


| Basic Information | |
|---|---|
| Family ID | F014904 |
| Family Type | Metagenome |
| Number of Sequences | 259 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLD |
| Number of Associated Samples | 178 |
| Number of Associated Scaffolds | 259 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 12.50 % |
| % of genes near scaffold ends (potentially truncated) | 6.18 % |
| % of genes from short scaffolds (< 2000 bps) | 1.54 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (94.208 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (35.907 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.100 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.961 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 259 Family Scaffolds |
|---|---|---|
| PF16778 | Phage_tail_APC | 0.39 |
| PF03102 | NeuB | 0.39 |
| COG ID | Name | Functional Category | % Frequency in 259 Family Scaffolds |
|---|---|---|---|
| COG2089 | Sialic acid synthase SpsE, contains C-terminal SAF domain | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 94.21 % |
| All Organisms | root | All Organisms | 5.41 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10039870 | Not Available | 1976 | Open in IMG/M |
| 3300001748|JGI11772J19994_1002853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 3482 | Open in IMG/M |
| 3300006738|Ga0098035_1010620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 3781 | Open in IMG/M |
| 3300006750|Ga0098058_1005595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 3842 | Open in IMG/M |
| 3300006802|Ga0070749_10008989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 6492 | Open in IMG/M |
| 3300006928|Ga0098041_1218876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 609 | Open in IMG/M |
| 3300009425|Ga0114997_10016049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 5180 | Open in IMG/M |
| 3300017713|Ga0181391_1088451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 704 | Open in IMG/M |
| 3300022183|Ga0196891_1000969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 6399 | Open in IMG/M |
| 3300025072|Ga0208920_1002668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 4369 | Open in IMG/M |
| 3300025109|Ga0208553_1114699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 615 | Open in IMG/M |
| 3300025276|Ga0208814_1006830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4323 | Open in IMG/M |
| 3300025276|Ga0208814_1007893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 3968 | Open in IMG/M |
| 3300027779|Ga0209709_10020012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 4414 | Open in IMG/M |
| 3300031519|Ga0307488_10019083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 5540 | Open in IMG/M |
| 3300034375|Ga0348336_014791 | unclassified Hyphomonas → Hyphomonas sp. | 4380 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 35.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.01% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.74% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.34% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.32% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.93% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.93% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.54% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.54% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.16% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.77% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.77% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.77% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.77% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.39% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.39% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.39% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.39% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.39% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.39% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.39% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.39% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.39% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.39% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.39% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300001740 | Marine viral communities from the Deep Pacific Ocean - MSP-114 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031647 | Marine microbial communities from water near the shore, Antarctic Ocean - #179 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031694 | Marine microbial communities from water near the shore, Antarctic Ocean - #231 | Environmental | Open in IMG/M |
| 3300031811 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8 | Environmental | Open in IMG/M |
| 3300031848 | Marine microbial communities from water near the shore, Antarctic Ocean - #3 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100176381 | 3300000115 | Marine | MATQSQKNSQEIIKLQGEIKLVNEKITTIKDXXLAH |
| DelMOSum2011_100221934 | 3300000115 | Marine | MPTQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLA |
| DelMOSum2011_100398701 | 3300000115 | Marine | MPTQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAH |
| DelMOSpr2010_102549641 | 3300000116 | Marine | MKTQSQKNSEEIIKLQGEIQLLDQKIVNIRDNHLAHIDAKINTIYKLLWFVLTI |
| DelMOWin2010_100090098 | 3300000117 | Marine | MTTQSQKNQQDIIKLQGETKLIHQKIDTIKDNHLAHLDIKV |
| JGI24003J15210_100236591 | 3300001460 | Marine | MATQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDIK |
| JGI24004J15324_100247862 | 3300001472 | Marine | MTTQSQRNSQDIIKLQGETKLIHQKIDTIKDNHLA |
| JGI24004J15324_101069782 | 3300001472 | Marine | MTTQSQKNSQXIIKLQGETKLIHQKIDTIKDNHLAHLDIKVNNIYK |
| JGI24005J15628_100064376 | 3300001589 | Marine | MTTQSQKNQQDIIKLQGETKLIHQKIDTIKDNHLAHLDIEVK |
| JGI24005J15628_100144093 | 3300001589 | Marine | MATQSLKNSQDIIKLQGETKLIHQKIDTIRDNHLHHLDMKI |
| JGI24005J15628_100405882 | 3300001589 | Marine | MATQSQKNSIDIIKLQGEMKLINSKLETITNNHLHHLDLE |
| JGI24523J20078_10312251 | 3300001718 | Marine | MTTQSQKNSQEIIKLQGEIKLVHEKINTIKDNHLAHLDIKV |
| JGI24656J20076_10264461 | 3300001740 | Deep Ocean | MPTQSQKNAQEIIKLQGEVRLVNQKMDTLINNHLAHLDTRINNINK |
| JGI11772J19994_10028533 | 3300001748 | Saline Water And Sediment | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHIDAKINTIYKLLWFV |
| JGI11772J19994_10162661 | 3300001748 | Saline Water And Sediment | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHIDAKINTI |
| KVRMV2_1001528333 | 3300002231 | Marine Sediment | MATQSQKNSEQIIKLQGEMKLIHNKISVIKDNHLAH |
| Ga0074647_10053403 | 3300005611 | Saline Water And Sediment | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLA |
| Ga0076924_12248943 | 3300005747 | Marine | MPTQSQKNTEQIIKLQGEIKLIHNKISVIKDNHLA |
| Ga0076924_12406611 | 3300005747 | Marine | MPNQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLA |
| Ga0075441_100543482 | 3300006164 | Marine | MASQSVKNSQDIIKLQGEIKLINNKLDTITHNHLHHLD |
| Ga0075446_100370411 | 3300006190 | Marine | MASQSLKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDIK |
| Ga0075448_100962062 | 3300006352 | Marine | MVNQSLKNSQDIIKLQGETKLIHQKIDTIRDNHLHHLD |
| Ga0098038_10192951 | 3300006735 | Marine | MKK*ITKMATQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAH |
| Ga0098038_10227781 | 3300006735 | Marine | MPTQSQKNSQDIIKLQGELKLVHQKIDTIKNNHLA |
| Ga0098038_11791802 | 3300006735 | Marine | MATQSQKNANEIIKLQGEIKLIHNKISTIKDNHLVHLEKKVDNVY |
| Ga0098038_12075962 | 3300006735 | Marine | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDIKVNNI |
| Ga0098033_10092391 | 3300006736 | Marine | MPTQSQKNTQEIIKLQGEVRLVNQKIDTLINNHLTHLETRI |
| Ga0098033_10999451 | 3300006736 | Marine | MPTQSQKNAQEIIKLQGEVRLVNQKMDTLINNHLAHLDTRINNI |
| Ga0098033_11154242 | 3300006736 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLER |
| Ga0098037_10278921 | 3300006737 | Marine | MKK*ITKMATQSQKNSEQIIKLQGEIKLIHNKISVIKDNHL |
| Ga0098035_10106201 | 3300006738 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLEKKM |
| Ga0098042_10212182 | 3300006749 | Marine | MPNQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAHLDIK |
| Ga0098058_10048151 | 3300006750 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLEKKVDNV |
| Ga0098058_10055951 | 3300006750 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLEKKV |
| Ga0098040_10103013 | 3300006751 | Marine | MLTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLA |
| Ga0098048_10073975 | 3300006752 | Marine | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDIKVNN |
| Ga0098048_11598511 | 3300006752 | Marine | MATTQSQKNSLDIIKLQGETKLIHQKIDTIKDNHLAHLDIKV |
| Ga0098039_10074024 | 3300006753 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLA |
| Ga0098039_11597622 | 3300006753 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLERKV |
| Ga0098055_11390501 | 3300006793 | Marine | MATTQSQKNSLDIIKLQGETKLIHQKIDTIKDNHLAHLDIKVSNI |
| Ga0098055_13124201 | 3300006793 | Marine | MATTQSQKNSLDIIKLQGETKLIHQKIDTIKDNHLAHLDIKVSN |
| Ga0070749_100089899 | 3300006802 | Aqueous | MTTQSQKNQQDIIKLQGETKLIHQKIDTIKDNHLAHLDI |
| Ga0070749_100335573 | 3300006802 | Aqueous | MPNQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAHLDIKV |
| Ga0070749_102125241 | 3300006802 | Aqueous | MKSQSQKNSEDIIKLQGELKLVHQKIDTIKDNHLAHLDI |
| Ga0075467_102580572 | 3300006803 | Aqueous | MPTQSQKNSQDIIKLQGELKLIHQKIDTIKNNHLAHM |
| Ga0070754_104093712 | 3300006810 | Aqueous | MTTQSQKNQQDIIKLQGETKLIHQKIDTIKDNHLAHLD |
| Ga0075476_102826082 | 3300006867 | Aqueous | MKSQSQKNSEDIIKLQGELKLVHQKIDTIKDNHLAHLDIK |
| Ga0075477_100803001 | 3300006869 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIINIRDNHLAHIDQKINT |
| Ga0070750_100144824 | 3300006916 | Aqueous | MPTQSQKNSQDIIKLQGELKLVHQKIDTIKDNHLAHMDE |
| Ga0070746_102492292 | 3300006919 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIINIRDNHLAHIDQKINTI |
| Ga0070746_102603542 | 3300006919 | Aqueous | MPTQSQKNSQDIIKLQGELKLIHQKIDTIKNNHLAHMD |
| Ga0070746_103245141 | 3300006919 | Aqueous | MRTQSQKNSEEIIKLQGEVKLIHTKIMVIKDNHLAHIDKK |
| Ga0098060_10856901 | 3300006921 | Marine | MPNQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAHLDIKVDNVY |
| Ga0098057_10464641 | 3300006926 | Marine | MPTQSQKNAQEIIKLQGEVRLVNQKMDTLINNHLAHLD |
| Ga0098041_12188761 | 3300006928 | Marine | MATQSQKNSQDIIKLQGETKLIHQKIDTIKNNHLAH |
| Ga0075444_100154561 | 3300006947 | Marine | MASQSLKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDTKV |
| Ga0075444_101389202 | 3300006947 | Marine | MASQSLKNSQDIIKLQGETKLIHQKIDTIKDNHLAH |
| Ga0075444_101606862 | 3300006947 | Marine | MTNQSQKNSQDIIKLQGELRLIHEKINTIKDNHLAHLD |
| Ga0098046_10109201 | 3300006990 | Marine | MPNQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAH |
| Ga0098046_11253491 | 3300006990 | Marine | MATQSQKNSEQIIKLQGEIKLIHNKISTIKDNHLAH |
| Ga0070747_10266872 | 3300007276 | Aqueous | MTTQSQKNSLDIIKLQGETKLIHQKIDTIKDNHLAHLD |
| Ga0070752_10339921 | 3300007345 | Aqueous | MKSQSQKNSEDIIKLQGELKLVHQKIDTIKDNHLAHL |
| Ga0070752_10378012 | 3300007345 | Aqueous | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDIKVNNIY |
| Ga0105020_11668462 | 3300007514 | Marine | MPTQSQKNSLDIIKLQGEVKLINQKIDTITHNHLAH |
| Ga0099851_10648352 | 3300007538 | Aqueous | MKTQSQKNSEEIIKLQGEIQLLDQKIVNIRDNHLAHIDAKINTIYKLLWFVLTISVS |
| Ga0099849_10157551 | 3300007539 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLSHIDAKI |
| Ga0099847_11214282 | 3300007540 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHIDAKINTVYKLLWFVLTISV |
| Ga0114998_100250563 | 3300009422 | Marine | MTKSQSQKNSEDIIKIQGELNLVHQKIDTIKDNHLAHIDQKVN |
| Ga0114998_101115871 | 3300009422 | Marine | MPTQSQKNSFDIIKLQGEMKLINQKLETITNNHLHHLDLEIKNIK |
| Ga0114997_100160491 | 3300009425 | Marine | MATQSLKNSQDIIKLQGETKLIHQKIDTIRDNHLHHLDIKI |
| Ga0114997_102145561 | 3300009425 | Marine | MATQSQKNLFDIIKLQGEMKLINQKLETITHNHLHHLDLEIKN |
| Ga0114997_102375922 | 3300009425 | Marine | MASQSLKNSQDIIKLQGETKLIHQKIDTIRDNHLHHLDIK |
| Ga0127390_10768091 | 3300009474 | Meromictic Pond | MKTQSQKNSEEIIKLQGEIQLIDQKIINIRDNHLAHIDQKINTIYKLL |
| Ga0115564_105243742 | 3300009505 | Pelagic Marine | MATQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAHLDAK |
| Ga0115000_100278171 | 3300009705 | Marine | MATQSLKNSQDIIKLQGETKLIHQKIDTIRDNHLHHLDIKIDVV |
| Ga0115000_106619832 | 3300009705 | Marine | MPTQSQKNSLDIIKLQGEMKLINQKLETITHNHLH |
| Ga0115012_104811032 | 3300009790 | Marine | MKTQSQKNSEEIIKLQGEVKLIHNKINTIKDNHLTHID |
| Ga0115012_118763702 | 3300009790 | Marine | MPTQSQKNSEEIIKLQGEVKLIHQKLTTIKDNHLAHLEK |
| Ga0098056_13131051 | 3300010150 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLERKVDNV |
| Ga0098061_10198331 | 3300010151 | Marine | MLTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAH |
| Ga0098059_10456472 | 3300010153 | Marine | MPTQTQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLE |
| Ga0098059_11844652 | 3300010153 | Marine | MLTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLEKKMD |
| Ga0098059_13776742 | 3300010153 | Marine | MPTQSQKNSEEIIKLQGEVKLIHQKLTTIKDNHLAHLERK |
| Ga0098047_100113833 | 3300010155 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLERKM |
| Ga0129351_10169924 | 3300010300 | Freshwater To Marine Saline Gradient | MPTQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAHLDAKVQ |
| Ga0129351_12114362 | 3300010300 | Freshwater To Marine Saline Gradient | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHIDAK |
| Ga0133547_103309623 | 3300010883 | Marine | MTSQSQKNSQDIIKLQGELRLIHEKINTIKDNHLAHLDIKV |
| Ga0133547_103688723 | 3300010883 | Marine | MTKSQSQKNSEEIIKIQGELNLVHQKIDTIRDNHLSHI |
| Ga0133547_104086833 | 3300010883 | Marine | MTNQSQKNSQDIIKLQGELRLIHEKINTIKDNHLAHL |
| Ga0133547_106462151 | 3300010883 | Marine | MTSQSQKNSQDIIKLQGELRLIHEKINTIKDNHLAHLD |
| Ga0133547_120257601 | 3300010883 | Marine | MTSQSQKNSQDIIKLQGELRLIHEKINTIKDNHLAHLDIKVNH |
| Ga0114934_102008142 | 3300011013 | Deep Subsurface | MATQSQKNSEEIIKLQGEVKLIHQKLTTIKDNHLAHLE |
| Ga0151669_1182492 | 3300011128 | Marine | MTTQSQKNSQDIIKLQDETKLIHQKIDTIKDNHLDHLDIKVN |
| Ga0151674_11171771 | 3300011252 | Marine | MTTQSQKNQQDIIKLQGETKLIHQKIDTIKDNHLAH |
| Ga0151675_10929051 | 3300011254 | Marine | MATQSQKNSIDIIKLQGETRLINQKLETITNNHLHHLDL |
| Ga0160423_103350312 | 3300012920 | Surface Seawater | MPTQSQKNSQDIIKLQGELKLVHQKIDTIKNNHLKHMDD |
| Ga0163179_101243742 | 3300012953 | Seawater | MPTQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAHLDAKVQTIINFYG* |
| Ga0181369_10133552 | 3300017708 | Marine | MATQSQKNSEQIINLQGEIKLVHNKISVITDNHLTHLDTKVDNVY |
| Ga0181403_10247492 | 3300017710 | Seawater | MATQSQKNSIDIIKLQGETRLINQKLETITNNHLHHLDLEIK |
| Ga0181391_10082763 | 3300017713 | Seawater | MTTQSQKNQQDIIKLQGETKLIHQKIDTITNNHLHHLDLEIKN |
| Ga0181391_10884512 | 3300017713 | Seawater | MTTQSQKNQQDIIKLQGETKLIHQKIDTITNNHLHHLDL |
| Ga0181412_10684032 | 3300017714 | Seawater | MATQSQKNSIDIIKLQGETKLINQKLETITNNHLHHLD |
| Ga0181390_10227652 | 3300017719 | Seawater | MTTQSQKNQQDIIKLQGETKLIHQKIDTITNNHLHHLDLEI |
| Ga0181390_11263912 | 3300017719 | Seawater | MATQSQKNSIDIIKLQGEMKLINAKLETITNNHLHHLDLEI |
| Ga0181383_10052774 | 3300017720 | Seawater | MATQSQKNSIDIIKLQGETRLINQKLETITNNHLHHLDLE |
| Ga0181398_11493282 | 3300017725 | Seawater | MTTQSQKNSQDIIKLQGETKLIHQKIDTITNNHLHHLDLEIKN |
| Ga0181401_11381572 | 3300017727 | Seawater | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDTKV |
| Ga0181417_10395952 | 3300017730 | Seawater | MTTQSQKNQQDIIKLQGETKLIHQKIDTITNNHLHHLDLEIKNIK |
| Ga0181415_11061692 | 3300017732 | Seawater | MTTQSQKNQQDIIKLQGETKLIHQKIDTITNNHLHHMDLEIKN |
| Ga0181433_10410841 | 3300017739 | Seawater | MTTQSQKNSLDIIKLQGETKLIHQKIDTIKDNHLAH |
| Ga0181421_11518141 | 3300017741 | Seawater | MATQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAH |
| Ga0181402_11393612 | 3300017743 | Seawater | MKNKMKSQSQKNSEDIIKLQGQLQLLDVKITTIKDNHLTHIDAKVNSIY |
| Ga0181427_10240161 | 3300017745 | Seawater | MKNKMKSQSQKNSEDIIKLQGQLQLLDVKITTIKDNHLTHID |
| Ga0187219_10033861 | 3300017751 | Seawater | MPNQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAHLDIKVDN |
| Ga0181407_10083733 | 3300017753 | Seawater | MATQSQKNSIDIIKLQGETRLINQKLETITNNHLHHLELEIKNIK |
| Ga0181382_10221712 | 3300017756 | Seawater | MATQSQKNSIDIIKLQGETKLINQKLETITNNHLHHL |
| Ga0181420_11890011 | 3300017757 | Seawater | MATQSQKNTEQIIKLQGEIKLIHSKISTIKDNHLAHL |
| Ga0181409_10469322 | 3300017758 | Seawater | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHL |
| Ga0181408_10028475 | 3300017760 | Seawater | MATQSQKNSLDIIKLQGETKLIHQKIDTIKNNHLAHL |
| Ga0181385_11820462 | 3300017764 | Seawater | MPTQSQKNSQDIIKLQGELKLVHQKIDTIKNNHLAHMDE |
| Ga0181413_12626172 | 3300017765 | Seawater | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDTK |
| Ga0181406_10105562 | 3300017767 | Seawater | MTTQSQKNSQDIIKLQGETKLIHQKIDTITNNHLYHLDLEIKN |
| Ga0181406_11504811 | 3300017767 | Seawater | MATQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLE |
| Ga0187217_10126231 | 3300017770 | Seawater | MTTQSQKNQQDIIKLQGETKLIHQKIDTITNNHLHHLDLEIKNI |
| Ga0181425_11161912 | 3300017771 | Seawater | MATQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDIKVN |
| Ga0181430_10482021 | 3300017772 | Seawater | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDTKVNN |
| Ga0181395_11914802 | 3300017779 | Seawater | MTTQSQKNKQDIIKLQGETKLIHQKIDTITNNHLHHLDLE |
| Ga0181423_13373322 | 3300017781 | Seawater | MTTQSKKNSQDIIKIQGEIKLIDQKIDTITHNHLHHLDL |
| Ga0181380_10303322 | 3300017782 | Seawater | MATQSQKNSIDIIKLQGETRLINQKLETITNNHLHH |
| Ga0181424_100418672 | 3300017786 | Seawater | MPTQSQKNSQDIIKLQGELKLVHEKIDTIKNNHLAHMDEKIN |
| Ga0181424_102979191 | 3300017786 | Seawater | MATQSQKNSIDIIKLQGETKLINQKLETITNNHLHH |
| Ga0181563_100456773 | 3300018420 | Salt Marsh | MATQSQKNSIDIIKLQGEMKLINAKLETITHNHLHHL |
| Ga0181555_11199942 | 3300020051 | Salt Marsh | MATQSQKNSIDIIKLQGEMKLINAKLETITHNHLHHLDLEIKNI |
| Ga0181604_101119481 | 3300020191 | Salt Marsh | MATQSQKNSIDIIKLQGEMKLINAKLETITHNHLHHLDLEIK |
| Ga0181597_102029082 | 3300020194 | Salt Marsh | MATQSQKNSIDIIKLQGEMKLINAKLETITHNHLHHLDLEIKN |
| Ga0211683_100079321 | 3300020372 | Marine | MASQSVKNSQDIIKLQGEIKLINNKLDTITHNHLHHLDLEIK |
| Ga0211659_100554141 | 3300020404 | Marine | MPTQSQKNSQDIIKLQGELKLVHQKIDTIKNNHLAH |
| Ga0211523_102136841 | 3300020414 | Marine | MATQSQKNSQDIIKIQGEIKLIHNKIDTIKDNHLQ |
| Ga0211521_103877801 | 3300020428 | Marine | MATQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAHLD |
| Ga0211558_104142021 | 3300020439 | Marine | MATQSQKNSQDIIKLQGEIKLIHNKIDTIKDNHLQHIDYKIN |
| Ga0211643_101916111 | 3300020457 | Marine | MPTQSQKNSQDIIKLQGELKLVHQKIDTIKNNHLKHMDDKIS |
| Ga0211486_103270612 | 3300020460 | Marine | MKTQSQRNSEEIIKLQGEVKLIHEKITTIKDNHLAH |
| Ga0222716_104600301 | 3300021959 | Estuarine Water | MKTQSQKNSEEIIKLQGEIQLIDQKIINIRDNHLAHIDQ |
| Ga0222716_107163842 | 3300021959 | Estuarine Water | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHIDAKINTIY |
| Ga0212021_10129812 | 3300022068 | Aqueous | MPNQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAHL |
| Ga0212021_10487221 | 3300022068 | Aqueous | MATQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAHLDA |
| Ga0196887_11181221 | 3300022178 | Aqueous | MPTQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAHLDAKV |
| Ga0196891_10009691 | 3300022183 | Aqueous | MTTQSQKNQQDIIKLQGETKLIHQKIDTIKDNHLAHLDIKVNN |
| Ga0196891_10250992 | 3300022183 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIINIRDNHLAHIDQK |
| Ga0196899_10773112 | 3300022187 | Aqueous | MKTQSQKISEEIIKLQGEIQLIDQKIMNIRDNHLAHIDQKINTIYKLLW |
| Ga0196905_10161261 | 3300022198 | Aqueous | MKSQSQKNSEDIIKLQGELKLIHQKIDTIKDNHLAHLD |
| Ga0196905_11038322 | 3300022198 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHI |
| Ga0196901_10266872 | 3300022200 | Aqueous | MKSQSQKNSEDIIKLQGELKLIHQKIDTIKDNHLAH |
| Ga0196901_10351271 | 3300022200 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLSHIDAKINTIYK |
| Ga0187833_100235164 | 3300022225 | Seawater | MPTQSQKNAQEIIKLQGEVRLVNQKMDTLINNHLAHLDTRIN |
| Ga0187833_100348201 | 3300022225 | Seawater | MPTQSQKNAQEIIKLQGEVRLVNQKMDTLINNHLAHL |
| Ga0187827_101279761 | 3300022227 | Seawater | MPTQSQKNAQEIIKLQGEVRLVNQKIDTLINNHLTHLETRINNINKILWL |
| Ga0187827_106197382 | 3300022227 | Seawater | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLERKVDNVYK |
| Ga0255758_1000926112 | 3300022928 | Salt Marsh | MATQSQKNSIDIIKLQGEMKLINAKLETITHNHLHHLDLEI |
| (restricted) Ga0233444_100053921 | 3300024264 | Seawater | MPTQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAHLDAK |
| Ga0207905_10340192 | 3300025048 | Marine | MATQSLKNSQDIIKLQGETKLIHQKIDTIRDNHLHHLDM |
| Ga0208920_10026681 | 3300025072 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLEKKVDNVY |
| Ga0208920_10580821 | 3300025072 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLEKKMDN |
| Ga0208668_10047231 | 3300025078 | Marine | MPTQSQKNAQEIIKLQGEVRLVNQKMDTLINNHLAHLDTRINNIN |
| Ga0208156_10048871 | 3300025082 | Marine | MPTQSQKNAQEIIKLQGEVRLVNQKMDTLINNHLAHLDTR |
| Ga0208156_10524301 | 3300025082 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLERKMD |
| Ga0208157_11395292 | 3300025086 | Marine | MATQSQKNSQDIIKVQGEIKLINQKIDTITHNHLHHLDLE |
| Ga0208011_10089963 | 3300025096 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLEK |
| Ga0208010_10431472 | 3300025097 | Marine | MPTQSQKNAQEIIKLQGEVRLVNQKMDTLINNHLAH |
| Ga0208434_10056364 | 3300025098 | Marine | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDIKV |
| Ga0208666_10063044 | 3300025102 | Marine | MPTQSQKNSQDIIKLQGELKLVHQKIDTIKNNHLAHMDEK |
| Ga0208666_10178611 | 3300025102 | Marine | MATQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAHL |
| Ga0208666_10381721 | 3300025102 | Marine | MATQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLSH |
| Ga0208793_11511691 | 3300025108 | Marine | MATQSQKNSIDIIKLQGEMKLINAKLETITHNHLHH |
| Ga0208553_11052011 | 3300025109 | Marine | MPTQSQKNAQEIIKLQGEVRLVNQKMDTLINNHLAHLDT |
| Ga0208553_11146991 | 3300025109 | Marine | MPTQSQKNAQEIIKLQGEVRLVNQKMDTLINNHLAHLDTRI |
| Ga0208553_11165101 | 3300025109 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLE |
| Ga0208433_10069551 | 3300025114 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLEKK |
| Ga0208790_10084833 | 3300025118 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAHLEKKVD |
| Ga0209535_10137044 | 3300025120 | Marine | MTTQSQKNSQEIIKLQGEIKLVHEKINTIKDNHLAHLDIKVN |
| Ga0209535_11076462 | 3300025120 | Marine | MATQSQKNSIDIIKLQGEMKLINAKLETITHNHLHHLD |
| Ga0209535_11170492 | 3300025120 | Marine | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDIKVN |
| Ga0208919_10879111 | 3300025128 | Marine | MPSQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAHLDI |
| Ga0208299_10190772 | 3300025133 | Marine | MPTQSQRNAQEIIKLQGEIKLIHQKLTSIKDNHLA |
| Ga0208299_11437921 | 3300025133 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLAH |
| Ga0209336_100060801 | 3300025137 | Marine | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDT |
| Ga0209336_100229951 | 3300025137 | Marine | MATQSQKNSIDIIKLQGETKLINQKLETITNNHLHHLDLEI |
| Ga0209336_100579761 | 3300025137 | Marine | MVSQSQKNSEDIIKIQGELNLVHQKIDTIKNNHLAHI |
| Ga0209634_10183121 | 3300025138 | Marine | MATQSQKNSFDIIKLQGEMKLINQKLETITHNHLHHLDLEI |
| Ga0209634_10190071 | 3300025138 | Marine | MATQSQKNSIDIIKLQGEMKLINSKLETITNNHLHHLDLEIKN |
| Ga0209634_11115302 | 3300025138 | Marine | MATQSQKNSLDIIKLQGETKLIHQKIDTIKNNHLAH |
| Ga0209645_10125561 | 3300025151 | Marine | MATQSQKNANEIIKLQGEIKLIHNKISTIKDNHLVHLEK |
| Ga0209645_10284352 | 3300025151 | Marine | MKKXITKMATQSQKNANEIIKLQGEIKLIHNKISTIKDNHLVHLEK |
| Ga0209337_11201812 | 3300025168 | Marine | MTKSQSQKNSEDIIKIQGELNLVHQKIDTIKDNHLAHIDAKVNQIY |
| Ga0208032_10325312 | 3300025266 | Deep Ocean | MASQSLKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDTK |
| Ga0208032_10984072 | 3300025266 | Deep Ocean | MASQSLKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDI |
| Ga0208814_10068304 | 3300025276 | Deep Ocean | MASQSLKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDIKVN |
| Ga0208814_10078931 | 3300025276 | Deep Ocean | MASQSLKNSQDIIKLQGETKLIHQKIDTIKDNHLAHL |
| Ga0208814_10098522 | 3300025276 | Deep Ocean | MASQSLKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDTKVN |
| Ga0208814_10442991 | 3300025276 | Deep Ocean | MASQSVKNSQDIIKLQGEIKLINNKLDTITHNHLH |
| Ga0208148_10094541 | 3300025508 | Aqueous | MPTQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAHLDAKVQT |
| Ga0208303_10062782 | 3300025543 | Aqueous | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDI |
| Ga0208303_10081793 | 3300025543 | Aqueous | MATQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAH |
| Ga0208303_10097414 | 3300025543 | Aqueous | MPTQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAHL |
| Ga0208643_10378251 | 3300025645 | Aqueous | MTTQSQKNQQDIIKLQGETKLIHQKIDTIKDNHLAHLDIKVN |
| Ga0208161_10198061 | 3300025646 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLSH |
| Ga0208161_10251382 | 3300025646 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIINIRDNHLAHIDQKI |
| Ga0208160_10111961 | 3300025647 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLSHIDAK |
| Ga0208160_10525421 | 3300025647 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHIDAKI |
| Ga0208134_11208181 | 3300025652 | Aqueous | MTTQSQKNQQDIIKLQGETKLIHQKIDTIKDNHLA |
| Ga0208795_10070434 | 3300025655 | Aqueous | MKTQSQKNSEEIIKLQGEIQLLDQKIVNIRDNHLAHIDAKINTIYKL |
| Ga0208898_10207221 | 3300025671 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIMNIRDNHLAHIDQKIN |
| Ga0208898_11648481 | 3300025671 | Aqueous | MKSQSQKNSEDIIKLQGELKLVHQKIDTIKDNHLAH |
| Ga0208019_10232031 | 3300025687 | Aqueous | MKSQSQKNSEDIIKLQGELKLIHQKIDTIKDNHLAHLDI |
| Ga0208899_10149083 | 3300025759 | Aqueous | MPTQSQKNSQDIIKLQGELKLVHQKIDTIKDNHLAHMDEK |
| Ga0208899_10163843 | 3300025759 | Aqueous | MKSQSQKNSEDIIKLQGELKLVHQKIDTIKDNHLAHLD |
| Ga0208899_11474132 | 3300025759 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIMNIRDNHLAHIDQKINTIY |
| Ga0208767_10135496 | 3300025769 | Aqueous | MATQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLA |
| Ga0208767_11306381 | 3300025769 | Aqueous | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLD |
| Ga0208767_11651122 | 3300025769 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIINIRDNHLAH |
| Ga0208785_10259831 | 3300025815 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIMNIRDNHLAHIDQKINTIYKLLWF |
| Ga0208542_10128693 | 3300025818 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIINIRDNHLAHIDQKIN |
| Ga0208547_10454661 | 3300025828 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIMNIRDNHLAHIDQ |
| Ga0208917_10256251 | 3300025840 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIMNIRDNHLAHIDQKINTI |
| Ga0208645_10272721 | 3300025853 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIMNIRDNHLA |
| Ga0208645_10288851 | 3300025853 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIMNIRDNHLAHIDQK |
| Ga0208644_10633801 | 3300025889 | Aqueous | MATQSQKNSQEIIKLQGEIKLVNEKITTIKDNHLAHLD |
| Ga0209482_10102041 | 3300027668 | Marine | MASQSLKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLD |
| Ga0209482_12191772 | 3300027668 | Marine | MASQSVKNSQDIIKLQGEIKLINNKLDTITHNHLHHL |
| Ga0209383_10294951 | 3300027672 | Marine | MASQSVKNSQDIIKLQGEIKLINNKLDTITHNHLHH |
| Ga0209710_11933372 | 3300027687 | Marine | MPTQSQKNSFDIIKLQGEMKLINQKLETITNNHLHH |
| Ga0209816_10962621 | 3300027704 | Marine | MASQSVKNSQDIIKLQGEIKLINNKLDTITHNHLHHLDLE |
| Ga0209709_100200121 | 3300027779 | Marine | MATQSLKNSQDIIKLQGETKLIHQKIDTIRDNHLHHLDIKID |
| Ga0209709_100572251 | 3300027779 | Marine | MPTQSQKNSFDIIKLQGEMKLINQKLETITNNHLHHLDLEI |
| Ga0209502_102012302 | 3300027780 | Marine | MPTQSQKNSFDIIKLQGEMKLINQKLETITNNHLHHLDLEIK |
| Ga0209830_101279401 | 3300027791 | Marine | MTKSQSQKNSEDIIKIQGELNLVHQKIDTIKDNHLAHIDQKVNQI |
| Ga0209091_103594362 | 3300027801 | Marine | MPTQSQKNSLDIIKLQGEMKLINQKLETITHNHLHHLDLEIKN |
| Ga0209090_102550972 | 3300027813 | Marine | MTSQSQKNSQDIIKLQGELRLIHEKINTIKDNHLAHLDI |
| Ga0183683_10057863 | 3300029309 | Marine | MPTQSQKNSQDIIKLQGELKLVHQKIDTIKNNHLK |
| Ga0183755_10103081 | 3300029448 | Marine | MATQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDT |
| Ga0307488_100190837 | 3300031519 | Sackhole Brine | MATQSLKNSQDIIKLQGETKLIHQKIDTIRDNHLHHLD |
| Ga0307488_100838091 | 3300031519 | Sackhole Brine | MTSQSQKNSQDIIKLQGELRLIHEKINTIKDNHLAHLDIK |
| Ga0307489_100939552 | 3300031569 | Sackhole Brine | MTSQSQKNSQDIIKLQGELRLIHEKINTIKDNHLAH |
| Ga0307376_102618222 | 3300031578 | Soil | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHIDQKINTIYK |
| Ga0308012_100824542 | 3300031647 | Marine | MTSQSVKNSQDIIKLQGEIKLINNKLDTITHNHLHHLDLEI |
| Ga0307986_100346581 | 3300031659 | Marine | MTSQSQKNSQDIIKLQGELRLIHEKINTIKDNHLA |
| Ga0307375_100524674 | 3300031669 | Soil | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHID |
| Ga0307375_106675412 | 3300031669 | Soil | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHIDAKIN |
| Ga0307377_100784791 | 3300031673 | Soil | MKTQSQKNSEEIIKLQGEIQLIDQKIVNIRDNHLAHIDQK |
| Ga0308015_100154441 | 3300031694 | Marine | MTSQSVKNSQDIIKLQGEIKLINNKLDTITHNHLHHLDLEIK |
| Ga0310125_103273211 | 3300031811 | Marine | MPTQSQKNAQEIIKLQGEIKLIHQKLTSIKDNHLTHLEKKVDN |
| Ga0308000_100106751 | 3300031848 | Marine | MTSQSVKNSQDIIKLQGEIKLINNKLDTITHNHLHHLDL |
| Ga0315321_103300821 | 3300032088 | Seawater | MPNQSQKNSEQIIKLQGEIKLIHNKISVIKDNHLAHLD |
| Ga0316202_102019661 | 3300032277 | Microbial Mat | MTTQSQKNSQDIIKLQGETKLIHQKIDTIKDNHLAHLDIK |
| Ga0314858_000687_1_111 | 3300033742 | Sea-Ice Brine | MTSQSQKNSQDIIKLQGELRLIHEKINTIKDNHLAHL |
| Ga0314858_018760_1390_1497 | 3300033742 | Sea-Ice Brine | MTTQSLKNSQDIIKLQGETKLIHQKIDTIRDNHLHH |
| Ga0348336_014791_4270_4380 | 3300034375 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIMNIRDNHLAHI |
| Ga0348337_019819_3295_3429 | 3300034418 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIINIRDNHLAHIDQKINTIY |
| Ga0348337_024855_2780_2902 | 3300034418 | Aqueous | MKTQSQKNSEEIIKLQGEIQLIDQKIMNIRDNHLAHIDQKI |
| ⦗Top⦘ |