


| Basic Information | |
|---|---|
| Family ID | F014548 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 262 |
| Average Sequence Length | 41 residues |
| Representative Sequence | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLKVR |
| Number of Associated Samples | 221 |
| Number of Associated Scaffolds | 262 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.77 % |
| % of genes near scaffold ends (potentially truncated) | 98.47 % |
| % of genes from short scaffolds (< 2000 bps) | 98.09 % |
| Associated GOLD sequencing projects | 211 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.076 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.542 % of family members) |
| Environment Ontology (ENVO) | Unclassified (16.794 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.023 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 262 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 88.55 |
| PF04392 | ABC_sub_bind | 1.15 |
| PF01548 | DEDD_Tnp_IS110 | 0.76 |
| PF00665 | rve | 0.38 |
| PF02586 | SRAP | 0.38 |
| PF00782 | DSPc | 0.38 |
| PF14417 | MEDS | 0.38 |
| PF17158 | MASE4 | 0.38 |
| PF01526 | DDE_Tnp_Tn3 | 0.38 |
| PF00732 | GMC_oxred_N | 0.38 |
| PF08332 | CaMKII_AD | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 262 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 89.31 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.15 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.38 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.38 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.38 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.38 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.38 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.38 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.38 |
| COG4875 | Protein kinase association domain CaMKII_AD, NTF2-like superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.08 % |
| Unclassified | root | N/A | 9.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig15693 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10036264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium tibeticum | 1142 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1009346 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1009910 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300000886|AL3A1W_1103203 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300001132|JGI12491J13347_101992 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300001397|JGI20177J14857_1007134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2283 | Open in IMG/M |
| 3300001423|JGI20199J14953_1002852 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300001538|A10PFW1_10245086 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300001593|JGI12635J15846_10252514 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300001661|JGI12053J15887_10118991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1414 | Open in IMG/M |
| 3300002077|JGI24744J21845_10018673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1373 | Open in IMG/M |
| 3300002128|JGI24036J26619_10086121 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300002239|JGI24034J26672_10021328 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100368497 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10045389 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10107077 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300003989|Ga0055473_10021913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1717 | Open in IMG/M |
| 3300004007|Ga0055476_10044701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium tibeticum | 1385 | Open in IMG/M |
| 3300004014|Ga0055456_10070953 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300004025|Ga0055433_10116466 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300004266|Ga0055457_10061462 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300005159|Ga0066808_1012856 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005186|Ga0066676_10658717 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005290|Ga0065712_10589116 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005332|Ga0066388_104306007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300005332|Ga0066388_105231259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300005332|Ga0066388_107317529 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005332|Ga0066388_107395607 | Not Available | 551 | Open in IMG/M |
| 3300005333|Ga0070677_10638560 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005354|Ga0070675_100898854 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300005354|Ga0070675_100964100 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005356|Ga0070674_102210356 | Not Available | 503 | Open in IMG/M |
| 3300005406|Ga0070703_10581323 | Not Available | 515 | Open in IMG/M |
| 3300005435|Ga0070714_102373146 | Not Available | 515 | Open in IMG/M |
| 3300005436|Ga0070713_102361083 | Not Available | 514 | Open in IMG/M |
| 3300005445|Ga0070708_100535839 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300005455|Ga0070663_100268722 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300005466|Ga0070685_10166175 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300005466|Ga0070685_10788110 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005467|Ga0070706_100291291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1523 | Open in IMG/M |
| 3300005518|Ga0070699_100643694 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300005518|Ga0070699_100723965 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005536|Ga0070697_101509441 | Not Available | 601 | Open in IMG/M |
| 3300005538|Ga0070731_10023701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4214 | Open in IMG/M |
| 3300005538|Ga0070731_10376386 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300005561|Ga0066699_10439252 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005598|Ga0066706_10272595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense | 1324 | Open in IMG/M |
| 3300005602|Ga0070762_10170658 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300005712|Ga0070764_10149347 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300005712|Ga0070764_10224276 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300005713|Ga0066905_100738436 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005713|Ga0066905_101074182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300005718|Ga0068866_10352462 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005718|Ga0068866_10909425 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005718|Ga0068866_11141410 | Not Available | 560 | Open in IMG/M |
| 3300005719|Ga0068861_101001629 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005764|Ga0066903_103258652 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300005764|Ga0066903_104151171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. JYMT SZCCT0428 | 775 | Open in IMG/M |
| 3300005764|Ga0066903_106922000 | Not Available | 588 | Open in IMG/M |
| 3300005764|Ga0066903_107772648 | Not Available | 551 | Open in IMG/M |
| 3300005764|Ga0066903_109064247 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005896|Ga0075282_1037972 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005949|Ga0066791_10095306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. SS-4 | 599 | Open in IMG/M |
| 3300005983|Ga0081540_1150565 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300005993|Ga0080027_10107020 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300005995|Ga0066790_10505469 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006038|Ga0075365_10188059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1445 | Open in IMG/M |
| 3300006048|Ga0075363_100126977 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300006050|Ga0075028_100085850 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300006051|Ga0075364_10255295 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300006055|Ga0097691_1039076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1760 | Open in IMG/M |
| 3300006057|Ga0075026_100119664 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300006057|Ga0075026_100555112 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006059|Ga0075017_100234843 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300006086|Ga0075019_10498790 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006102|Ga0075015_100992283 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300006162|Ga0075030_101533123 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006172|Ga0075018_10143493 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300006172|Ga0075018_10174623 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300006173|Ga0070716_100223917 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300006173|Ga0070716_100501313 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300006174|Ga0075014_100761081 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300006176|Ga0070765_100712380 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300006176|Ga0070765_100831706 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006178|Ga0075367_10160308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
| 3300006178|Ga0075367_10171445 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300006354|Ga0075021_10152296 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300006354|Ga0075021_10641432 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006572|Ga0074051_11759019 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300006577|Ga0074050_11811584 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300006579|Ga0074054_12111669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. SS-4 | 1336 | Open in IMG/M |
| 3300006846|Ga0075430_100406021 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300006852|Ga0075433_10635133 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300006854|Ga0075425_100404714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense | 1572 | Open in IMG/M |
| 3300006854|Ga0075425_100541872 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300006854|Ga0075425_100591108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense | 1277 | Open in IMG/M |
| 3300006871|Ga0075434_101078035 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300006871|Ga0075434_101305255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 737 | Open in IMG/M |
| 3300006881|Ga0068865_101412770 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006903|Ga0075426_10413052 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300007076|Ga0075435_100636407 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300009088|Ga0099830_10942459 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300009100|Ga0075418_13013777 | Not Available | 513 | Open in IMG/M |
| 3300009148|Ga0105243_10882661 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300009523|Ga0116221_1410676 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009525|Ga0116220_10152489 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300009552|Ga0116138_1078059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 927 | Open in IMG/M |
| 3300009624|Ga0116105_1073107 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300009628|Ga0116125_1023750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1525 | Open in IMG/M |
| 3300009628|Ga0116125_1108421 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300009649|Ga0105855_1064400 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300009759|Ga0116101_1090995 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300010039|Ga0126309_10374606 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300010041|Ga0126312_10771100 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300010048|Ga0126373_10800006 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300010166|Ga0126306_10229791 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300010359|Ga0126376_11733978 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300010360|Ga0126372_10344674 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300010361|Ga0126378_13140838 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010366|Ga0126379_12302914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
| 3300010376|Ga0126381_100702610 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300010403|Ga0134123_11511733 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010863|Ga0124850_1113103 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300010868|Ga0124844_1064911 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300011412|Ga0137424_1003676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1670 | Open in IMG/M |
| 3300011412|Ga0137424_1012467 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300012202|Ga0137363_11133401 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012209|Ga0137379_11828692 | Not Available | 501 | Open in IMG/M |
| 3300012211|Ga0137377_10911288 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012477|Ga0157336_1001305 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300012582|Ga0137358_10091210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2059 | Open in IMG/M |
| 3300012948|Ga0126375_11575494 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012951|Ga0164300_10086188 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300012987|Ga0164307_11412651 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300013105|Ga0157369_10134568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2617 | Open in IMG/M |
| 3300013306|Ga0163162_10330050 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300014160|Ga0181517_10350997 | Not Available | 765 | Open in IMG/M |
| 3300014164|Ga0181532_10467433 | Not Available | 694 | Open in IMG/M |
| 3300014168|Ga0181534_10412016 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300014200|Ga0181526_10281454 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300014264|Ga0075308_1024410 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300014498|Ga0182019_10634531 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300014501|Ga0182024_11035835 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300014501|Ga0182024_11440237 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300014969|Ga0157376_11712337 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300015080|Ga0167639_1008470 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300015158|Ga0167622_1058067 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300015161|Ga0167623_1028003 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300015162|Ga0167653_1060671 | Not Available | 652 | Open in IMG/M |
| 3300015200|Ga0173480_10239658 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300015241|Ga0137418_10256867 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300015371|Ga0132258_12325846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1344 | Open in IMG/M |
| 3300015373|Ga0132257_103686249 | Not Available | 557 | Open in IMG/M |
| 3300015374|Ga0132255_100615345 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300015374|Ga0132255_101211743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → unclassified Pelagibacterium → Pelagibacterium sp. SCN 64-44 | 1137 | Open in IMG/M |
| 3300015374|Ga0132255_102194185 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300016341|Ga0182035_11082286 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300016404|Ga0182037_10212052 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300016422|Ga0182039_11673614 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300016445|Ga0182038_11370135 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300017961|Ga0187778_10190937 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300017975|Ga0187782_11323331 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300018002|Ga0187868_1309789 | Not Available | 519 | Open in IMG/M |
| 3300018017|Ga0187872_10471115 | Not Available | 524 | Open in IMG/M |
| 3300018030|Ga0187869_10108515 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300018088|Ga0187771_10223077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium medicae | 1568 | Open in IMG/M |
| 3300018469|Ga0190270_10286617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1458 | Open in IMG/M |
| 3300018476|Ga0190274_10902743 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300018476|Ga0190274_11554379 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300019240|Ga0181510_1335390 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300019361|Ga0173482_10161337 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300021082|Ga0210380_10099928 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300021088|Ga0210404_10170971 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300021401|Ga0210393_11018198 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300021475|Ga0210392_10856952 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300021560|Ga0126371_10536038 | Not Available | 1319 | Open in IMG/M |
| 3300021560|Ga0126371_10659390 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300023070|Ga0247755_1146720 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300023168|Ga0247748_1018580 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300025481|Ga0208079_1053055 | Not Available | 913 | Open in IMG/M |
| 3300025527|Ga0208714_1022797 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300025898|Ga0207692_10143304 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300025898|Ga0207692_10666339 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300025915|Ga0207693_10401258 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300025927|Ga0207687_11382777 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300025934|Ga0207686_10758551 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300025938|Ga0207704_10341774 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300025986|Ga0207658_10321750 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300026005|Ga0208285_1006822 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300026075|Ga0207708_10288481 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300026089|Ga0207648_10646561 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300026121|Ga0207683_11484171 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300026276|Ga0209847_1018483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1486 | Open in IMG/M |
| 3300027516|Ga0207761_1022908 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300027590|Ga0209116_1020772 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300027854|Ga0209517_10273444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1000 | Open in IMG/M |
| 3300027862|Ga0209701_10109910 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300027869|Ga0209579_10259875 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300027876|Ga0209974_10238078 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300027911|Ga0209698_11403648 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300028884|Ga0307308_10111922 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300029827|Ga0134606_10218424 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300029999|Ga0311339_10598746 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300030014|Ga0302175_10024433 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300030019|Ga0311348_10821993 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300030737|Ga0302310_10267294 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300030916|Ga0075386_10062583 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300030972|Ga0075400_10020842 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300031128|Ga0170823_14073872 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300031200|Ga0307496_10097549 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300031231|Ga0170824_101783886 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300031235|Ga0265330_10050440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1825 | Open in IMG/M |
| 3300031446|Ga0170820_14666335 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031543|Ga0318516_10188449 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300031544|Ga0318534_10119770 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300031640|Ga0318555_10202024 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300031679|Ga0318561_10119603 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300031708|Ga0310686_108282659 | Not Available | 605 | Open in IMG/M |
| 3300031708|Ga0310686_118952434 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031711|Ga0265314_10143190 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300031720|Ga0307469_10937429 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031744|Ga0306918_10206326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1483 | Open in IMG/M |
| 3300031747|Ga0318502_10477882 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300031753|Ga0307477_10188753 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300031754|Ga0307475_10506564 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300031754|Ga0307475_11086348 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300031763|Ga0318537_10155607 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300031765|Ga0318554_10575327 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300031792|Ga0318529_10098839 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300031795|Ga0318557_10243207 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031833|Ga0310917_10309599 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300031833|Ga0310917_11186989 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031854|Ga0310904_11329200 | Not Available | 521 | Open in IMG/M |
| 3300031890|Ga0306925_10449353 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300031908|Ga0310900_10226592 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300031912|Ga0306921_11625409 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300031941|Ga0310912_10690927 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031945|Ga0310913_11235169 | Not Available | 519 | Open in IMG/M |
| 3300031945|Ga0310913_11310594 | Not Available | 502 | Open in IMG/M |
| 3300031947|Ga0310909_10869494 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031947|Ga0310909_11237577 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031965|Ga0326597_10659388 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032000|Ga0310903_10075806 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300032000|Ga0310903_10077164 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300032043|Ga0318556_10348556 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300032051|Ga0318532_10055361 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300032060|Ga0318505_10267963 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300032076|Ga0306924_10425775 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300032076|Ga0306924_12124330 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300032205|Ga0307472_101155270 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300032205|Ga0307472_102640691 | Not Available | 512 | Open in IMG/M |
| 3300032261|Ga0306920_100817459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → unclassified Pelagibacterium → Pelagibacterium sp. SCN 64-44 | 1367 | Open in IMG/M |
| 3300032421|Ga0310812_10260650 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300032783|Ga0335079_11524757 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300033289|Ga0310914_10903370 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300033433|Ga0326726_11689387 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300033475|Ga0310811_10691272 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300033513|Ga0316628_101975432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium tibeticum | 775 | Open in IMG/M |
| 3300033547|Ga0316212_1061360 | Not Available | 542 | Open in IMG/M |
| 3300034151|Ga0364935_0162078 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.91% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.91% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.53% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.53% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.53% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.15% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.15% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.15% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.15% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.15% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.76% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.76% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.76% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.76% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.38% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.38% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.38% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.38% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.38% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.38% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.38% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.38% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.38% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001132 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 10 | Environmental | Open in IMG/M |
| 3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
| 3300001423 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003989 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 | Environmental | Open in IMG/M |
| 3300004007 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 | Environmental | Open in IMG/M |
| 3300004014 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004266 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014264 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015158 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin) | Environmental | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023070 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4 | Environmental | Open in IMG/M |
| 3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026276 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029827 | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030972 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0693.00001430 | 2166559005 | Simulated | ALVGCGHVSGLLMRQVWPLALMLCADRVPIERLHFKVR |
| F14TC_1001836221 | 3300000559 | Soil | RPGKNFLTNAALVGCGHVSGLLMRQVWPLALMRCANRVPIELAHLLVR* |
| AF_2010_repII_A001DRAFT_100362642 | 3300000793 | Forest Soil | DAALVGCGHVSGLLMRHGWPLALMLCADQVPIQTSHSKMR* |
| AP72_2010_repI_A100DRAFT_10093462 | 3300000837 | Forest Soil | IDKSLYVDAALVGCGHVSGLLMRRGWPLALMLXADQVPIVHTHSKMR* |
| AP72_2010_repI_A100DRAFT_10099101 | 3300000837 | Forest Soil | VDAALVGCGHVSGLLMRHGWPLALMLCADQVPIESTHSKMQ* |
| AL3A1W_11032032 | 3300000886 | Permafrost | AAALVGCGHVSGLLMRRMWPLALMLCADRVPIVSTHFKVR* |
| JGI12491J13347_1019921 | 3300001132 | Tropical Forest Soil | AALVGCGHVSGLLMRRMWPLALMLCADRIPIVSTHFKVR* |
| JGI20177J14857_10071341 | 3300001397 | Arctic Peat Soil | VGCGHVSGLFVRQEWPLALMLCADRVPIKMAHLEVR* |
| JGI20199J14953_10028523 | 3300001423 | Arctic Peat Soil | LVGCGHVSGLLMRQVWPLALMLCADRVPIVRPHLKVR* |
| A10PFW1_102450861 | 3300001538 | Permafrost | AAALVGCGHVSGLLMRRVGPLALMLCANRAPIVSTHF* |
| JGI12635J15846_102525141 | 3300001593 | Forest Soil | VGCGHVSGLLMRQVWPLALMLCADRVPIENAHFKVR* |
| JGI12053J15887_101189913 | 3300001661 | Forest Soil | GCGHVSGLLMRQVWPLALMLCADRVPNIARTFEEVR* |
| JGI24744J21845_100186731 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | FAALVGCGHVSGLLMRQVWPLALMLCADRVPIVNPHFEVR* |
| JGI24036J26619_100861212 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | XLSDXSAALVGCGHVSGLLMRQVWPLALMLCADRVPIVNPHFEVR* |
| JGI24034J26672_100213282 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | CGHVSGLFVRRVRPLALMLCADRVPIKNTHFKVR* |
| JGIcombinedJ26739_1003684972 | 3300002245 | Forest Soil | VGCGHVSGLLMRQVWPLALMLCADRVPIVRMHFKVR* |
| JGIcombinedJ43975_100453891 | 3300002899 | Soil | AALVGCGHVSGLLMRHGWPLALMLYADQVPIESTHSKMR* |
| JGIcombinedJ51221_101070771 | 3300003505 | Forest Soil | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHFKVR* |
| Ga0055473_100219132 | 3300003989 | Natural And Restored Wetlands | MSALGHLWTAPWQVLSYGSAGLVGAVMSGLLVRHWWPLALMLSADQIPIESTHSMMR* |
| Ga0055476_100447011 | 3300004007 | Natural And Restored Wetlands | GHLWTAPWQVLSYGSAGLVGAVMSGLLVRHWWPLALMLSADQIPIESTHSMMR* |
| Ga0055456_100709531 | 3300004014 | Natural And Restored Wetlands | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVHMHLEVR* |
| Ga0055433_101164662 | 3300004025 | Natural And Restored Wetlands | LLQMVGCGHVSGLFVRRGWPLALMLSAGQVPIVSTHSKMR* |
| Ga0055457_100614621 | 3300004266 | Natural And Restored Wetlands | LQLVGCGHVSGLFVRRGWPLALMLSAGQVPIVSTHSKMR* |
| Ga0066808_10128562 | 3300005159 | Soil | FAALVGCGHVSGLLVRQVWPLALMLCADRVPIVFMHLEVR* |
| Ga0066676_106587171 | 3300005186 | Soil | AALVGCGHVSGLLMRRVWPLALMLCADQVPNKNTHFEEVR* |
| Ga0065712_105891161 | 3300005290 | Miscanthus Rhizosphere | SAALVGCGHVSGLLMRPVWPLALMLCADRVPIVRMHVKVR* |
| Ga0066388_1043060071 | 3300005332 | Tropical Forest Soil | MGYVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIVRTHS |
| Ga0066388_1052312593 | 3300005332 | Tropical Forest Soil | VDAALVGCGHVSGLLMRHGWPLALMLYADQVPIRLAHSKMR* |
| Ga0066388_1073175292 | 3300005332 | Tropical Forest Soil | FYVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIVRTHSKMR* |
| Ga0066388_1073956073 | 3300005332 | Tropical Forest Soil | LSYVDAALVGCGHVSGLLMRHGWPLALMLCADQVPIQTSHSKMR* |
| Ga0070677_106385601 | 3300005333 | Miscanthus Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVNPHFEVR* |
| Ga0070675_1008988542 | 3300005354 | Miscanthus Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCADWVPIDRMHLKVR* |
| Ga0070675_1009641001 | 3300005354 | Miscanthus Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCADRIPIESTHLEVR* |
| Ga0070674_1022103561 | 3300005356 | Miscanthus Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCADWVPIESTHLEVR* |
| Ga0070703_105813231 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | DAALVGCGHVSGLLMRRGWPLALMLCADQVPIVHTHSKMR* |
| Ga0070714_1023731462 | 3300005435 | Agricultural Soil | DRFAALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLKVR* |
| Ga0070713_1023610832 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLKVR* |
| Ga0070708_1005358392 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCANRVPIELPHLVVR* |
| Ga0070663_1002687222 | 3300005455 | Corn Rhizosphere | VAAALVGCGHVSGLLMRRGWPLALMLCADLVPIVHMHLEVR* |
| Ga0070685_101661753 | 3300005466 | Switchgrass Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCADRVPKPRTLEEVR* |
| Ga0070685_107881102 | 3300005466 | Switchgrass Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLEVR* |
| Ga0070706_1002912911 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VDAALVGCGHVSGLLMRRGWPLALMLCADQVPIESTHSKMR* |
| Ga0070699_1006436942 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AFYVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIVHTHSKMR* |
| Ga0070699_1007239651 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LFYVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIQLAHSKMR* |
| Ga0070697_1015094412 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AALVGCGHVSGLLMRRVWPLALMLCADQVPIESTHFKVR* |
| Ga0070731_100237012 | 3300005538 | Surface Soil | MGIGRMRHVSGLLMRRMWPLALMLCADQVLIVNMHF* |
| Ga0070731_103763862 | 3300005538 | Surface Soil | NFLTFCSMVGCGHVSGLLVRHLWPLALMLCADGVPNNRAHLEEVR* |
| Ga0066699_104392522 | 3300005561 | Soil | LVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLKVR* |
| Ga0066706_102725952 | 3300005598 | Soil | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLKVR* |
| Ga0070762_101706581 | 3300005602 | Soil | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVNTHF* |
| Ga0070764_101493472 | 3300005712 | Soil | FDVSAALVGCGHVSGLLMRRGWPLALMLCADRVPIHRAHSIMR* |
| Ga0070764_102242762 | 3300005712 | Soil | LVGCGHVSGLLMQPMWPLALMLCADRVPIENTHFVEVR* |
| Ga0066905_1007384362 | 3300005713 | Tropical Forest Soil | DAALVGCGHVSGLLMRHGWPLALMLCADQVPIVRTHSKMR* |
| Ga0066905_1010741823 | 3300005713 | Tropical Forest Soil | FDVDAVLVGCGHVSGLLMRRGWPLALMLRADQVPVESTHSKMR* |
| Ga0068866_103524621 | 3300005718 | Miscanthus Rhizosphere | LVGCGHVSGLLMRQVWPLALMLCADRVPIVSSHLKVR* |
| Ga0068866_109094251 | 3300005718 | Miscanthus Rhizosphere | ALVGCGHVSGLLMRQVWPLALMLCADRVPIVNPHFEVR* |
| Ga0068866_111414102 | 3300005718 | Miscanthus Rhizosphere | LSDVSAALVGCGHVSGLLMRQVRPLALMLCADRVPIVRPHLTVR* |
| Ga0068861_1010016292 | 3300005719 | Switchgrass Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCADRVPIKMAHLEVR* |
| Ga0066903_1032586522 | 3300005764 | Tropical Forest Soil | DVDAALVGCGHVSGLFVRRGWPLALMLCADQVPIVSTHLKMR* |
| Ga0066903_1041511712 | 3300005764 | Tropical Forest Soil | VDAALVGCGHVSGLLMRRGWPLALMLCADQVPIQTSHSKSVNPNGLF* |
| Ga0066903_1069220003 | 3300005764 | Tropical Forest Soil | ALVGCGHVSGLFVRPMWPLAIMLCADRVPIESTHSKMR* |
| Ga0066903_1077726481 | 3300005764 | Tropical Forest Soil | GKNFLTFAALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHSKVR* |
| Ga0066903_1090642472 | 3300005764 | Tropical Forest Soil | LVGCGHVSGLLMRHGWPLALMLCADQVPIESTHSK |
| Ga0075282_10379722 | 3300005896 | Rice Paddy Soil | SAALVGCGHVSGLLMRQVWPLALMLCADQVPIVRPHLMVR* |
| Ga0066791_100953062 | 3300005949 | Soil | AALVGCGHVSGLLMRRVWPLALMLCADRVPIVNTHF* |
| Ga0081540_11505652 | 3300005983 | Tabebuia Heterophylla Rhizosphere | GCGHVSGLLMRRVWPLALMLCADRVPNKNAHLEVVR* |
| Ga0080027_101070202 | 3300005993 | Prmafrost Soil | AALVGCGHVSGLLMRRVWPLALMLCADRVPNNRAHFREVR* |
| Ga0066790_105054691 | 3300005995 | Soil | RRHGKSFFDVSAALVGCGHVSGLLMRRVWPLALMLCADRVPNNRAHFREVR* |
| Ga0075365_101880591 | 3300006038 | Populus Endosphere | LVGCGHVSGLLMRQVWPLALMLCADRVPIERLHLEVR* |
| Ga0075363_1001269773 | 3300006048 | Populus Endosphere | FLRFAALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLKVR* |
| Ga0075028_1000858502 | 3300006050 | Watersheds | VGCGHVSGLLMRQERPLALMLCADRVPIERLHLEVR* |
| Ga0075364_102552952 | 3300006051 | Populus Endosphere | SDVAAALVGCGHVSGLLMRQVWPLALMLCADRIPIESTHLEVR* |
| Ga0097691_10390763 | 3300006055 | Arctic Peat Soil | LSDVDAALVGCGHVSGLFVRQEWPLALMLCADRVPIKMAHLEVR* |
| Ga0075026_1001196643 | 3300006057 | Watersheds | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHSKVR* |
| Ga0075026_1005551122 | 3300006057 | Watersheds | GKNFLTLLQMVGCGHVSGLFVRHGWPLALMLSADQVPILRTHSKMR* |
| Ga0075017_1002348433 | 3300006059 | Watersheds | AALVGCGHVSGLLMRRGWPLALMLCADRVPIHRAHSIMR* |
| Ga0075019_104987901 | 3300006086 | Watersheds | DVSAALVGCGHVSGLLMRQVWPLALMLCADQVPIVRPHLMVR* |
| Ga0075015_1009922831 | 3300006102 | Watersheds | AALVGCGHVSGLLMRQVWPLALMLCADRVPNKKAHLEDVR* |
| Ga0075030_1015331231 | 3300006162 | Watersheds | ALVGCGHVSGLLMRQVWPLALMLCADRVPNKKAHLEDVR* |
| Ga0075018_101434932 | 3300006172 | Watersheds | FYVDAALVGCGHVSGLLMRHGWPLALMLCADQVPIQRTHSKMR* |
| Ga0075018_101746231 | 3300006172 | Watersheds | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHFGVR* |
| Ga0070716_1002239172 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DAALVGCGHVSGLLMRRGWPLALMLCADQVPIESTHSKMR* |
| Ga0070716_1005013132 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DAALVGCGHVSGLLMRRGWPLALMLCADQVPIHRTHSKMR* |
| Ga0075014_1007610812 | 3300006174 | Watersheds | AALVGCGHVSGLLMRQERPLALMLCADRVPIENTHSSMR* |
| Ga0070765_1007123802 | 3300006176 | Soil | ALVGCGHVSGLWMRRWWPLALMLFADRVPIVFMHLEVR* |
| Ga0070765_1008317062 | 3300006176 | Soil | SDVSAALVGCGHVSGLLMRRGWPLALMLCADRVPIVFTHSEVR* |
| Ga0075367_101603083 | 3300006178 | Populus Endosphere | AALVGCGHVSGLLMRQVWPLALMLCADRVPIERLHLEVR* |
| Ga0075367_101714452 | 3300006178 | Populus Endosphere | VGCGHVSGLLMRQVWPLALMLCADRIPIESTHLEVR* |
| Ga0075021_101522962 | 3300006354 | Watersheds | GCGHVSGLLMRQVWPLALMLCADRVPIVRMHFKVR* |
| Ga0075021_106414322 | 3300006354 | Watersheds | VGCGHVSGLFVRPVRPLAIMLFADRVPIESTHSKMR* |
| Ga0074051_117590192 | 3300006572 | Soil | AALVGCGHVSGLLMRQERPLALMLCADRVPIERLHLEVR* |
| Ga0074050_118115842 | 3300006577 | Soil | AALVGCGHVSGLLVRQVWPLALMLCAERVPIESPHLKVR* |
| Ga0074054_121116692 | 3300006579 | Soil | RLAALVGCGHVSGLLVRQVWPLALMLCAERVPIESPHLKVR* |
| Ga0075430_1004060211 | 3300006846 | Populus Rhizosphere | RFAALVGCGHVSGLLMRQVWPLALMLCADRIPIESTHLEVR* |
| Ga0075433_106351332 | 3300006852 | Populus Rhizosphere | FYVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIVRAHSKMR* |
| Ga0075425_1004047142 | 3300006854 | Populus Rhizosphere | QGPFYVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIVRAHSKMR* |
| Ga0075425_1005418721 | 3300006854 | Populus Rhizosphere | SAALVGCGHVSGLLMRRVWPLALMLCADRVPNKNAHLEVVR* |
| Ga0075425_1005911081 | 3300006854 | Populus Rhizosphere | AAALVGCGHVSGLLMRHGWPLALMLFADQVPIEMAHLGVH* |
| Ga0075434_1010780351 | 3300006871 | Populus Rhizosphere | DVDAALVGCGHVSGLFVRRGWPLALMLSADQVPIESTHSKMR* |
| Ga0075434_1013052553 | 3300006871 | Populus Rhizosphere | GCGHVSGLLVRRVWPLALMLCAERVPIESPHLKVR* |
| Ga0068865_1014127701 | 3300006881 | Miscanthus Rhizosphere | LVGCGHVSGLLMRQVWPLALMLCADRVPIVSPHLEVR* |
| Ga0075426_104130521 | 3300006903 | Populus Rhizosphere | AAALVGCGHVSGLLMRHGWPLALMLCADRVPIESTHFKVR* |
| Ga0075435_1006364071 | 3300007076 | Populus Rhizosphere | AALVGCGHVSGLLMRRGWPLALMLCADQVPIVRAHSKMR* |
| Ga0099830_109424591 | 3300009088 | Vadose Zone Soil | HLGHVSGLLMRQVWPLALMLCADRVPNNRAHLEEVR* |
| Ga0075418_130137772 | 3300009100 | Populus Rhizosphere | FYVDAALVGCGHVSGLLMRHGWPLALMLYADQVPIESTHSKMR* |
| Ga0105243_108826612 | 3300009148 | Miscanthus Rhizosphere | QELSDVAAALVGCGHVSGLLMRRGWPLALMLCADLVPIVHMHLEVR* |
| Ga0116221_14106761 | 3300009523 | Peatlands Soil | HGKSFFDVGAALVGCGHVSGLLMRQVWPLALMLCADRIPNNRAHFREVR* |
| Ga0116220_101524892 | 3300009525 | Peatlands Soil | ELSDAAAALVGCGHVSGLLMRRGWPLALMLFADLVPIVFMHLDVR* |
| Ga0116138_10780593 | 3300009552 | Peatland | VGCGHVSGLLMRRGWPLALMLSADKVPILRTHSSMR* |
| Ga0116105_10731071 | 3300009624 | Peatland | KSFFDVGAALVGCGHVSGLLMRQVWPLALMLCADRVPIVNTHF* |
| Ga0116125_10237501 | 3300009628 | Peatland | SMVGCGHVSGLLMRRGWPLALMLSADKVPILRTHSSMR* |
| Ga0116125_11084211 | 3300009628 | Peatland | ELFWRRCRLVGCGHVSGLLMRRVWPLALMLCADRVPIVNTHF* |
| Ga0105855_10644002 | 3300009649 | Permafrost Soil | LVGCGHVSGLLMRRVWPLALMLCADRVPNNRAHFREVR* |
| Ga0116101_10909952 | 3300009759 | Peatland | AALVGCGHVSGLLMRQVRPLALMLCADRVPIVNTHF* |
| Ga0126309_103746062 | 3300010039 | Serpentine Soil | AALVGCGHVSGLLMRQVWPLALMLCADRVPIENTHFEVR* |
| Ga0126312_107711002 | 3300010041 | Serpentine Soil | FYVDAALVGCGHVSGLLMRHGWPLALMLCADQVPIQLAHSKMR* |
| Ga0126373_108000062 | 3300010048 | Tropical Forest Soil | AAALVGCGHVSGLLMRRGWPLALMLFADRVPIVRMHFEVR* |
| Ga0126306_102297911 | 3300010166 | Serpentine Soil | AALVGCGHVSGLLMRQVWPLALMLCADRIPIESTHLDVR* |
| Ga0126376_117339782 | 3300010359 | Tropical Forest Soil | VDAALVGCGHVSGLLMRRGWPLALMLCADQVPIVRTHSKMR* |
| Ga0126372_103446742 | 3300010360 | Tropical Forest Soil | AALVGCGHVSGLLMRQERPLALMLCADRVPIELLHLEVR* |
| Ga0126378_131408381 | 3300010361 | Tropical Forest Soil | GCGHVSGLLMRQERPLALMLCADRVPIELLHLEVR* |
| Ga0126379_123029141 | 3300010366 | Tropical Forest Soil | AALVGCGHVCGLFVRLVRPLALMLCADRVPIKNTHFKVR* |
| Ga0126381_1007026103 | 3300010376 | Tropical Forest Soil | AALVGCGHVSGLLMRQVWPLALMLCADRVPILFMHLEVR* |
| Ga0134123_115117332 | 3300010403 | Terrestrial Soil | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVSPHLEVR* |
| Ga0124850_11131032 | 3300010863 | Tropical Forest Soil | DAALVGCGHVSGLLMRHAWPLALMLCADQVPIQISHSKMR* |
| Ga0124844_10649111 | 3300010868 | Tropical Forest Soil | GHVSGLFHVSGLLMRRGWPLALMLCADQVPIVHTHSKMR* |
| Ga0137424_10036761 | 3300011412 | Soil | LFDVAAALVGCGHVSGLLMRQVWPLALMLCADRVPIVSTHFEVR* |
| Ga0137424_10124672 | 3300011412 | Soil | GCGHVSGLLMRQVWPLALMLCADRVPIERLHLEVR* |
| Ga0137363_111334012 | 3300012202 | Vadose Zone Soil | CGHVSGLLMRQVWPLALMLCADRVPNNRAHLEEVR* |
| Ga0137379_118286922 | 3300012209 | Vadose Zone Soil | VGCGHVSGLLMRRGWPLALMLCADQVPIQLAHSKMR* |
| Ga0137377_109112882 | 3300012211 | Vadose Zone Soil | QELSDISAALVGCGHVSGLLMRQVWPLALMLCADRVPNNRAHLEEVR* |
| Ga0157336_10013051 | 3300012477 | Arabidopsis Rhizosphere | LSYVFAALVGCGHVSGLLMRQVWPLALMLCADRVPKPRTLEEVR* |
| Ga0137358_100912103 | 3300012582 | Vadose Zone Soil | YVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIESSHSKMR* |
| Ga0126375_115754942 | 3300012948 | Tropical Forest Soil | CGHVSGLLMRHGWPLALMLCADQVPIESTHSKMQ* |
| Ga0164300_100861882 | 3300012951 | Soil | WQVLSDGSAALVGCGHVSGLFVRHGWPLALMLSADQVPILRTHSKVR* |
| Ga0164307_114126511 | 3300012987 | Soil | LVGCGHVSGLFVRHGWPLALMLSADQVPILRTHSKVR* |
| Ga0157369_101345681 | 3300013105 | Corn Rhizosphere | GCGHVSGLLMRRVWPLALMLCADRVPIKNTHFKVR* |
| Ga0163162_103300502 | 3300013306 | Switchgrass Rhizosphere | CGHVSGLLMRQVWPLALMLCADRVPIVRMHLKVR* |
| Ga0181517_103509971 | 3300014160 | Bog | AALVGCGHVSGLLMRRGLPLALMLCADRVPIVHMHLEVR* |
| Ga0181532_104674331 | 3300014164 | Bog | ELSDVAAALVGCGHVPGLFVRPVQPLAIMLCADRGPIVSTHFKVR* |
| Ga0181534_104120161 | 3300014168 | Bog | ALVGCGHVSGLLMRRGWPLALMLCADQVPIVHMHLEVR* |
| Ga0181526_102814542 | 3300014200 | Bog | AALVGCGHVSGLLMRPLWPLALMLCADRVPIHHTHSSMR* |
| Ga0075308_10244102 | 3300014264 | Natural And Restored Wetlands | AAALVGCGHVSGLLMRRMVPLALMLCADRVPIKNTHF* |
| Ga0182019_106345312 | 3300014498 | Fen | FAALVGCGHVSGLLMRQVWPLALMLCADRVPNKKAHLEDVR* |
| Ga0182024_110358352 | 3300014501 | Permafrost | FDVRAALVGCGHVSGLLMRRVWPLALMLCADRVPIENAYFKVR* |
| Ga0182024_114402372 | 3300014501 | Permafrost | CGHVSGLLMRRGWPLALMLCADRVPIVHMHLEVR* |
| Ga0157376_117123372 | 3300014969 | Miscanthus Rhizosphere | FAALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLEVR* |
| Ga0167639_10084702 | 3300015080 | Glacier Forefield Soil | SFFDGFAALVGCGHVSGLLMRRVWPLALMLCADRIPIVNTHF* |
| Ga0167622_10580671 | 3300015158 | Glacier Forefield Soil | PWQELSDISAALVGCGHVSGLLMRQVWPLALMLCADRVPNKLTHFEEVR* |
| Ga0167623_10280031 | 3300015161 | Glacier Forefield Soil | ELSDISAALVGCGHVSGLLMRQVWPLALMLCADRVPNKLTHFEEVR* |
| Ga0167653_10606711 | 3300015162 | Glacier Forefield Soil | VAAALVGCGHVSGLLMRQVWPLALMLCADQVPIDRTHLEVR* |
| Ga0173480_102396582 | 3300015200 | Soil | RYAALVWCGHVSGLFVRRVMPLALMLCADRVPIKNTHFKVR* |
| Ga0137418_102568672 | 3300015241 | Vadose Zone Soil | ALVGCGHVSGLLMRQVWPLALMLCANRVPIELPHLVVR* |
| Ga0132258_123258462 | 3300015371 | Arabidopsis Rhizosphere | QEPSDVAATLVGCGHVSGLLMRQVWPLALMLCADRVPIERLHLEVR* |
| Ga0132257_1036862492 | 3300015373 | Arabidopsis Rhizosphere | FYVDAALVGCGHVSGLLMRHGWPLALMLCADQVPIESTHSKMR* |
| Ga0132255_1006153453 | 3300015374 | Arabidopsis Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCADQVPIESSH* |
| Ga0132255_1012117432 | 3300015374 | Arabidopsis Rhizosphere | YAALVGCGHVSGLFVRRVRPLALMLCADRVPIKNTHFKVR* |
| Ga0132255_1021941851 | 3300015374 | Arabidopsis Rhizosphere | CGHVSGLLMRQVWPLALMLCADRVPIVRMHFKVR* |
| Ga0182035_110822862 | 3300016341 | Soil | FAALVGCGHVSGLLVRQVWPLALMLCADRVPIVLMHLKVR |
| Ga0182037_102120522 | 3300016404 | Soil | VGCGHVSGLLMRRGWPLALMLCADQVPIVYTHSEVR |
| Ga0182039_116736142 | 3300016422 | Soil | GCGHVSGLLMRHGWPLALMLCADQVPILFTHSKMR |
| Ga0182038_113701351 | 3300016445 | Soil | GCGHVSGLLVRQVWPLALMLCADRVPIVLMHLKVR |
| Ga0187778_101909372 | 3300017961 | Tropical Peatland | WQELSDVAAALVGCGHVSGLLMRRGWPLALMLCADQVPIRSMHSKMR |
| Ga0187782_113233311 | 3300017975 | Tropical Peatland | VALVGCGHVSGLLMRRVRPLALMRFADRVPIDKTHS |
| Ga0187868_13097892 | 3300018002 | Peatland | ALVGCGHVSGLLMRRGWPLALMLFADLVPIVFMHLDVR |
| Ga0187872_104711152 | 3300018017 | Peatland | ALVGCGHVSGLLMRRGWPLALMLYADQIPIELAHFEVR |
| Ga0187869_101085153 | 3300018030 | Peatland | AAALVGCGHVSGLLMRRGWPLALMLFADLVPIVFMHLDVR |
| Ga0187771_102230772 | 3300018088 | Tropical Peatland | LVGCGHVSGLLMRQVWPLALMLCADRVPNNRAHFREVR |
| Ga0190270_102866173 | 3300018469 | Soil | LSDGSAALVGCGHVSGLLMRQVWPLALMLCADRVPIVRKHLKVR |
| Ga0190274_109027431 | 3300018476 | Soil | LVGCGHVSGLLMRQVWPLALMLCADRVPIERLHLEVR |
| Ga0190274_115543791 | 3300018476 | Soil | RCCRLVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLKVR |
| Ga0181510_13353902 | 3300019240 | Peatland | LSDVSAALVGCGHVSGLLMRPLWPLALMLCADRVPIVFTHSEVR |
| Ga0173482_101613372 | 3300019361 | Soil | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVNPHFEVR |
| Ga0210380_100999282 | 3300021082 | Groundwater Sediment | ALVGCGHVSGLLMRQVWPLALMLCADRVPIDRMHLKVR |
| Ga0210404_101709712 | 3300021088 | Soil | DVAAALVGCGHVSGLLMRRGWPLALMLCADRVPIELTHLEVR |
| Ga0210393_110181982 | 3300021401 | Soil | TAVLVGCGHVSGLLMRQERPLALMLCADRVPIERLHLEVR |
| Ga0210392_108569521 | 3300021475 | Soil | SDVAAVLVGCGHVSGLLMRQERPLALMLCADRVPIERLHLEVR |
| Ga0126371_105360382 | 3300021560 | Tropical Forest Soil | GCGHVSGLLMRRGWPLALMLFADQVPIVSTHLEVR |
| Ga0126371_106593902 | 3300021560 | Tropical Forest Soil | FFDASAALVGCGHVSGLLMRQVWPLALMLCADRVPILFMHLEVR |
| Ga0247755_11467201 | 3300023070 | Plant Litter | ALVGCGHVSGLLMRQVWPLALMLCADRVPIVNPHFEVR |
| Ga0247748_10185802 | 3300023168 | Soil | RLAALVGCGHVSGLLMRQVWPLALMLCADRVPIVNPHFEVR |
| Ga0208079_10530551 | 3300025481 | Arctic Peat Soil | VGCGHVSGLFVRQEWPLALMLCADRVPIKMAHLEVR |
| Ga0208714_10227971 | 3300025527 | Arctic Peat Soil | CGHVSGLLMRQVWPLALMLCADRVPNKKAHLEDVR |
| Ga0207692_101433042 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVGCGHVSGLLVRQVWPLALMLCADRVPNKNAHF |
| Ga0207692_106663391 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | WQELSDVFAVLVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLKVR |
| Ga0207693_104012581 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PGKNFSDASAALVGCGHVSGLLMRRVWPLALMLCADRVPNKSAHLEEVR |
| Ga0207687_113827772 | 3300025927 | Miscanthus Rhizosphere | DVAAALVGCGHVSGLLMRRGWPLALMLCADLVPIVHMHLEVR |
| Ga0207686_107585512 | 3300025934 | Miscanthus Rhizosphere | AALVGCGHVSGLLMRRGWPLALMLCADLVPIVHMHLEVR |
| Ga0207704_103417741 | 3300025938 | Miscanthus Rhizosphere | GSAALVGCGHVSGLLMRQVWPLALMLCADRVPIVRKHLEVR |
| Ga0207658_103217501 | 3300025986 | Switchgrass Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLEVR |
| Ga0208285_10068222 | 3300026005 | Rice Paddy Soil | GKSFFDLSAALVGCGHVSGLLMRQVWPLALMLCADQVPIVRPHLMVR |
| Ga0207708_102884812 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ELSDVSAALVGCGHVSGLLMRQVWPLALMLCADWVPIDRMHLKVR |
| Ga0207648_106465611 | 3300026089 | Miscanthus Rhizosphere | AALVGCGHVSGLLMRQVWPLALMLCADWVPIESTHLEVR |
| Ga0207683_114841712 | 3300026121 | Miscanthus Rhizosphere | PWQELSDVSAALVGCGHVSGLLMRPVWPLALMLCADRVPIVRMHVKVR |
| Ga0209847_10184832 | 3300026276 | Permafrost Soil | KSFFDAFAALVGCGHVSGLLMRRVWPLALMLCADRVPIVNTHFKEVR |
| Ga0207761_10229081 | 3300027516 | Tropical Forest Soil | GCGHVSGLLMRRGWPLALMLCADLVPIVHMHLEVR |
| Ga0209116_10207721 | 3300027590 | Forest Soil | RHGKSFFDVGAALVGCGHVSGLLMRQVWPLALMLCADRVPIVNTHF |
| Ga0209517_102734441 | 3300027854 | Peatlands Soil | QELFDVAAALVGCGHVSGLFVRPVWPLAIMLCTDLVPIVSTHFKVR |
| Ga0209701_101099102 | 3300027862 | Vadose Zone Soil | HLGHVSGLLMRQVWPLALMLCADRVPNNRAHLEEVR |
| Ga0209579_102598752 | 3300027869 | Surface Soil | AAALAECGHVSGLLMRRVWPLALMLCADQVPIENTHSLMR |
| Ga0209974_102380782 | 3300027876 | Arabidopsis Thaliana Rhizosphere | FAALVGCGHVSGLLMRRGWPLALMLCADRVPIKNTHFKVR |
| Ga0209698_114036482 | 3300027911 | Watersheds | AALVGCGHVSGLLMRQVWPLALMLCADRVPNKKAHLEDVR |
| Ga0307308_101119221 | 3300028884 | Soil | VAAALVGCGHVSGLLMRQVWPLALMLCADRVPNNRAHLEEVR |
| Ga0134606_102184241 | 3300029827 | Marine Sediment | AAALVGCGHVSGLLMRRMWPLALMLCADRVPIVFTHLEVR |
| Ga0311339_105987462 | 3300029999 | Palsa | LVGCGHVSGLLMRRVWPLALMLCADRVPNKLAHVREVR |
| Ga0302175_100244331 | 3300030014 | Fen | GKSFFDVSAALVGCGHVSGLLMRRVWPLALMLCADRVPIVRLHLEVR |
| Ga0311348_108219931 | 3300030019 | Fen | SFFDVSAALVGCGHVSGLLMRQVWPLALMLCADRVPIVSTHLKVR |
| Ga0302310_102672942 | 3300030737 | Palsa | MVGCGHVSGLLMRRGWPLALMLSADKVPIVRTHSSMR |
| Ga0075386_100625831 | 3300030916 | Soil | QGHSDVRAALVGCGHVSGLLMRQVWPLALMLCADRVPIERLHLEVR |
| Ga0075400_100208421 | 3300030972 | Soil | VGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLEVR |
| Ga0170823_140738722 | 3300031128 | Forest Soil | FAALVGCGHVSGLLVRQVWPLALMLCADRVPIVRMHSKVR |
| Ga0307496_100975491 | 3300031200 | Soil | AALVGCGHVSGLFVRRVRPLALMLCADRVPIKNTHFKVR |
| Ga0170824_1017838862 | 3300031231 | Forest Soil | VLVGCGHVSGLLMRQERPLALMLCADRVPNKIAHSEVR |
| Ga0265330_100504401 | 3300031235 | Rhizosphere | RFAALVRCGHVSGLLMRQVWPLALMLCADRVPNKKAHLEDVR |
| Ga0170820_146663351 | 3300031446 | Forest Soil | CGHVSGLLMRQVRPLALMLCADQISIESAHFVEVR |
| Ga0318516_101884491 | 3300031543 | Soil | ELFYVDAALVGYGHVSGLLMRHGWPLALMLCADQVPILFTHSKMR |
| Ga0318534_101197701 | 3300031544 | Soil | AGLVGCGHVSGLLLRYDGPLALMLCADRVPIVSPHLAVR |
| Ga0318555_102020241 | 3300031640 | Soil | KSFFDVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIESTHSKMR |
| Ga0318561_101196032 | 3300031679 | Soil | KSFFDVDAALVGCGHVSGLLMRHGWPLALMLCADQVPILFTHSKMR |
| Ga0310686_1082826591 | 3300031708 | Soil | GCGHVSGLLLRQGWPLAPMRCADRVPNKNTHLEEVR |
| Ga0310686_1189524342 | 3300031708 | Soil | DATAALVGCGHVSGLLMRRGWPLALMLFADRVPFVFMHLEVR |
| Ga0265314_101431901 | 3300031711 | Rhizosphere | RCGHVSGLLMRQVWPLALMLCADRVPNKKAHLEDVR |
| Ga0307469_109374291 | 3300031720 | Hardwood Forest Soil | WCGHVSGLLMRQVWPLALMLCADRVPIVSPHLEVR |
| Ga0306918_102063261 | 3300031744 | Soil | KSFFDFDAALVGCGHVSGLLMRHGWPLALMLCADQVPIVRTHSKMR |
| Ga0318502_104778821 | 3300031747 | Soil | DVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIESTHSKMR |
| Ga0307477_101887532 | 3300031753 | Hardwood Forest Soil | GKSFFYVSAALVGCGHVSGLLMRRVWPLALMLCADRVPNKLAHFREVR |
| Ga0307475_105065641 | 3300031754 | Hardwood Forest Soil | HGKSFFYVSAALVGCGHVSGLLMRRVWPLALMLCADRVPNKLAHFREVR |
| Ga0307475_110863481 | 3300031754 | Hardwood Forest Soil | ALVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHSKVR |
| Ga0318537_101556071 | 3300031763 | Soil | AALVGCGHVSGLLMRQVWPLALMLCADRVPIVCPHSKVR |
| Ga0318554_105753271 | 3300031765 | Soil | QELSDVSAALVGCGHVSGLLMRQVRPLALMLCADRVPIVCPHSKVR |
| Ga0318529_100988392 | 3300031792 | Soil | ALVGCGHVSGLLVRQVWPLALMLCADRVPIVLLHLKVR |
| Ga0318557_102432071 | 3300031795 | Soil | AEALVGCGHVSGLLMRRGWPLALMLCADLVPIVHMHLEVR |
| Ga0310917_103095991 | 3300031833 | Soil | LVGCGHVSGLLMRPVRPLALMLCADQVPIVYMHLEVR |
| Ga0310917_111869892 | 3300031833 | Soil | HCEVDAGLVGCGHVSGLLLRYDGPLALMLCADRVPIVSPHLAVR |
| Ga0310904_113292002 | 3300031854 | Soil | VGCGHVSGLLMRQVWPLALMLCADRIPIESTHLEVR |
| Ga0306925_104493531 | 3300031890 | Soil | QELSYVDAALVGCGHVSGLLMRHGWPLALMLCADQVPIQSTHSNEMR |
| Ga0310900_102265922 | 3300031908 | Soil | DVRAALVGCGHVSGLLMRQVWPLALMLCADRVPIERLHLEVR |
| Ga0306921_116254092 | 3300031912 | Soil | DAALVGCGHVFGLLMRHGWPLALMLCADQVPILRTHSKMR |
| Ga0310912_106909272 | 3300031941 | Soil | GCGHVSGLLMRQVWPLALMLCADRVPIVCSHLNVR |
| Ga0310913_112351691 | 3300031945 | Soil | VGCGHVSGLLMRRGWPLALMLCADLVPIVHMHLEVR |
| Ga0310913_113105941 | 3300031945 | Soil | LYVDAALVGCGHVSGLLMRHGWPLALMLCADQVPIVR |
| Ga0310909_108694941 | 3300031947 | Soil | LVRCAHVSGLLMRHAWPLALMLFADQVPILSMHSNMG |
| Ga0310909_112375772 | 3300031947 | Soil | DAALVGCGHVSGLLMRHGWPLALMLCADQVPIESTHSKMQ |
| Ga0326597_106593882 | 3300031965 | Soil | VAAALVGCGHVSGLFVRQVWPLALMLCADRVPIVNMHLEVR |
| Ga0310903_100758062 | 3300032000 | Soil | VAATLVGCGHVSGLLMRQVWPLALMLCADRVPIERLHLEVR |
| Ga0310903_100771641 | 3300032000 | Soil | ALVGCGHVSGLLMRRGWPLALMLCADQVPIVHMHLEVR |
| Ga0318556_103485561 | 3300032043 | Soil | FDVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIESTHSKMR |
| Ga0318532_100553611 | 3300032051 | Soil | FYDVDAALVGCGHVSGLLMRHGWPLALMLCADQVPILFTHSKMR |
| Ga0318505_102679632 | 3300032060 | Soil | VGCGHVSGLLMRHGWPLALMLFADQVPIEMAHLAVH |
| Ga0306924_104257751 | 3300032076 | Soil | EHCEVDAGLVGCGHVSGLLLRYDGPLALMLCADRVPIVSPHLAVR |
| Ga0306924_121243302 | 3300032076 | Soil | AALVGCGHVSGLLMRRGWPLALMLFADQVPIVSTHLEVR |
| Ga0307472_1011552702 | 3300032205 | Hardwood Forest Soil | RLAALVGCGHVSGLLMRQVWPLALMLCADRVPIVSPHLEVR |
| Ga0307472_1026406911 | 3300032205 | Hardwood Forest Soil | FAVLVGCGHVSGLLMRQVWPLALMLCADRVPIVRMHLKVR |
| Ga0306920_1008174592 | 3300032261 | Soil | DAALVGCGHVSGLLMQPVWPLALMLCANLVPIELTHLVVR |
| Ga0310812_102606501 | 3300032421 | Soil | QELSDVSAALVGCGHVSGLLMRQVWPLALMLCADWVPIDRMHLKVR |
| Ga0335079_115247571 | 3300032783 | Soil | HGKSFFDVSAALVGCGHVSGLLMRQVWPLALMLCADRVPNKSAHFREVR |
| Ga0310914_109033702 | 3300033289 | Soil | YVDAALVGCGHVSGLLMRRGWPLALMLCADQVPIESTHSKMR |
| Ga0326726_116893871 | 3300033433 | Peat Soil | ALVGYGHVSGLLVRQVWPLALMLCADRVPNKLAHLEGVR |
| Ga0310811_106912722 | 3300033475 | Soil | ELSDVFAALVGCGHVSGLLMRHGWPLALMLCADQVPIVRAHSKMR |
| Ga0316628_1019754321 | 3300033513 | Soil | FDVAAALVGCGHVSGLFVRLGWPLALMLCADRLPIESTHFKVR |
| Ga0316212_10613602 | 3300033547 | Roots | DVGAALVGCGHVSGLLMRPVWPLALMLCADRVPIVNTHF |
| Ga0364935_0162078_582_710 | 3300034151 | Sediment | DVAAALVGCGHVSGLLMRQVWPLALMLCADRVPIVSTHFEVR |
| ⦗Top⦘ |