3300031720 | Hardwood Forest Soil | MDAKYNYIIDSIPWRIILNLVGFGLWLAASAALLHLAS |
| Ga0307469_109849742 | 3300031720 | Hardwood Forest Soil | MDAKYNYIIDSMKWRIILNLAAFGVWLATSVVLLRLT |
| Ga0307469_110054042 | 3300031720 | Hardwood Forest Soil | MDAKYNYIIDSIKWRIALNMAGFTLWLVTAFTLLKAAAR |
| Ga0307468_1015917412 | 3300031740 | Hardwood Forest Soil | SGVMDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT |
| Ga0307473_102737462 | 3300031820 | Hardwood Forest Soil | MDAKYNYIIDSMKWRIALNLAGFAVWLVASVVLLRAAA |
| Ga0307473_106346802 | 3300031820 | Hardwood Forest Soil | MDAKYNYIIDSMKWRITLNLAGFGLWLAAVVVLLRLTF |
| Ga0308175_1001591042 | 3300031938 | Soil | MDAKYNYIIDSMRWRIVLNLAGFGLWLAASVVLLQLT |
| Ga0306926_115162332 | 3300031954 | Soil | MDAKYNHIIDSMKWRIALNLTGFAVWLAVSWALIRIAA |
| Ga0307479_100402895 | 3300031962 | Hardwood Forest Soil | MDAKYNYIIDSMKWRIALNLAGFALWLVASVLLLRAAA |
| Ga0307479_102417632 | 3300031962 | Hardwood Forest Soil | MDAKYNHIIDSMKWRIVLNLAGFGLWLAATVVLLRLT |
| Ga0307471_1000640892 | 3300032180 | Hardwood Forest Soil | VDAKYNYIIDSMKWRLILNLAGFGLWLAASVVLLRLTTL |
| Ga0307471_1001354352 | 3300032180 | Hardwood Forest Soil | MDAKYNYIIDSMKWRIALNMAGFALWLVTALALLKVAVR |
| Ga0307471_1004620093 | 3300032180 | Hardwood Forest Soil | MDAKYNYIIDSMKWRIMLNLAGFGLWLGASVLLLR |
| Ga0307471_1004821081 | 3300032180 | Hardwood Forest Soil | EEFMDAKYNYIIDSMTWRIALNMAGFALWLAVSVALLRG |
| Ga0307471_1006050972 | 3300032180 | Hardwood Forest Soil | MVMDAKYNFIIDSMKWRIALNLAGFAVWLAVTVALFKVAS |
| Ga0307471_1020219211 | 3300032180 | Hardwood Forest Soil | MDAKYNYIIDSMKWRIVLNLAGFSLWLATSVVLLGLT |
| Ga0307471_1032809322 | 3300032180 | Hardwood Forest Soil | MDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLHLA |
| Ga0307472_1001013863 | 3300032205 | Hardwood Forest Soil | EWVMDAKYNHIIDSMKWRIALNMAGFALWLVTALALLKVAVR |
| Ga0307472_1006105571 | 3300032205 | Hardwood Forest Soil | MDAKYNYIIDSTPWRIILNLVGFGLWLAASAALLHLAS |
| Ga0335085_117928591 | 3300032770 | Soil | MGAKYNYIIDSVTWRIGLNLAGFALWLAAIAGLLAVAQL |
| Ga0335079_101799642 | 3300032783 | Soil | MDAKYNYIIDSMNWRIALNVAGFAIWLAAGLALLRVAGA |
| Ga0335070_1000028651 | 3300032829 | Soil | MDAKYNHIIDSISWRIALNLAGFALWLTTAVVLLHLAA |
| Ga0335070_100101228 | 3300032829 | Soil | MGAKYNYIIDSMTWRVGLNLAGFALWLAAIAGLLAAVQL |
| Ga0335070_100818132 | 3300032829 | Soil | MDAKYNHIIDSMGWRIALNMAGFALWLATAITLLMAAA |
| Ga0335070_103451072 | 3300032829 | Soil | MDAKYNYIIDSMRWRIVLNLAGFGLWLATSVVLLRLT |
| Ga0335084_105499272 | 3300033004 | Soil | MVMDAKYNHIIDSISWRIGLNLAGFTLWLVTAAVLLRLAA |
| Ga0335084_110133742 | 3300033004 | Soil | MDAKYNHIIDSMSWRIALNLIGFALWLATAITLLGVAA |
| Ga0335084_112556322 | 3300033004 | Soil | MDAKYNYIIDSMTWRIALNLAGFSLWLAASYALLRLAA |
| Ga0335084_121496212 | 3300033004 | Soil | TVMDAKYNHIIDSMGWRIALNMAGFALWLATAITLLMAAA |
| Ga0335077_103638892 | 3300033158 | Soil | MDAKYNYIIDSMKWRIVLNLSGFALWLAASVALLRLTF |
| Ga0326726_111683122 | 3300033433 | Peat Soil | MDAKYNYIIDSMKWRIVLNLTGFAVWLAASVILLRLAS |
| Ga0316628_1019513751 | 3300033513 | Soil | MGAKYNYIIDSVTWRIGLNLAGFALWLAAVAGLLAAVQL |
| Ga0314865_119801_326_445 | 3300033806 | Peatland | MDARYNQFIDSFKWRIMLNLAGFSLWLGLSFALLAAGAH |
| ⦗Top⦘ |