


| Basic Information | |
|---|---|
| Family ID | F014865 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 259 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MVISLTTLLATLSSIFRSRAALELENLALRHQIGVLQRS |
| Number of Associated Samples | 182 |
| Number of Associated Scaffolds | 259 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.02 % |
| % of genes near scaffold ends (potentially truncated) | 91.89 % |
| % of genes from short scaffolds (< 2000 bps) | 83.78 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.625 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.761 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.344 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.668 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 259 Family Scaffolds |
|---|---|---|
| PF02566 | OsmC | 1.16 |
| PF13683 | rve_3 | 1.16 |
| PF12704 | MacB_PCD | 1.16 |
| PF13620 | CarboxypepD_reg | 1.16 |
| PF14690 | zf-ISL3 | 0.77 |
| PF13418 | Kelch_4 | 0.77 |
| PF00578 | AhpC-TSA | 0.77 |
| PF01740 | STAS | 0.77 |
| PF04014 | MazE_antitoxin | 0.77 |
| PF07238 | PilZ | 0.77 |
| PF02368 | Big_2 | 0.77 |
| PF00570 | HRDC | 0.77 |
| PF12697 | Abhydrolase_6 | 0.77 |
| PF14294 | DUF4372 | 0.77 |
| PF07228 | SpoIIE | 0.77 |
| PF02954 | HTH_8 | 0.77 |
| PF02687 | FtsX | 0.77 |
| PF00126 | HTH_1 | 0.77 |
| PF13495 | Phage_int_SAM_4 | 0.77 |
| PF00106 | adh_short | 0.77 |
| PF01609 | DDE_Tnp_1 | 0.77 |
| PF02517 | Rce1-like | 0.77 |
| PF07676 | PD40 | 0.77 |
| PF00069 | Pkinase | 0.77 |
| PF01593 | Amino_oxidase | 0.39 |
| PF13545 | HTH_Crp_2 | 0.39 |
| PF00801 | PKD | 0.39 |
| PF00675 | Peptidase_M16 | 0.39 |
| PF02321 | OEP | 0.39 |
| PF01548 | DEDD_Tnp_IS110 | 0.39 |
| PF13378 | MR_MLE_C | 0.39 |
| PF07617 | DUF1579 | 0.39 |
| PF06441 | EHN | 0.39 |
| PF02065 | Melibiase | 0.39 |
| PF02927 | CelD_N | 0.39 |
| PF07602 | DUF1565 | 0.39 |
| PF02878 | PGM_PMM_I | 0.39 |
| PF00078 | RVT_1 | 0.39 |
| PF04055 | Radical_SAM | 0.39 |
| PF00856 | SET | 0.39 |
| PF01927 | Mut7-C | 0.39 |
| PF12796 | Ank_2 | 0.39 |
| PF01402 | RHH_1 | 0.39 |
| PF00027 | cNMP_binding | 0.39 |
| PF02806 | Alpha-amylase_C | 0.39 |
| PF00313 | CSD | 0.39 |
| PF03707 | MHYT | 0.39 |
| PF14871 | GHL6 | 0.39 |
| PF13505 | OMP_b-brl | 0.39 |
| PF04365 | BrnT_toxin | 0.39 |
| PF13338 | AbiEi_4 | 0.39 |
| PF01738 | DLH | 0.39 |
| PF11154 | DUF2934 | 0.39 |
| PF01566 | Nramp | 0.39 |
| PF00654 | Voltage_CLC | 0.39 |
| PF01381 | HTH_3 | 0.39 |
| PF13181 | TPR_8 | 0.39 |
| PF00753 | Lactamase_B | 0.39 |
| PF13676 | TIR_2 | 0.39 |
| PF07690 | MFS_1 | 0.39 |
| PF04073 | tRNA_edit | 0.39 |
| PF00884 | Sulfatase | 0.39 |
| PF00723 | Glyco_hydro_15 | 0.39 |
| PF00326 | Peptidase_S9 | 0.39 |
| PF03959 | FSH1 | 0.39 |
| PF02604 | PhdYeFM_antitox | 0.39 |
| PF13857 | Ank_5 | 0.39 |
| PF13483 | Lactamase_B_3 | 0.39 |
| PF04879 | Molybdop_Fe4S4 | 0.39 |
| PF06527 | TniQ | 0.39 |
| PF13701 | DDE_Tnp_1_4 | 0.39 |
| PF08818 | DUF1801 | 0.39 |
| PF09722 | Xre_MbcA_ParS_C | 0.39 |
| PF13751 | DDE_Tnp_1_6 | 0.39 |
| PF05973 | Gp49 | 0.39 |
| PF00376 | MerR | 0.39 |
| PF00149 | Metallophos | 0.39 |
| PF00873 | ACR_tran | 0.39 |
| PF03551 | PadR | 0.39 |
| PF02775 | TPP_enzyme_C | 0.39 |
| PF01019 | G_glu_transpept | 0.39 |
| PF04430 | DUF498 | 0.39 |
| PF13602 | ADH_zinc_N_2 | 0.39 |
| COG ID | Name | Functional Category | % Frequency in 259 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.09 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.16 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.16 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.77 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.77 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.77 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.77 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.77 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.77 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.77 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.39 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.39 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.39 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.39 |
| COG0400 | Predicted esterase | General function prediction only [R] | 0.39 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.39 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.39 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.39 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.39 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.39 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.39 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.39 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.39 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.39 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.39 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.39 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.39 |
| COG3300 | MHYT domain, NO-binding membrane sensor | Signal transduction mechanisms [T] | 0.39 |
| COG3345 | Alpha-galactosidase | Carbohydrate transport and metabolism [G] | 0.39 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.39 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.39 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.39 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.39 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.39 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.39 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.39 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.39 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.39 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.39 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.63 % |
| Unclassified | root | N/A | 17.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000793|AF_2010_repII_A001DRAFT_10094345 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300001413|JGI20180J14839_1003734 | Not Available | 1005 | Open in IMG/M |
| 3300001545|JGI12630J15595_10017358 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300001867|JGI12627J18819_10366365 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300002568|C688J35102_120983032 | All Organisms → cellular organisms → Bacteria | 5352 | Open in IMG/M |
| 3300002910|JGI25615J43890_1064643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300003369|JGI24140J50213_10022657 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300004082|Ga0062384_100207328 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300004092|Ga0062389_100179691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2046 | Open in IMG/M |
| 3300004631|Ga0058899_12291499 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005166|Ga0066674_10372644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300005167|Ga0066672_10288716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
| 3300005171|Ga0066677_10070399 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300005175|Ga0066673_10059893 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300005332|Ga0066388_100354071 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
| 3300005332|Ga0066388_104426307 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005332|Ga0066388_107809738 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005363|Ga0008090_15186316 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005451|Ga0066681_10117533 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300005554|Ga0066661_10472441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300005554|Ga0066661_10896421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300005556|Ga0066707_10426873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300005557|Ga0066704_10328339 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300005561|Ga0066699_10050848 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
| 3300005568|Ga0066703_10066723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2052 | Open in IMG/M |
| 3300005569|Ga0066705_10302767 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300005574|Ga0066694_10061658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1718 | Open in IMG/M |
| 3300005602|Ga0070762_10844620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300005764|Ga0066903_100510416 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
| 3300005921|Ga0070766_10159741 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300005921|Ga0070766_10223020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300005921|Ga0070766_10358582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300006031|Ga0066651_10128315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1309 | Open in IMG/M |
| 3300006059|Ga0075017_100401086 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300006059|Ga0075017_100638998 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300006162|Ga0075030_100416268 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300006176|Ga0070765_102182634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300006755|Ga0079222_11232982 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006791|Ga0066653_10179648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300006800|Ga0066660_11401884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300006852|Ga0075433_10057774 | All Organisms → cellular organisms → Bacteria | 3392 | Open in IMG/M |
| 3300006893|Ga0073928_10038366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4476 | Open in IMG/M |
| 3300006893|Ga0073928_10976443 | Not Available | 578 | Open in IMG/M |
| 3300009038|Ga0099829_11306463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300009518|Ga0116128_1002689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7253 | Open in IMG/M |
| 3300009525|Ga0116220_10508019 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010043|Ga0126380_11723504 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010048|Ga0126373_10588916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1164 | Open in IMG/M |
| 3300010048|Ga0126373_11122072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 852 | Open in IMG/M |
| 3300010048|Ga0126373_11266501 | Not Available | 803 | Open in IMG/M |
| 3300010048|Ga0126373_11431035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium pictum | 757 | Open in IMG/M |
| 3300010048|Ga0126373_12749364 | Not Available | 549 | Open in IMG/M |
| 3300010048|Ga0126373_13028664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300010321|Ga0134067_10452790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300010341|Ga0074045_10338933 | Not Available | 981 | Open in IMG/M |
| 3300010358|Ga0126370_11638358 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300010360|Ga0126372_10600545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1056 | Open in IMG/M |
| 3300010361|Ga0126378_12058058 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300010366|Ga0126379_11138021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
| 3300010376|Ga0126381_100005700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13742 | Open in IMG/M |
| 3300010376|Ga0126381_100298998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2203 | Open in IMG/M |
| 3300010376|Ga0126381_101312841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300010376|Ga0126381_103227252 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010376|Ga0126381_104141787 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010379|Ga0136449_104405006 | Not Available | 519 | Open in IMG/M |
| 3300010398|Ga0126383_10038315 | All Organisms → cellular organisms → Bacteria | 3885 | Open in IMG/M |
| 3300010398|Ga0126383_11472436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300011269|Ga0137392_10146613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1901 | Open in IMG/M |
| 3300011270|Ga0137391_10333807 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300012189|Ga0137388_10135731 | All Organisms → cellular organisms → Bacteria | 2161 | Open in IMG/M |
| 3300012189|Ga0137388_11841840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012198|Ga0137364_10999685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300012203|Ga0137399_10116280 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300012203|Ga0137399_10309064 | Not Available | 1307 | Open in IMG/M |
| 3300012203|Ga0137399_11314039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300012203|Ga0137399_11527822 | Not Available | 555 | Open in IMG/M |
| 3300012205|Ga0137362_10331091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1318 | Open in IMG/M |
| 3300012208|Ga0137376_10328408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1328 | Open in IMG/M |
| 3300012211|Ga0137377_10962957 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300012285|Ga0137370_10002049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8614 | Open in IMG/M |
| 3300012357|Ga0137384_10817395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300012362|Ga0137361_11453673 | Not Available | 608 | Open in IMG/M |
| 3300012582|Ga0137358_10101728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1946 | Open in IMG/M |
| 3300012917|Ga0137395_10008953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5363 | Open in IMG/M |
| 3300012917|Ga0137395_10358523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
| 3300012918|Ga0137396_10466842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 936 | Open in IMG/M |
| 3300012923|Ga0137359_10380815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1253 | Open in IMG/M |
| 3300012925|Ga0137419_10723306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300012971|Ga0126369_10017565 | All Organisms → cellular organisms → Bacteria | 5673 | Open in IMG/M |
| 3300012971|Ga0126369_10901359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 970 | Open in IMG/M |
| 3300014158|Ga0181521_10257168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300014162|Ga0181538_10111051 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300014165|Ga0181523_10507380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300014502|Ga0182021_10966246 | Not Available | 1025 | Open in IMG/M |
| 3300015054|Ga0137420_1336812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rhizocola → Rhizocola hellebori | 2284 | Open in IMG/M |
| 3300015372|Ga0132256_100059567 | All Organisms → cellular organisms → Bacteria | 3577 | Open in IMG/M |
| 3300016270|Ga0182036_10157838 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300016270|Ga0182036_10327737 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300016294|Ga0182041_10047434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2883 | Open in IMG/M |
| 3300016294|Ga0182041_10218699 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300016294|Ga0182041_10235469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1481 | Open in IMG/M |
| 3300016294|Ga0182041_10774036 | Not Available | 856 | Open in IMG/M |
| 3300016319|Ga0182033_10031796 | All Organisms → cellular organisms → Bacteria | 3383 | Open in IMG/M |
| 3300016319|Ga0182033_10171379 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300016319|Ga0182033_11080135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300016319|Ga0182033_11418686 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300016319|Ga0182033_12199061 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300016357|Ga0182032_11426533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300016371|Ga0182034_10192626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1570 | Open in IMG/M |
| 3300016371|Ga0182034_10376459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300016371|Ga0182034_12009648 | Not Available | 511 | Open in IMG/M |
| 3300016387|Ga0182040_10204012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
| 3300016387|Ga0182040_10247963 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300016387|Ga0182040_10336667 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300016387|Ga0182040_11273265 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300016404|Ga0182037_10144420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1784 | Open in IMG/M |
| 3300016422|Ga0182039_10918497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300016422|Ga0182039_11265022 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300016422|Ga0182039_11992135 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300016422|Ga0182039_12194820 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300016445|Ga0182038_11235819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300017928|Ga0187806_1213796 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300017932|Ga0187814_10363793 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300017943|Ga0187819_10232468 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300017943|Ga0187819_10349939 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300017955|Ga0187817_10631500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300017975|Ga0187782_10963544 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300018006|Ga0187804_10207485 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300018006|Ga0187804_10366239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300018009|Ga0187884_10084618 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300018024|Ga0187881_10164046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300018062|Ga0187784_10634520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300019888|Ga0193751_1195159 | Not Available | 683 | Open in IMG/M |
| 3300020199|Ga0179592_10005217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5520 | Open in IMG/M |
| 3300020199|Ga0179592_10122311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1194 | Open in IMG/M |
| 3300020580|Ga0210403_10233558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea atacamensis | 1509 | Open in IMG/M |
| 3300021046|Ga0215015_10349676 | Not Available | 733 | Open in IMG/M |
| 3300021168|Ga0210406_10138980 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300021432|Ga0210384_11721016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300021475|Ga0210392_10096828 | Not Available | 1933 | Open in IMG/M |
| 3300021559|Ga0210409_10041738 | All Organisms → cellular organisms → Bacteria | 4352 | Open in IMG/M |
| 3300021560|Ga0126371_10642229 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300021560|Ga0126371_10829790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300021560|Ga0126371_12240309 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300021560|Ga0126371_13818994 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300025496|Ga0208191_1002302 | All Organisms → cellular organisms → Bacteria | 8330 | Open in IMG/M |
| 3300025929|Ga0207664_10606334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300026305|Ga0209688_1057616 | Not Available | 717 | Open in IMG/M |
| 3300026325|Ga0209152_10048592 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300026328|Ga0209802_1309968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → Magnetococcaceae → Magnetococcus → Magnetococcus marinus | 522 | Open in IMG/M |
| 3300026333|Ga0209158_1162833 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300026335|Ga0209804_1281036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300026502|Ga0255350_1048761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
| 3300026529|Ga0209806_1079317 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300026551|Ga0209648_10152596 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300026551|Ga0209648_10270741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1242 | Open in IMG/M |
| 3300026552|Ga0209577_10024423 | All Organisms → cellular organisms → Bacteria | 5309 | Open in IMG/M |
| 3300026557|Ga0179587_10729610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300026890|Ga0207781_1024469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300027326|Ga0209731_1025229 | Not Available | 844 | Open in IMG/M |
| 3300027371|Ga0209418_1065011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300027460|Ga0207506_1013873 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300027548|Ga0209523_1028522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1112 | Open in IMG/M |
| 3300027671|Ga0209588_1023545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1941 | Open in IMG/M |
| 3300027783|Ga0209448_10032903 | Not Available | 1735 | Open in IMG/M |
| 3300027842|Ga0209580_10101408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1392 | Open in IMG/M |
| 3300027874|Ga0209465_10249798 | Not Available | 887 | Open in IMG/M |
| 3300027874|Ga0209465_10453341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300027882|Ga0209590_10230681 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300027911|Ga0209698_10677103 | Not Available | 787 | Open in IMG/M |
| 3300028536|Ga0137415_10141458 | Not Available | 2245 | Open in IMG/M |
| 3300028906|Ga0308309_10729227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300031057|Ga0170834_111204759 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031057|Ga0170834_112488741 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031090|Ga0265760_10178045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 709 | Open in IMG/M |
| 3300031122|Ga0170822_14497619 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031231|Ga0170824_113777220 | Not Available | 544 | Open in IMG/M |
| 3300031231|Ga0170824_114702142 | Not Available | 681 | Open in IMG/M |
| 3300031231|Ga0170824_124486230 | Not Available | 583 | Open in IMG/M |
| 3300031231|Ga0170824_128279475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter dinghuensis | 1117 | Open in IMG/M |
| 3300031261|Ga0302140_10836566 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031344|Ga0265316_10740558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300031446|Ga0170820_11300180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300031446|Ga0170820_15806115 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300031474|Ga0170818_101174345 | Not Available | 521 | Open in IMG/M |
| 3300031524|Ga0302320_10671183 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300031545|Ga0318541_10822313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300031573|Ga0310915_10889511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 624 | Open in IMG/M |
| 3300031679|Ga0318561_10039304 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
| 3300031679|Ga0318561_10329976 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300031681|Ga0318572_10940925 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031708|Ga0310686_114986151 | Not Available | 866 | Open in IMG/M |
| 3300031708|Ga0310686_117663764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3507 | Open in IMG/M |
| 3300031708|Ga0310686_118451702 | Not Available | 542 | Open in IMG/M |
| 3300031711|Ga0265314_10323101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300031719|Ga0306917_10859115 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031736|Ga0318501_10543714 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300031740|Ga0307468_101719510 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031744|Ga0306918_11175766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300031754|Ga0307475_10798661 | Not Available | 749 | Open in IMG/M |
| 3300031763|Ga0318537_10196288 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300031765|Ga0318554_10816824 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031771|Ga0318546_10386834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 976 | Open in IMG/M |
| 3300031771|Ga0318546_10707388 | Not Available | 709 | Open in IMG/M |
| 3300031771|Ga0318546_10932596 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031792|Ga0318529_10154801 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300031795|Ga0318557_10404333 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031795|Ga0318557_10565732 | Not Available | 522 | Open in IMG/M |
| 3300031796|Ga0318576_10108133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300031799|Ga0318565_10521983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300031820|Ga0307473_10190845 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300031846|Ga0318512_10487651 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300031846|Ga0318512_10496178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300031879|Ga0306919_10986282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 644 | Open in IMG/M |
| 3300031880|Ga0318544_10251054 | Not Available | 685 | Open in IMG/M |
| 3300031890|Ga0306925_10564681 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300031912|Ga0306921_10372352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1669 | Open in IMG/M |
| 3300031941|Ga0310912_11403224 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031942|Ga0310916_10805076 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 791 | Open in IMG/M |
| 3300031945|Ga0310913_10162244 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300031946|Ga0310910_10951388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300031946|Ga0310910_11360037 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031946|Ga0310910_11383291 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031947|Ga0310909_10790167 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300031947|Ga0310909_11585516 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031954|Ga0306926_12763168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300031959|Ga0318530_10079289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300031959|Ga0318530_10209408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300032001|Ga0306922_10992223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300032010|Ga0318569_10415851 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300032025|Ga0318507_10339713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300032025|Ga0318507_10475718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300032035|Ga0310911_10430063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300032035|Ga0310911_10587579 | Not Available | 646 | Open in IMG/M |
| 3300032039|Ga0318559_10601180 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300032052|Ga0318506_10525191 | Not Available | 524 | Open in IMG/M |
| 3300032055|Ga0318575_10558490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 581 | Open in IMG/M |
| 3300032059|Ga0318533_11370888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300032160|Ga0311301_11597640 | Not Available | 794 | Open in IMG/M |
| 3300032160|Ga0311301_12531166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300032180|Ga0307471_100120512 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300032180|Ga0307471_100662039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300032180|Ga0307471_100822209 | Not Available | 1096 | Open in IMG/M |
| 3300032180|Ga0307471_101631027 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300032261|Ga0306920_102840976 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300032261|Ga0306920_103042593 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300032783|Ga0335079_10000418 | All Organisms → cellular organisms → Bacteria | 49017 | Open in IMG/M |
| 3300033289|Ga0310914_10784050 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300033547|Ga0316212_1007671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1558 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.51% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.32% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.16% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.16% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.16% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.16% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.77% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.77% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.39% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.39% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.39% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.39% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.39% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.39% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.39% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.39% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001413 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027460 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A001DRAFT_100943451 | 3300000793 | Forest Soil | MLVFLTTFLAILPSILRSRAAVELENLALRHQIGVLQRSAARR |
| JGI20180J14839_10037343 | 3300001413 | Arctic Peat Soil | MFASLTTLLTTLSSILHSRTALELENLALRHQIGV |
| JGI12630J15595_100173581 | 3300001545 | Forest Soil | MLIFLATLLATLSAILRSRAALGLENLALRHQIGVLQRSARKRSKLTPLDR |
| JGI12627J18819_100611951 | 3300001867 | Forest Soil | MFLATLSSIFRSRAALQLENLALRHQIGVLQRSAKRRPRL |
| JGI12627J18819_103663652 | 3300001867 | Forest Soil | MALFLTAFLAILPSILRSRAALLLENLALRHQIGVLQRSAAKR |
| C688J35102_1209830321 | 3300002568 | Soil | MLAVLASVLKSRTALQLDNLALRHQIGVLQRSAKKRHLLTT* |
| JGI25615J43890_10646432 | 3300002910 | Grasslands Soil | MLIFLKTLLASLASIFRSRASLGLENLALRHQIGVLXRSAGKRXK |
| JGI24140J50213_100226572 | 3300003369 | Arctic Peat Soil | MFASLTTLLTTLSSILHSRTALELENLALRHQIGVLQRSARKRPR* |
| Ga0062384_1002073281 | 3300004082 | Bog Forest Soil | MLISLTTFLATLSSICHSRVALELENLALRHQIGVLQRSARKRPKLTPVD |
| Ga0062389_1001796913 | 3300004092 | Bog Forest Soil | MLISLTSVLATLRLIFRSRAALDLENLALRHQIGELQRSTPIIPC* |
| Ga0058899_122914992 | 3300004631 | Forest Soil | MRISLSTLLATLSSIFRSRAALGLENLALRHQIGVLQRSA |
| Ga0066674_103726442 | 3300005166 | Soil | MLIFLTTLLASLASTFRSRASVGRENLALRHQIGVLQGLQESAQN* |
| Ga0066672_102887162 | 3300005167 | Soil | MLIFLRTLFASLLSIFRLRAALELENLALRHQIAVLQRTAAKRL |
| Ga0066677_100703991 | 3300005171 | Soil | MLIFLAAFLPTLFSIFRSRAALELENLALRHQIGVLQRSVRKRPRLTPL |
| Ga0066673_100598934 | 3300005175 | Soil | MLIFLATLLSTLYSILRSRTALELENLALRHQIGVLQCSARNRRPKLTALDRVL |
| Ga0066388_1003540711 | 3300005332 | Tropical Forest Soil | MLIVLKTALASLSSIFRSRAALELENLALRHQIGILQRSARKRPKLT |
| Ga0066388_1015626362 | 3300005332 | Tropical Forest Soil | MLRSLIRSRIDLQLENLALRHQIGVLQRSLKKHPKLNTAS* |
| Ga0066388_1044263071 | 3300005332 | Tropical Forest Soil | MLIFLATLLATLPSILRSRAVLELENLALRHQIGVLQRSARKRPKVILA |
| Ga0066388_1078097381 | 3300005332 | Tropical Forest Soil | MLISLTTLFAALSSVFRSRSALQLENLALRHQINVLQRTAETPDIDALG |
| Ga0008090_151863162 | 3300005363 | Tropical Rainforest Soil | MLVFLTTFLAVLPSILRSRAALELENLALCHQIGVLQRSAAKR |
| Ga0066681_101175331 | 3300005451 | Soil | MLIFLTTLLASLASIFRSRASLGLENLALRHQIGVLHRSAG |
| Ga0066661_104724412 | 3300005554 | Soil | MLIFLAAFLPTRFSIFRSRAALELENLALRHQIGV |
| Ga0066661_108964212 | 3300005554 | Soil | MLIFLATLLTSLASIFRSRASRGLENLALRHQIGVLQGLQESAQ |
| Ga0066707_104268732 | 3300005556 | Soil | MPISLTTLLATLSSIFRSRAALGLENLALRHQIGVLQRSARK |
| Ga0066704_103283393 | 3300005557 | Soil | MLIFLTTLLASLASIFRSRASLGLENLALRHQIGVLHRSAGKRPKLTAGD |
| Ga0066699_100508481 | 3300005561 | Soil | MLIFLTTLLAPLRSIFRSRAALELENLALRHQNRC |
| Ga0066703_100667234 | 3300005568 | Soil | MLISLVTRFATLSSIFRSRAVLQLENLALRHQIGVLQRSARKR |
| Ga0066705_103027671 | 3300005569 | Soil | MLILSSFLATLPSILRSRAALELENLALRHQIGVLQRSAASRPKLV |
| Ga0066694_100616581 | 3300005574 | Soil | MLIFLTTLLASLASIFRSRASLGLENLALRHQIGV |
| Ga0070762_108446201 | 3300005602 | Soil | MLISLTTLLAALSSIFRSRAALGLENLALRHQIGVLQRS |
| Ga0066903_1005104161 | 3300005764 | Tropical Forest Soil | MLVFLTTFLAVLPSILRSRAALELENLALRHQIGVLQRSAAKRLKLTS |
| Ga0066903_1059483192 | 3300005764 | Tropical Forest Soil | LRSLIRSRIDLQLENLALRHQIGVLQRSLKKHPKLNTAS* |
| Ga0070766_101597411 | 3300005921 | Soil | MLIFLTTLLGTLSSMFRSRAVLELENLALRHQIGVLQRSAR |
| Ga0070766_102230204 | 3300005921 | Soil | MVISLTTLLATLSSIFRSRAALELENLALRHQIGVLQRS |
| Ga0070766_103585823 | 3300005921 | Soil | MLISLTTFLATLSWICRSRATLQLENLALRHQIGVLQRS |
| Ga0066651_101283153 | 3300006031 | Soil | MLIFLTTLLASLASIFRSRASLGLENLALRHQIGVLHR |
| Ga0075017_1004010861 | 3300006059 | Watersheds | MLNSLTTFFTTLSSIFRSRAILQLENLALRHQIGVLQRSARKR |
| Ga0075017_1006389981 | 3300006059 | Watersheds | MLISLTRLLATLGSIFRSRGALQLENLALRHPIGVLLRSAKNGPS* |
| Ga0075030_1004162681 | 3300006162 | Watersheds | MLIFLTTLLAALSSIGRSRAALQLENLALRHQVGVLR |
| Ga0070765_1021826342 | 3300006176 | Soil | MLIPLTTLLATLSSICRSRAAVGLENLALRHQIGVLQRSARK |
| Ga0079222_112329823 | 3300006755 | Agricultural Soil | MLIFISTLFATLSSIYRSRAVLELENLALRHQIGVLQRS |
| Ga0066653_101796482 | 3300006791 | Soil | MLIFVTTLLATLASIFRSRASLGLENLALRYQIGVLHRSAGKRP |
| Ga0066660_114018841 | 3300006800 | Soil | MFISVMRLLAALGSIFRSRAALQLENLALRHQIGV |
| Ga0075433_100577741 | 3300006852 | Populus Rhizosphere | MLISLTTLLATMSSIFPSRAGLELENLALRHQIGVLQRSAKKRP |
| Ga0073928_100383664 | 3300006893 | Iron-Sulfur Acid Spring | MLISLATLLAALGSLFRSRAALELENLARRNHIGLLRRSGLHHR* |
| Ga0073928_109764432 | 3300006893 | Iron-Sulfur Acid Spring | MLILLSALLSTLGSMFRSRAALESEHLAFRHQIGVPKRS |
| Ga0099829_113064632 | 3300009038 | Vadose Zone Soil | MLISLTTLLATLFSIFRSRAALELENLALRHQIGVLQ |
| Ga0116128_10026896 | 3300009518 | Peatland | MLISLAALLGTLRSIIRSRLDVQLENLALRHQIGVLHRSARER |
| Ga0116220_105080191 | 3300009525 | Peatlands Soil | MLFSLTTLLATLYSIFRSCAALELENLTLRHPRQLPRV |
| Ga0116124_10379343 | 3300009634 | Peatland | MLISLAALLGTLRSIIRSRLDVQLENLALRHQIGVLHRSARERPKLTSA |
| Ga0126380_117235042 | 3300010043 | Tropical Forest Soil | LISLKTLFAALSSVFRSRSALQLENLALRHQINVLQRTARNTRH* |
| Ga0126373_105889163 | 3300010048 | Tropical Forest Soil | MLISLTTLFVTLSSIFRSRSALQLENLALRHQVGVL |
| Ga0126373_111220721 | 3300010048 | Tropical Forest Soil | VLIFLTTLLATLSSVLGPRAALELENLALRHQIGVLQRSAAKRPKLTSGD |
| Ga0126373_112665011 | 3300010048 | Tropical Forest Soil | FSLMRVFLTTLLAVLPSILRSRAAVELEILALHH* |
| Ga0126373_114310352 | 3300010048 | Tropical Forest Soil | SKTLAMLIFATLLATLSSIVRSRAALELENLALRHPIGVLQRCA* |
| Ga0126373_127493642 | 3300010048 | Tropical Forest Soil | MLIFLTTLLATLSSALRPRAALQLENMALRHQIGVL |
| Ga0126373_130286642 | 3300010048 | Tropical Forest Soil | MLVFATLLATLSSTVRSRAALELENLALRHQIGVLQR |
| Ga0134067_104527901 | 3300010321 | Grasslands Soil | MLISLTTLFATLSSVFRSRAALELENLALRHQIGV |
| Ga0074045_103389332 | 3300010341 | Bog Forest Soil | MLNFLATLLATLPSILRSRAALELENLALRRHQIGVLQRSARKRPKLTPLD |
| Ga0126370_116383582 | 3300010358 | Tropical Forest Soil | MHLFLKTFLADLPYILRSRAALGLENLALRHQIGVLHGSAA |
| Ga0126372_106005451 | 3300010360 | Tropical Forest Soil | MRVFLTTLLAILPSILRSRAAVQLENLALRHQIGVLQRSAAKR |
| Ga0126378_120580581 | 3300010361 | Tropical Forest Soil | MLIFLTTLIAVLSSFLRSRAALELENLALRHQIGVLQRSATRRP |
| Ga0126379_111380211 | 3300010366 | Tropical Forest Soil | MLISFTTLFVTLSSIFRSRAALQLENLALRHQVGVLQR |
| Ga0126381_1000057001 | 3300010376 | Tropical Forest Soil | MLIALKTLLAMLASIFRSRAALQLENLALRHQIGILQRS |
| Ga0126381_1002989984 | 3300010376 | Tropical Forest Soil | MLIFLATLLATLSSILRSRAVLELENLALRHQIGVLQRSAS |
| Ga0126381_1013128412 | 3300010376 | Tropical Forest Soil | MLIFLTTLLATLSSVLRPRAALQLENMALRHQIGVLQRS |
| Ga0126381_1032272521 | 3300010376 | Tropical Forest Soil | MLILLRSYLATLPSILLSRAALELENLALRHQIGVLQRSAAKRPKLTS |
| Ga0126381_1041417871 | 3300010376 | Tropical Forest Soil | MLISFTTLFVTLSSIFRSRAALQLENLALRHQVGV |
| Ga0136449_1044050061 | 3300010379 | Peatlands Soil | MLTALLTLLATLSSFFRLRAALELENLALRHQIGELRRAAAKRLKL |
| Ga0126383_100383155 | 3300010398 | Tropical Forest Soil | MLIFLATLLDTLSSILRSRAALELENLALRHQIGVLQRSTRKRPKSILM |
| Ga0126383_114724362 | 3300010398 | Tropical Forest Soil | MLILRSFLAALLSILRSRAALELENLALRHQIGVLQRS |
| Ga0137392_101466131 | 3300011269 | Vadose Zone Soil | MPISLTTLLATLSSIFRSRAALELENVALRHQIGV |
| Ga0137391_103338071 | 3300011270 | Vadose Zone Soil | MLISLTTLLAILSSIFRSRTALEVENLALRHQIGVLQR |
| Ga0137388_101357311 | 3300012189 | Vadose Zone Soil | MLILLSAVLSTLGSMFRSRAVLELEHMALRHQIGV |
| Ga0137388_118418402 | 3300012189 | Vadose Zone Soil | MLILLSAVFSTLCSMFRSRAALELEHIALRHQIGVLKRSARKRPK |
| Ga0137364_109996852 | 3300012198 | Vadose Zone Soil | MLIFLTTLVAILSSILRSRAVIELENLALRHQIGVL |
| Ga0137399_101162804 | 3300012203 | Vadose Zone Soil | MLIFLKTLLTSLASIFRSRASLGLENLALRHQIGVLH |
| Ga0137399_103090642 | 3300012203 | Vadose Zone Soil | MLIFLKTLLTSLASIFPSRASLGLENLALRHQIGVLYRS |
| Ga0137399_113140391 | 3300012203 | Vadose Zone Soil | MLIFLKTLLASLASIFRSRASLGLENLALRHQIGVLHRSAGKRPKLTAG |
| Ga0137399_115278221 | 3300012203 | Vadose Zone Soil | MLISPATLLATLFSIFRSRAALQLENLALRHQIGVL |
| Ga0137362_103310913 | 3300012205 | Vadose Zone Soil | MLIFLKTLLASLASIFRSRASLGLENLALRHQIGVLQRSAGKR |
| Ga0137376_103284082 | 3300012208 | Vadose Zone Soil | MLIFLTTLLATLWSIFRSRASLGLENLALRHQIGVLH |
| Ga0137377_109629571 | 3300012211 | Vadose Zone Soil | MLIFLTTLLATLWSIFRSRASLGLENLALRHQIGVLHR |
| Ga0137370_100020491 | 3300012285 | Vadose Zone Soil | MLIFLKTLLASLAPIFRSRASLGLENLALRHQIGVLHRSAGKRPKL |
| Ga0137384_108173951 | 3300012357 | Vadose Zone Soil | MLNLLSIFLAALSSVFRTHAALRLENLALRHQIGVLQPEKKAGMM |
| Ga0137361_114536731 | 3300012362 | Vadose Zone Soil | MLIFLTTLLASLASIFRSRASLGLENLALRHQIGVLHRS |
| Ga0137358_101017283 | 3300012582 | Vadose Zone Soil | MLIFLTTLLAILWSIFRSRASLGLENLALRHQIGVL |
| Ga0137395_100089531 | 3300012917 | Vadose Zone Soil | MLIFLTTLLASLASIFRSRASLGLENLSLRHQIGVL |
| Ga0137395_103585231 | 3300012917 | Vadose Zone Soil | MLIFLTTLLASLASIFRSRASLGLENLALRHQIGVL |
| Ga0137396_104668422 | 3300012918 | Vadose Zone Soil | MLISLTTLFATLFSIFRSRTALQLENLALRHQIGVLQRSAR |
| Ga0137359_103808152 | 3300012923 | Vadose Zone Soil | MLILLSAVFSTLCSMFRSRATLELEHIALRHQIGVL |
| Ga0137419_107233062 | 3300012925 | Vadose Zone Soil | MLIFVTTLLSTLWSIFRSRASLGLENLALRHQIGVLRRSAGK |
| Ga0126369_100175651 | 3300012971 | Tropical Forest Soil | MLIFFTTLLATLSSILCSRAALELENLALRHQLGVLQRSARKRPRLT |
| Ga0126369_109013591 | 3300012971 | Tropical Forest Soil | MLILPSFLATLPSILRSRAALELEILALRHQIGVLQRSA |
| Ga0181521_102571681 | 3300014158 | Bog | MLILLSAVLSTLGSMCRSRAALELEHVALCHQIGVLKRSARKRPK |
| Ga0181538_101110512 | 3300014162 | Bog | MLISFTTLLVTLSSIFRSRAAVEFENLALRHQIGVLQRSARKRPG* |
| Ga0181523_105073801 | 3300014165 | Bog | MLVFLMTLLAVLPSILRSRAAVELENLALRHQIGVLQRSA |
| Ga0182015_102802661 | 3300014495 | Palsa | MKILFLALLSALRSYFKSRAALQAENLALRHQIIV |
| Ga0182021_109662461 | 3300014502 | Fen | MLISLATLLATMSSSFRSRAALEMENLALRHQIGVLQQAVKIRP* |
| Ga0137420_13368121 | 3300015054 | Vadose Zone Soil | MLIFLTTFLATLSSIFRSRAALEFENLALRHQIGVLQTSGRKRPK |
| Ga0132256_1000595675 | 3300015372 | Arabidopsis Rhizosphere | MLIVLTTLLGSLSSMVRSRAVLELENLALRHQIGVLQRPAG |
| Ga0182036_101578381 | 3300016270 | Soil | MLVFATLLATLSSTVRSRAALELENLALRHQIGVLQ |
| Ga0182036_103277371 | 3300016270 | Soil | MLISLKTLLTNLSSILHSRAALQLENLALRHQIGVLQRS |
| Ga0182041_100474341 | 3300016294 | Soil | MPIFLTTLLATLSSVLRPRAALQLENMALRHEIGVLQRS |
| Ga0182041_102186992 | 3300016294 | Soil | LLATLSSVLRPRAALQLENMALRHEIGVLQRSAAKRPKLTSGDL |
| Ga0182041_102354691 | 3300016294 | Soil | MLVFATLLAALSSTVRSRAALELENLALRHQIGVLQ |
| Ga0182041_107740361 | 3300016294 | Soil | MLIFLTTLLAALRAILRSRGALELENLALRHQIGV |
| Ga0182033_100317962 | 3300016319 | Soil | MPIFLTTLLATLSSVLRPRAALQLENMALRHEIGVLQRSAAKRPKLTSGDL |
| Ga0182033_101713791 | 3300016319 | Soil | MLISLAAFLPTLFSIFRSRAALQLENLALRHQIGVLQRSVRKRPK |
| Ga0182033_110801351 | 3300016319 | Soil | MLIFVTTLLGTLSSMFRSRAVLELENVALRHQIGVLQ |
| Ga0182033_114186861 | 3300016319 | Soil | MHLFFRTFLAALPSILCSRAALELENLALRHQIGVLQRSAAKRPKLT |
| Ga0182033_121990612 | 3300016319 | Soil | MHVFLTTLLAILPSIPRSRAAVEFENLALRHQNGLLQRPAAKRLKLTSGDR |
| Ga0182033_122150151 | 3300016319 | Soil | MIIIILRSLVRSRIDLQLENLALRHQIGVLQRSLKKR |
| Ga0182032_114265331 | 3300016357 | Soil | MLIFLRSCLATLPSILLSRAALELENLAQRHQIGVLQR |
| Ga0182034_101926264 | 3300016371 | Soil | MLISLAAFLPTLFSIFRSRAALQLENLALRHQIGVLQRSVRKR |
| Ga0182034_103764593 | 3300016371 | Soil | PMLIVFASMLATLASILRSRAALELEILALRHQIGVLRRSAAKRQS |
| Ga0182034_120096482 | 3300016371 | Soil | MVIFLALISSLGSICRSRAALELENLALRHQIGVLRRSVRKRPKWTPL |
| Ga0182040_102040122 | 3300016387 | Soil | MALFLTAFLAILPSILRSRAALLLENLALRHQIGVLQRSTAKRPKLTSGDR |
| Ga0182040_102479631 | 3300016387 | Soil | MPVFLRTLLAVLPSILRSRAAVELENLALRHQIGVLQRC |
| Ga0182040_103366671 | 3300016387 | Soil | MLISLKTLLTNLSSILHSRAALQLENLALRHQIGVLQ |
| Ga0182040_112732651 | 3300016387 | Soil | MHVFLTTLLAILPSIPRSRAAVEFENLALRHQNGVLQRPAAKRLKLTSGDRLL |
| Ga0182037_101444203 | 3300016404 | Soil | MLIALTTLLATLSSIFRSRAAIELENLALRHQIGVLQRSARK |
| Ga0182039_109184972 | 3300016422 | Soil | MLVFLTTFLAILPSILRLRAALELENLALRHQIGVLQRSAAKR |
| Ga0182039_112650221 | 3300016422 | Soil | MPVFLRTLLAVLPSILRSRAAVELENLALRHQIGVLQRCAAKRPKLT |
| Ga0182039_119921352 | 3300016422 | Soil | MLIFLTTLLATLSSVLRPRAALQLENIALRHQIGVLQRSAAKRPKLTNLWR |
| Ga0182039_121948201 | 3300016422 | Soil | MLIFLATLLAALRAIFRSRTALELENLALRHQIGVLQRST |
| Ga0182038_112358191 | 3300016445 | Soil | MLILPSFLATLASIFRSRAVLGLEILALRHQIGVLKRSAVKRPKLT |
| Ga0187806_12137961 | 3300017928 | Freshwater Sediment | MLISFTTLLVTLRAIFRSRAALELENLALRHQIGVLQRS |
| Ga0187849_10073816 | 3300017929 | Peatland | MLISLAALLGTLRSIIRSRLDVQLENLALRHQIGVLHRS |
| Ga0187814_103637932 | 3300017932 | Freshwater Sediment | MLNFLATLLPTLPSILRSRAALELENLALRHQIGVRSGPQENA |
| Ga0187819_102324681 | 3300017943 | Freshwater Sediment | MLISLKTLLATLSSIFRSRAALQLENLALRHPIGILQRSPKKRSKL |
| Ga0187819_103499393 | 3300017943 | Freshwater Sediment | MFISVMRLLVALGSIFRSRAALQLENLALRHQIGVLLRSAR |
| Ga0187817_106315002 | 3300017955 | Freshwater Sediment | MRISLKTLLAALSSIFRSRAALQLENLALRHPIGILQR |
| Ga0187782_109635441 | 3300017975 | Tropical Peatland | MTRLATLSSIFRSRAALELENLARRHQIGVLQRSARKRPTLTS |
| Ga0187804_102074851 | 3300018006 | Freshwater Sediment | MPISLTTLLSTLWSIFGSRAALQLENLALRHQIGVLQR |
| Ga0187804_103662391 | 3300018006 | Freshwater Sediment | MLIFLTTLLASLASIFRSRASLGLENLALRHQIGVLH |
| Ga0187884_100846184 | 3300018009 | Peatland | MLIFLATLLGTLSSRLHSPVALELENLALRHPVAVLQRSARKRPKLTPADR |
| Ga0187881_101640461 | 3300018024 | Peatland | MLIFLATLLGTLSSMLHSPVALELENLALRHPVAVLQRSARKRPKLTPADR |
| Ga0187784_106345201 | 3300018062 | Tropical Peatland | MLLLFKTFLAVVASILRSRAAVELENLALCQQIGVLQRSAAKRPKLTSGDRLF |
| Ga0193751_11951591 | 3300019888 | Soil | MPISLTMFLATLSSIFRSRAALQLENLALRHQIGV |
| Ga0179592_100052171 | 3300020199 | Vadose Zone Soil | MLIFLKTLLASLASIFRSRASLGLENLALRHQIGVLQRSAGK |
| Ga0179592_101223111 | 3300020199 | Vadose Zone Soil | MLIFLKTLLASLASIFRSRASLGLENLALRNQIGVLTEVCRK |
| Ga0210403_102335582 | 3300020580 | Soil | MLILLTTLLGTLSSMFRSRAMLELENLALRHQVGVLQRSARK |
| Ga0215015_103496761 | 3300021046 | Soil | MLIPLVALLVTLCSILRSRLDLQLENLALRHQINVLQRSAKKRPMICLLYT |
| Ga0210406_101389804 | 3300021168 | Soil | MLIVLTTLLGTLSSLLRSRAVLEVENLALRHQIGVLQRSARKRPK |
| Ga0210384_117210161 | 3300021432 | Soil | MLIFLTTLLASLASIFRSRASLGPENLALRHQIGVLHRSAEIG |
| Ga0210392_100968281 | 3300021475 | Soil | MLISLTTLFATLSSIFHSRAALGLENLALRNQIGI |
| Ga0210409_100417381 | 3300021559 | Soil | MLTALMTLLATLSSIFRSRAALELENLALRHQIGVLR |
| Ga0126371_102379063 | 3300021560 | Tropical Forest Soil | LRSLIRSRIDLQLENLALRHQIGVLQRSLKKHPKLTSMDR |
| Ga0126371_106422291 | 3300021560 | Tropical Forest Soil | MLISLKTLLATLASIFRSRAALQLENLALRHQIGILQRSARK |
| Ga0126371_108297901 | 3300021560 | Tropical Forest Soil | MLILPSFLATLSSILRSRVALELEILALRHQIGVLQRSA |
| Ga0126371_122403091 | 3300021560 | Tropical Forest Soil | MLIFFPTLLATLSSILCSRAALELENLALRHQLGVLQRSARKRP |
| Ga0126371_138189942 | 3300021560 | Tropical Forest Soil | MHVFLTTLLAILPSIPPSRAAVELENVALRHQNGVLQRPAAKRLKLPPLVD |
| Ga0208191_10023027 | 3300025496 | Peatland | MLISLAALLGTLRSIIRSRLDVQLENLALRHQIGVLHRSARERPKLTS |
| Ga0207664_106063341 | 3300025929 | Agricultural Soil | MLIPLTALFGTLASDFRSRSALQLQNLALRHQIGVLQRAARK |
| Ga0209688_10576162 | 3300026305 | Soil | MLIFVTTLLATLASIFRSRASLGLENLALRYQIGVLHR |
| Ga0209152_100485921 | 3300026325 | Soil | MLIFLATFLPTLSSILRSRAALQLENLALRHQIGVLQRSARRRPK |
| Ga0209802_13099681 | 3300026328 | Soil | MLISLTTLFATLSSVFRSRAALELENLALRHQIGVLQRSARKR |
| Ga0209158_11628333 | 3300026333 | Soil | MLIFLATFLPTLSSILRSRAALQLENLALRHQIGV |
| Ga0209804_12810362 | 3300026335 | Soil | MPIFLTTLLASLASIFRSRASLGLENLALRHQIGVLH |
| Ga0255350_10487611 | 3300026502 | Soil | MLTFLTTLLAALRSLFRARVDLELENIALRHQIGVLR |
| Ga0209806_10793171 | 3300026529 | Soil | MLIFLATFLPTLSSILRSRAALQLENLALRHQIGVLQRSARRRP |
| Ga0209648_101525963 | 3300026551 | Grasslands Soil | MLIFLTTLLASVRSIFQSRAALDLENLALRHQIAVLQRSAA |
| Ga0209648_102707411 | 3300026551 | Grasslands Soil | MLIFLKTLLASLASIFRSRASLGLENLALRHQIGVLQRSAGKRPK |
| Ga0209577_100244231 | 3300026552 | Soil | MLIFLAAFLPTLFSIFRSRAALELENLALRHQIGV |
| Ga0179587_107296101 | 3300026557 | Vadose Zone Soil | MLIFLATLLGTLSSMLHSRVALEIENLALRHPGAVLQR |
| Ga0207781_10244692 | 3300026890 | Tropical Forest Soil | MLIFLRSCLATLPSILLLRAALELENLALRRQIGVLQRSAAKRPKLTSGDRPFVDLPLPP |
| Ga0209731_10252292 | 3300027326 | Forest Soil | MLIFLTALLASLASIFRSRASLRLENLALRHQIGVLQRSASERLNENAR |
| Ga0209418_10650111 | 3300027371 | Forest Soil | MLIVLTTLLGTLSPMVRSRAVLALENLALRHQIVVLQRSARN |
| Ga0207506_10138731 | 3300027460 | Soil | MLISLATLLTNLFSIFRSRAALELENLALRHQIGVVG |
| Ga0209523_10285222 | 3300027548 | Forest Soil | MLISFATRFATLSSIFRSRAALELENLALRHQIGVLQRSA |
| Ga0209588_10235451 | 3300027671 | Vadose Zone Soil | MLIFLTTLLASLASIFRSRASLGLENLALRRQIGVLHRSAGK |
| Ga0209448_100329031 | 3300027783 | Bog Forest Soil | MLISLTKLLFSLCLIFRSRAALELENLALRHQLGVLQRSTR |
| Ga0209580_101014083 | 3300027842 | Surface Soil | MLIALTTLFATLSPMFRSRAALELENLALRHQICVLH |
| Ga0209465_102497981 | 3300027874 | Tropical Forest Soil | MLVFATLLATLSSTVRSRAALELENLALRHQIGVLQRS |
| Ga0209465_104533412 | 3300027874 | Tropical Forest Soil | MHLFLRTFLADLPYILRSRAALGLENLALRHQIGVLHGSAAKLPKLTSG |
| Ga0209590_102306812 | 3300027882 | Vadose Zone Soil | MLILLSAVFSTLCSMFRSRAALELEHIALRHQIGVLKRSAGKR |
| Ga0209698_106771032 | 3300027911 | Watersheds | MLILLSALLSTLGSMFRSRAGLELENLALRHQIGVLK |
| Ga0137415_101414581 | 3300028536 | Vadose Zone Soil | MLISLTTFLATLSSIFRSRAALQLENLALRHQIGV |
| Ga0308309_107292273 | 3300028906 | Soil | MRISLSTLLATLSSIFRSRAALGLENLALRHQIGV |
| Ga0170834_1112047591 | 3300031057 | Forest Soil | MPILLSAVFSTLCSMFRSRAALELEHIALRHQIGVLKRSARKRPKLTAAD |
| Ga0170834_1124887411 | 3300031057 | Forest Soil | MLIFLTTLLASVRSIFQSRAVIDLENLALRHQIAVLQRSAAKCL |
| Ga0265760_101780451 | 3300031090 | Soil | MLISLTTLLTNLSSIFYSRAALQLENLALRHQIGVLQ |
| Ga0170822_144976191 | 3300031122 | Forest Soil | MLIFLTTLLAALRAIFRSRAALELENLALRHQIGVLQRSARKR |
| Ga0170824_1137772201 | 3300031231 | Forest Soil | MPISLTTLLVTLSSVFHSRAALQLENLALRHQIGVLQR |
| Ga0170824_1147021422 | 3300031231 | Forest Soil | MLIFLTTLLAALRAIFRSRAALELENLALRHQIGVL |
| Ga0170824_1244862301 | 3300031231 | Forest Soil | MPILLSAVFSTLCSMFRSRAALELEHIALRHQIGVLKRSARKR |
| Ga0170824_1282794751 | 3300031231 | Forest Soil | MLIFLTTLLAALRAIFRSRAALELENLALRHQIGVLQRS |
| Ga0302140_108365662 | 3300031261 | Bog | MLTFLTTLLAALRSLFRARVDLELENVALRHQIGVLQRSAKKR |
| Ga0265316_107405581 | 3300031344 | Rhizosphere | MLISVTVLLVALSSIFRSRASLELENLALRHQIGVLQRSVRKRP |
| Ga0170820_113001802 | 3300031446 | Forest Soil | MLSPLTTLFTTVCSMFRLRTTLQLENVALRHQIGVLQ |
| Ga0170820_158061152 | 3300031446 | Forest Soil | MLMLIFLTTILASVRLIFQSRATLDLENLALRHQIAVLQRSAAKRLKLTSAD |
| Ga0170818_1011743451 | 3300031474 | Forest Soil | MLIFLTTLLAALRAIFRSRAALELENLALRHQIGV |
| Ga0302320_106711831 | 3300031524 | Bog | MLTFLTTLLAALRSLFRARVDLELENVALRHQIGV |
| Ga0318541_108223132 | 3300031545 | Soil | MLILWSFLATLSSILRSRGALELEILALRHQIGVLQRSAM |
| Ga0310915_108895111 | 3300031573 | Soil | MLIFLMTLLAALRAIFRSRAALELENLALRHQIGVLQRSTTKR |
| Ga0318561_100393041 | 3300031679 | Soil | MLVFLTTFLAILPSILRSRAAVELENLALRHQIGVLQRSAARRPKLTSG |
| Ga0318561_103299761 | 3300031679 | Soil | MLIFLATLLAALRAIFRSRTALELENLALRHQIGVLQRS |
| Ga0318572_109409251 | 3300031681 | Soil | MLIFLTTLLATLSFILRSLAALELENLALRHQLGVLQR |
| Ga0310686_1149861511 | 3300031708 | Soil | MLISLTTLLATLSSIFHSRAALELENLALRHQIGVLQ |
| Ga0310686_1176637641 | 3300031708 | Soil | MPISLMTLLATLSSIFCSRASLLLENLALRHQIGVLKRSARKRPKLT |
| Ga0310686_1184517021 | 3300031708 | Soil | MLISLTILFATLCSLFRSRVALEFENLALRHQIGV |
| Ga0265314_103231012 | 3300031711 | Rhizosphere | MLISVTTLLVALASIFRSRASLELENLALRHQIGVLQRS |
| Ga0306917_108591153 | 3300031719 | Soil | MLVFLTPFLAILPSILRSRAAVELENLALRHQIGVLQRSAA |
| Ga0318501_105437141 | 3300031736 | Soil | MRVFLTTLLAILPSILRSRAAVELENLALRHQIGVLQRS |
| Ga0307468_1017195101 | 3300031740 | Hardwood Forest Soil | MLIFLTTLRASVCSIFRSGAALDLENLALRHQFGVLQ |
| Ga0306918_111757661 | 3300031744 | Soil | MLISLAAFLPTLFSIFRSRAALQLENLALRHQIGVLQRSV |
| Ga0307475_107986612 | 3300031754 | Hardwood Forest Soil | MLISLTTLLTNLSSIFYSRAALQLENLALRHQIGVLQRSV |
| Ga0318537_101962882 | 3300031763 | Soil | MLVFLTTFLAILPSILRSRAAVELENLALRHQIGVLQMSAARRPKLT |
| Ga0318554_108168242 | 3300031765 | Soil | MRVFLTTLLAVLPSILRSRAAVELENLALRHQIGVLQRSAAK |
| Ga0318546_103868343 | 3300031771 | Soil | MPVFLRTLLAVLPSILRSRAAVELENLALRHQIGVLQRCAAKRPK |
| Ga0318546_107073881 | 3300031771 | Soil | MPLILPLLAALRCMFRSRAAVELEILALRHQIGVLQRAANKR |
| Ga0318546_109325962 | 3300031771 | Soil | LAVFPSILRSRAALELENLALRHQIGVLQRSAAKTSEINLQ |
| Ga0318529_101548012 | 3300031792 | Soil | MPISLKTLLTNLPSIFHSRGALQLENLALRHQIGVLQRSSAILE |
| Ga0318557_104043332 | 3300031795 | Soil | MLVFLTTLLAILPSILRSRAAVELENLALRHQIGVLQRSAAKRLKLTS |
| Ga0318557_105657321 | 3300031795 | Soil | MLVFLTTFLAVLPSILRSRAALELENLALLHQIGVLHRSAAKR |
| Ga0318576_101081331 | 3300031796 | Soil | MLIVFASMLATLASILRSRAALELEILALRHQIGVLRRSAAKRQS |
| Ga0318565_105219831 | 3300031799 | Soil | MLIFLRSCLATLSSILLSRAAVELENLALRHQIGVLQRCA |
| Ga0307473_101908451 | 3300031820 | Hardwood Forest Soil | MLSPLTALFATLASVFRSRSALQLENLALRHQIGVLQRAARK |
| Ga0318512_104876511 | 3300031846 | Soil | MLIFLTTLLATLSSVLRPRAALQLENIALRHQIGVLQRSAA |
| Ga0318512_104961782 | 3300031846 | Soil | MLVFLTTFLAILPSILRSGVALELENLALRHQIGVLQR |
| Ga0306919_109862821 | 3300031879 | Soil | MLLFLTTFLAVLPSILRSRAALELENLALRHQIGVLQRSAA |
| Ga0318544_102510541 | 3300031880 | Soil | MVVFLTTFLAVLPSILRSRAALELENLALLHQIGVLHRSAAKRLKLT |
| Ga0306925_105646811 | 3300031890 | Soil | LVPLIRVFLTTHFAVLPSIPRSRAAVELENLALRHQVGVFQKSAAKRLKLTSGN |
| Ga0306921_103723521 | 3300031912 | Soil | MLIALTTLLATLSSIFRSRAALELENLALRHQIGVL |
| Ga0310912_114032241 | 3300031941 | Soil | MHVFLTTLLAILPSIPPSRAAVELENLALRHQNGVLQRPAAKRLKLTVDLSRPS |
| Ga0310916_105017081 | 3300031942 | Soil | SLFRLRAAPQLENLALRHQIGVLPESAAKRSKLAPGDRFF |
| Ga0310916_108050763 | 3300031942 | Soil | MLVFLTTFLAILPSILRSRAALELENLALRHQIGVLQRFAAKRPK |
| Ga0310913_101622441 | 3300031945 | Soil | MHVFLTTLLAILPSIPRSRAAVEFENLALRHQNGVLQRPAAKRLKLTSGD |
| Ga0310910_102967962 | 3300031946 | Soil | MIIIILRSLVRSRIDLQLENLALRHQIGVLQRSLKKRPQLTS |
| Ga0310910_109513882 | 3300031946 | Soil | LFLASMLATLASFLRSRAALELELLALRHQIGVLRRSAGKRPKLTSGVTDSR |
| Ga0310910_113600371 | 3300031946 | Soil | MLVFATLLATLSSTVRSRAALELENLALRHQIGVLQRSAKR |
| Ga0310910_113832911 | 3300031946 | Soil | MLVFLTPFLAILPSILRSRAAVELENLALRHQIGVLQRS |
| Ga0310909_107901671 | 3300031947 | Soil | MVPFLTAFLAILPSILRSHAALLLENLALRHQIGVLQRSAAKRPKL |
| Ga0310909_115855161 | 3300031947 | Soil | MLIFLTTLLATLSSVLRPRAALQLQNIALRHQIGVLQRSAAKRP |
| Ga0306926_127631681 | 3300031954 | Soil | MHLFFRTLLAALLSILRSLAALELENPALRHQIGVLQRSAAKRPKLT |
| Ga0318530_100792893 | 3300031959 | Soil | FLPMLIVFASMLATLASILRSRAALELEILALRHQIGVLRRSAAKRQS |
| Ga0318530_102094082 | 3300031959 | Soil | MPVFLRTLLAVLPSILRSRAAVELENLALRHQSGVV |
| Ga0306922_109922231 | 3300032001 | Soil | MLVFLTTFLAILPSILRSRAALELENLALRHQIGVLQ |
| Ga0318569_104158511 | 3300032010 | Soil | MLVFLTTLLAILPSILRSRAAVELENLALRHQIGVLQRSAAKR |
| Ga0318507_103397132 | 3300032025 | Soil | MLVFLTTFLAILPSILRSRAALELENLALRHQIGVLQR |
| Ga0318507_104757182 | 3300032025 | Soil | MLISLTTLLSTLGSIFRSRAALELENLALRHQIAVL |
| Ga0310911_104300632 | 3300032035 | Soil | MRVLLTTLLAILPSILRSRAALELEKLALRHQIAVLQ |
| Ga0310911_105875791 | 3300032035 | Soil | MPVFLRTFLAVLRSILRSRAAVELENLALRHQIGVLQRC |
| Ga0318559_106011801 | 3300032039 | Soil | MPIFLTTLLATLSSVLRPRAALQLENMALRHQIGVLQRSAAKRPK |
| Ga0318506_105251911 | 3300032052 | Soil | MLISLTTLIATLSSVFRSRTALQLENLALRHQVGVLQRASR |
| Ga0318575_105584901 | 3300032055 | Soil | MLIFLMTLLAALRAIFRSRAALELENLALRHQIGVLQR |
| Ga0318533_113708881 | 3300032059 | Soil | MLVFATQLATLSSTVRSRAALGLENLALRHQIGVLQRS |
| Ga0311301_115976401 | 3300032160 | Peatlands Soil | MLISLASVLATLGSVFRSRAALELENLALRHQIRVLQRSAR |
| Ga0311301_125311661 | 3300032160 | Peatlands Soil | MLISLTTVPVTLSSLFHSRAALELENLTLRRQIGVLQRAAIRRPRLTLV |
| Ga0307471_1001205123 | 3300032180 | Hardwood Forest Soil | MPISLTTLLATLSSIFCSRDSLLLEKLALRHQIGVLKRSARKPPKLTSGDRLL |
| Ga0307471_1006620391 | 3300032180 | Hardwood Forest Soil | MLTTLMTLLATLSSIFRSRAALELENMALRHQIGVLR |
| Ga0307471_1008222091 | 3300032180 | Hardwood Forest Soil | MLILLTTLLGTLSSMFRSRAMLENLALRHQVGVLQ |
| Ga0307471_1016310272 | 3300032180 | Hardwood Forest Soil | MLIVLTTLLGTLSSMFRSRAALSLELENLALRHQIGVLQRSARKR |
| Ga0306920_1028409762 | 3300032261 | Soil | MILLVKTFLAVVPSILRSRAAVGLKNLALRHQIGVLQR |
| Ga0306920_1030425931 | 3300032261 | Soil | MLILATLLAALPSVLRSRAAVELENIALRHQIGVLQRAAKQRPRLTAADR |
| Ga0335079_1000041835 | 3300032783 | Soil | MLISLTTLLANLSSIFYSRAALQLENLALRHQIGVLQ |
| Ga0310914_107840502 | 3300033289 | Soil | MRVFLTTLLAVLPSILRSRGAVESENLALRHQIGVLQRSAAK |
| Ga0316212_10076714 | 3300033547 | Roots | MIISLTTLLATLSSIFRSRAALELENLALRHQIGVLQR |
| ⦗Top⦘ |