


| Basic Information | |
|---|---|
| Family ID | F014241 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 264 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MVLLPEGLKALKEVAKEVGLDLRGAYLNLDGGFDSAHNRKC |
| Number of Associated Samples | 185 |
| Number of Associated Scaffolds | 264 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 43.51 % |
| % of genes near scaffold ends (potentially truncated) | 92.80 % |
| % of genes from short scaffolds (< 2000 bps) | 92.42 % |
| Associated GOLD sequencing projects | 172 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.424 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.061 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.621 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 0.00% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 264 Family Scaffolds |
|---|---|---|
| PF13340 | DUF4096 | 61.74 |
| PF13586 | DDE_Tnp_1_2 | 1.89 |
| PF04909 | Amidohydro_2 | 1.52 |
| PF01609 | DDE_Tnp_1 | 1.14 |
| PF01844 | HNH | 1.14 |
| PF13359 | DDE_Tnp_4 | 0.76 |
| PF08388 | GIIM | 0.76 |
| PF01348 | Intron_maturas2 | 0.76 |
| PF00106 | adh_short | 0.38 |
| PF08028 | Acyl-CoA_dh_2 | 0.38 |
| PF00903 | Glyoxalase | 0.38 |
| PF13565 | HTH_32 | 0.38 |
| PF06782 | UPF0236 | 0.38 |
| PF02371 | Transposase_20 | 0.38 |
| PF01832 | Glucosaminidase | 0.38 |
| PF00589 | Phage_integrase | 0.38 |
| PF02668 | TauD | 0.38 |
| PF13551 | HTH_29 | 0.38 |
| PF13613 | HTH_Tnp_4 | 0.38 |
| PF13655 | RVT_N | 0.38 |
| PF13384 | HTH_23 | 0.38 |
| PF00296 | Bac_luciferase | 0.38 |
| PF13424 | TPR_12 | 0.38 |
| PF12762 | DDE_Tnp_IS1595 | 0.38 |
| PF01610 | DDE_Tnp_ISL3 | 0.38 |
| PF13358 | DDE_3 | 0.38 |
| PF11716 | MDMPI_N | 0.38 |
| PF12974 | Phosphonate-bd | 0.38 |
| PF03400 | DDE_Tnp_IS1 | 0.38 |
| PF02899 | Phage_int_SAM_1 | 0.38 |
| PF12759 | HTH_Tnp_IS1 | 0.38 |
| PF11695 | DUF3291 | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 264 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.14 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.14 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.14 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.14 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.14 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.14 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.38 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.38 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.38 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.38 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.38 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.38 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.38 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.42 % |
| Unclassified | root | N/A | 7.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573005|GZGK9D402IVP6Q | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300003203|JGI25406J46586_10103030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300003373|JGI25407J50210_10102971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 705 | Open in IMG/M |
| 3300003911|JGI25405J52794_10008540 | Not Available | 1915 | Open in IMG/M |
| 3300004480|Ga0062592_102701907 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300004798|Ga0058859_11195101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 632 | Open in IMG/M |
| 3300005179|Ga0066684_11105522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia nodosa | 507 | Open in IMG/M |
| 3300005180|Ga0066685_10424078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 924 | Open in IMG/M |
| 3300005184|Ga0066671_10583034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 724 | Open in IMG/M |
| 3300005289|Ga0065704_10818552 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005295|Ga0065707_10917824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 561 | Open in IMG/M |
| 3300005332|Ga0066388_103106606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 848 | Open in IMG/M |
| 3300005332|Ga0066388_106690324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 581 | Open in IMG/M |
| 3300005332|Ga0066388_107265428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300005337|Ga0070682_100736567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300005347|Ga0070668_101680347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300005353|Ga0070669_100317558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1257 | Open in IMG/M |
| 3300005445|Ga0070708_100208191 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300005447|Ga0066689_10221307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1156 | Open in IMG/M |
| 3300005467|Ga0070706_100067888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3297 | Open in IMG/M |
| 3300005467|Ga0070706_100354058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1368 | Open in IMG/M |
| 3300005468|Ga0070707_102134430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 528 | Open in IMG/M |
| 3300005471|Ga0070698_100805043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 884 | Open in IMG/M |
| 3300005518|Ga0070699_100154852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2028 | Open in IMG/M |
| 3300005518|Ga0070699_101505588 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005545|Ga0070695_100294693 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300005549|Ga0070704_100093274 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300005554|Ga0066661_10354148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 899 | Open in IMG/M |
| 3300005558|Ga0066698_10899364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300005559|Ga0066700_10068371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 2244 | Open in IMG/M |
| 3300005559|Ga0066700_10892063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 591 | Open in IMG/M |
| 3300005575|Ga0066702_10500618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 740 | Open in IMG/M |
| 3300005587|Ga0066654_10719446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300005713|Ga0066905_100783012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 826 | Open in IMG/M |
| 3300005713|Ga0066905_101948212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 544 | Open in IMG/M |
| 3300005713|Ga0066905_101961185 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005713|Ga0066905_102291916 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005713|Ga0066905_102312325 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005764|Ga0066903_101334907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1342 | Open in IMG/M |
| 3300005764|Ga0066903_103216191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 883 | Open in IMG/M |
| 3300005764|Ga0066903_103692228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 824 | Open in IMG/M |
| 3300005764|Ga0066903_105431045 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005764|Ga0066903_105768863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 650 | Open in IMG/M |
| 3300005844|Ga0068862_101882938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300005981|Ga0081538_10020787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4818 | Open in IMG/M |
| 3300005981|Ga0081538_10209111 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005981|Ga0081538_10375741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300005985|Ga0081539_10058016 | All Organisms → cellular organisms → Bacteria | 2139 | Open in IMG/M |
| 3300006049|Ga0075417_10553973 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300006796|Ga0066665_11592278 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006844|Ga0075428_102545058 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006845|Ga0075421_101236747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300006845|Ga0075421_102749181 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006847|Ga0075431_100466096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1257 | Open in IMG/M |
| 3300006853|Ga0075420_100714914 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300006853|Ga0075420_100850000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 786 | Open in IMG/M |
| 3300006853|Ga0075420_101880934 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006880|Ga0075429_100116831 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300006880|Ga0075429_100299861 | Not Available | 1407 | Open in IMG/M |
| 3300006880|Ga0075429_100777677 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300006880|Ga0075429_101339311 | Not Available | 624 | Open in IMG/M |
| 3300007258|Ga0099793_10077873 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300007258|Ga0099793_10079248 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300009012|Ga0066710_101965391 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300009012|Ga0066710_102366501 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300009038|Ga0099829_10443121 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300009038|Ga0099829_11463822 | Not Available | 564 | Open in IMG/M |
| 3300009089|Ga0099828_10304018 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300009089|Ga0099828_10724110 | Not Available | 893 | Open in IMG/M |
| 3300009089|Ga0099828_10852361 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300009089|Ga0099828_11533619 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009089|Ga0099828_11900162 | Not Available | 522 | Open in IMG/M |
| 3300009090|Ga0099827_10026142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4146 | Open in IMG/M |
| 3300009090|Ga0099827_10777893 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300009090|Ga0099827_11058304 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009093|Ga0105240_11105540 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300009100|Ga0075418_10689626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1101 | Open in IMG/M |
| 3300009100|Ga0075418_12928507 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300009100|Ga0075418_12956114 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009143|Ga0099792_10415286 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300009147|Ga0114129_10643389 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300009147|Ga0114129_10733529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1266 | Open in IMG/M |
| 3300009156|Ga0111538_11178698 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300009156|Ga0111538_11276355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 927 | Open in IMG/M |
| 3300009156|Ga0111538_13391308 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300009157|Ga0105092_10390227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
| 3300009553|Ga0105249_10482285 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300009553|Ga0105249_12212311 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300009808|Ga0105071_1048513 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300009808|Ga0105071_1114015 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009813|Ga0105057_1061142 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300009821|Ga0105064_1103701 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300010038|Ga0126315_10783993 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300010041|Ga0126312_10644194 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300010046|Ga0126384_10124008 | Not Available | 1948 | Open in IMG/M |
| 3300010046|Ga0126384_10351642 | Not Available | 1228 | Open in IMG/M |
| 3300010047|Ga0126382_10400864 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300010047|Ga0126382_10703131 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300010047|Ga0126382_10741811 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300010047|Ga0126382_12038590 | Not Available | 547 | Open in IMG/M |
| 3300010047|Ga0126382_12184136 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010048|Ga0126373_10618897 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300010048|Ga0126373_11773082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300010124|Ga0127498_1074664 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300010145|Ga0126321_1002070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1210 | Open in IMG/M |
| 3300010320|Ga0134109_10400611 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010323|Ga0134086_10174389 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300010333|Ga0134080_10407629 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010359|Ga0126376_11099693 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300010359|Ga0126376_11503201 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300010362|Ga0126377_10730494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
| 3300010362|Ga0126377_11577120 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300010362|Ga0126377_12298811 | Not Available | 615 | Open in IMG/M |
| 3300010362|Ga0126377_12324517 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010362|Ga0126377_12495503 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010362|Ga0126377_13218145 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010362|Ga0126377_13390276 | Not Available | 515 | Open in IMG/M |
| 3300010362|Ga0126377_13594321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300010366|Ga0126379_10467644 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300010366|Ga0126379_12249088 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300010366|Ga0126379_12273937 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010398|Ga0126383_10616880 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300010398|Ga0126383_12297966 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010398|Ga0126383_12661700 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300010399|Ga0134127_11728078 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300011269|Ga0137392_11470117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Candidatus Paracaedibacteraceae → Candidatus Paracaedibacter → Candidatus Paracaedibacter symbiosus | 540 | Open in IMG/M |
| 3300011270|Ga0137391_10040475 | All Organisms → cellular organisms → Bacteria | 3948 | Open in IMG/M |
| 3300011270|Ga0137391_10131881 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300011423|Ga0137436_1126805 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300011435|Ga0137426_1171205 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012041|Ga0137430_1103727 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300012096|Ga0137389_10989893 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012189|Ga0137388_10746797 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300012204|Ga0137374_11104249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 564 | Open in IMG/M |
| 3300012205|Ga0137362_10405504 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300012205|Ga0137362_10588703 | Not Available | 960 | Open in IMG/M |
| 3300012205|Ga0137362_10659628 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300012207|Ga0137381_11647824 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012207|Ga0137381_11701425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 521 | Open in IMG/M |
| 3300012209|Ga0137379_11601279 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012211|Ga0137377_10115134 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300012211|Ga0137377_11908614 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012354|Ga0137366_10017180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 5668 | Open in IMG/M |
| 3300012355|Ga0137369_10164246 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300012355|Ga0137369_10528081 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300012357|Ga0137384_11053477 | Not Available | 653 | Open in IMG/M |
| 3300012358|Ga0137368_10871294 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012361|Ga0137360_10208266 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300012363|Ga0137390_11494089 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300012402|Ga0134059_1051686 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012477|Ga0157336_1000139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2994 | Open in IMG/M |
| 3300012477|Ga0157336_1013277 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012477|Ga0157336_1028362 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012483|Ga0157337_1009022 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012505|Ga0157339_1011935 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012509|Ga0157334_1027003 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012514|Ga0157330_1020568 | Not Available | 750 | Open in IMG/M |
| 3300012582|Ga0137358_10692894 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012672|Ga0137317_1027192 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012896|Ga0157303_10077252 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300012908|Ga0157286_10050543 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300012918|Ga0137396_10435108 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012922|Ga0137394_10551210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 977 | Open in IMG/M |
| 3300012922|Ga0137394_11593464 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012927|Ga0137416_10756306 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012929|Ga0137404_10429057 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300012929|Ga0137404_11467445 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012930|Ga0137407_10099573 | Not Available | 2489 | Open in IMG/M |
| 3300012930|Ga0137407_10386513 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300012930|Ga0137407_11200285 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012944|Ga0137410_11031330 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012948|Ga0126375_10430779 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300012948|Ga0126375_10434928 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300012948|Ga0126375_11968677 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012971|Ga0126369_11146183 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300012971|Ga0126369_13361060 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300013306|Ga0163162_10083863 | All Organisms → cellular organisms → Bacteria | 3261 | Open in IMG/M |
| 3300013306|Ga0163162_10950562 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300013306|Ga0163162_12845769 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300014150|Ga0134081_10124527 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300014968|Ga0157379_11286426 | Not Available | 706 | Open in IMG/M |
| 3300015053|Ga0137405_1052076 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300015053|Ga0137405_1317147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3437 | Open in IMG/M |
| 3300015054|Ga0137420_1174514 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300015264|Ga0137403_10092861 | All Organisms → cellular organisms → Bacteria | 3033 | Open in IMG/M |
| 3300015359|Ga0134085_10243843 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300015373|Ga0132257_103049571 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300016270|Ga0182036_11026800 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300016294|Ga0182041_10299919 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300016422|Ga0182039_10635199 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300016422|Ga0182039_11904912 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300017792|Ga0163161_12026046 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300017965|Ga0190266_11209568 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300017997|Ga0184610_1032961 | Not Available | 1464 | Open in IMG/M |
| 3300018076|Ga0184609_10235440 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300018082|Ga0184639_10302223 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300018433|Ga0066667_10607693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 912 | Open in IMG/M |
| 3300018465|Ga0190269_11569618 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300018466|Ga0190268_10454727 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300018468|Ga0066662_10925793 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300019259|Ga0184646_1364116 | Not Available | 1182 | Open in IMG/M |
| 3300020170|Ga0179594_10089175 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300021476|Ga0187846_10195773 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300021560|Ga0126371_11440642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
| 3300025900|Ga0207710_10607508 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300025917|Ga0207660_10806952 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300025919|Ga0207657_10880400 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300025922|Ga0207646_11382936 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300025931|Ga0207644_11406978 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300025939|Ga0207665_11030505 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300025961|Ga0207712_10929789 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300026035|Ga0207703_10970943 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300026035|Ga0207703_11322464 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300026116|Ga0207674_10198801 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300026142|Ga0207698_11267886 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300026300|Ga0209027_1191027 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300026310|Ga0209239_1066080 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300026332|Ga0209803_1229707 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300026351|Ga0257170_1020330 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300026377|Ga0257171_1083003 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300027032|Ga0209877_1026266 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300027169|Ga0209897_1065952 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300027332|Ga0209861_1067520 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027379|Ga0209842_1052957 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300027560|Ga0207981_1062953 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300027577|Ga0209874_1058983 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300027655|Ga0209388_1100687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 829 | Open in IMG/M |
| 3300027846|Ga0209180_10446849 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300027873|Ga0209814_10107286 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300027875|Ga0209283_10786552 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300027907|Ga0207428_10722502 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300027909|Ga0209382_10186363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2385 | Open in IMG/M |
| 3300028596|Ga0247821_11177803 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300028716|Ga0307311_10193642 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300028803|Ga0307281_10250312 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300028884|Ga0307308_10438003 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300030546|Ga0247646_1112345 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300031092|Ga0308204_10131176 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300031093|Ga0308197_10080644 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031094|Ga0308199_1110829 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031094|Ga0308199_1140869 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031114|Ga0308187_10115408 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031226|Ga0307497_10602110 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031424|Ga0308179_1048103 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031547|Ga0310887_10411505 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031720|Ga0307469_11268267 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300031793|Ga0318548_10637271 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031824|Ga0307413_10950357 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300031890|Ga0306925_12017790 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031912|Ga0306921_10416787 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300031913|Ga0310891_10099007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 893 | Open in IMG/M |
| 3300032002|Ga0307416_100527492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1250 | Open in IMG/M |
| 3300032002|Ga0307416_100932127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 970 | Open in IMG/M |
| 3300032068|Ga0318553_10575561 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300032090|Ga0318518_10726708 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300032174|Ga0307470_11060382 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300032180|Ga0307471_102171326 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300032205|Ga0307472_101848748 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300033290|Ga0318519_10873634 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300033551|Ga0247830_11111353 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300033551|Ga0247830_11149961 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300034681|Ga0370546_041824 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.14% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.14% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.14% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.38% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.38% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.38% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.38% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.38% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.38% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573005 | Grass soil microbial communities from Rothamsted Park, UK - FG3 (Nitrogen) | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012672 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030546 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG3_09407390 | 2189573005 | Grass Soil | VAPVNETDMTLLPESLKALKQVAKQVGLDLRGAYLNLRVVPQ |
| JGI25406J46586_101030303 | 3300003203 | Tabebuia Heterophylla Rhizosphere | VAPVNATDMVLFPEGLKALKQVAKVAGVDLRGAYLNLDGGFDSARHRKCI |
| JGI25407J50210_101029711 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MILLPQGLKALKQVAKQVELDLRGAYLNLDGGFDSTHNRKCIFNAGLI |
| JGI25405J52794_100085403 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MILVPQGLKALKQVVTQVGADLRGASLNPAGGCDAARQPCSR |
| Ga0062592_1027019072 | 3300004480 | Soil | MALLPKGLHALKHVAKEVGLDLRGAYLNLDGGFDSAHNWKCMFNGEHGSGSHE |
| Ga0058859_111951012 | 3300004798 | Host-Associated | VAPVNETDMVLLPQGLKALKQVAKQVGLDLRGAYLNLDGGFDS |
| Ga0066684_111055221 | 3300005179 | Soil | VAPVNETDMVLLPQSLQALKKVAKEVGLDLRGAYVNLDGGFDS |
| Ga0066685_104240781 | 3300005180 | Soil | MVLLPESLQALKKVAKEVGLDLRGAYLNLDGGFDSAHNRKCI |
| Ga0066671_105830342 | 3300005184 | Soil | MVLFPEGLKALKKVAKEVGLDLRGAYLNLDGGFDSARNRK |
| Ga0065704_108185522 | 3300005289 | Switchgrass Rhizosphere | MVLFPEGLQALKQVAKEVGVDLRGAYLNLDGGFDSAHNRKCIFN |
| Ga0065707_109178241 | 3300005295 | Switchgrass Rhizosphere | MVLLPDGLKALKRVAKEVGLDLRGAYLNLDGGFDSAHNRKCIF |
| Ga0066388_1031066063 | 3300005332 | Tropical Forest Soil | MVLLPKSLQALKQVAKEVGLDLRGASLNLDGGFDSARNRKCIF |
| Ga0066388_1066903242 | 3300005332 | Tropical Forest Soil | VAPANETDMVLLPEGLKALTKVAKEVGVDLRGAYLNLDGG |
| Ga0066388_1072654281 | 3300005332 | Tropical Forest Soil | MVLLPQGLHALKQVAKEVGVDLRGAYLNLDGGFDSTRNRKCIFN |
| Ga0070682_1007365672 | 3300005337 | Corn Rhizosphere | MILFPEGLKALKQVAKEVGFDLKGAYLNLDGGFDSARNRKCIFNAGLIPN |
| Ga0070668_1016803471 | 3300005347 | Switchgrass Rhizosphere | MVLFPEGLKALKEVAKEIGLDLRGAYLNLDGGFDSTRNRKC |
| Ga0070669_1003175581 | 3300005353 | Switchgrass Rhizosphere | MVLLPEGLKALKQVAKEVEVDLRGAYLNLDGGFDSRHNRKLIFNAGLI |
| Ga0070708_1002081913 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLLPDGLKALKRVAKEVGLDLKGAYLNLDGGFDSTHNHKCIFNAGLIP |
| Ga0066689_102213074 | 3300005447 | Soil | MVLLPESLKALKKVAKEVGVDLRGAYLNLDGGSDSAHNRKCIFN |
| Ga0070706_1000678885 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLLPESLHALKQVAKEVGLDLRGAYLNLDGGFDAIANRK |
| Ga0070706_1003540583 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLFPEGLKALKQVAKQVGLDVRGAYLNLDGGFDSAHNRK |
| Ga0070707_1021344301 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPVNETDMVLLPEGLKALKKVAKEVGIDLRGAYLNLDGG |
| Ga0070698_1008050431 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLLPQGLKALKQVAKQVGLDLRGAYLNLDGGFDSAHNRKCI |
| Ga0070699_1001548521 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPVNETDMVLFPEGLHALKQGAKEVGLDLKGAYLNLDGGFDSARNR |
| Ga0070699_1015055881 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLLPEGLQALKRVAKTVGLTLTGAYLNLDAGFDSTHHRKC |
| Ga0070695_1002946931 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLLPEGLKALKEVAKEVGLDLRGAYLNLDGGFDSAHNRKC |
| Ga0070704_1000932741 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | GLHALKRVAKEVGVDLHGAYLNLDGGFDSTHNRKCIRHYRE* |
| Ga0070704_1004774792 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | APVNEIDTVLLPGALKALKRIGKQTGLSFKGAYFNLDGGFDSASNRKAIGSIR* |
| Ga0066661_103541483 | 3300005554 | Soil | MVLLPEGLKALKKVATEVGLDLRGAYLNLDGGFDSTRNRKCMFN |
| Ga0066698_108993642 | 3300005558 | Soil | MVLFPEGLKALKDMAKEVGLDLRGAYVNLDGGFDSAHNRKCIFNAGM |
| Ga0066700_100683714 | 3300005559 | Soil | VAPVNATDMVLLPEGLKALKEVAKEVGLDLRGAYLNLDGGFD |
| Ga0066700_108920631 | 3300005559 | Soil | MVLFPEGLKALKDVAKEVELDLRGAYFNLDGGFDSAHNRKCIFNAGMIP |
| Ga0066702_105006182 | 3300005575 | Soil | VAPVNETDMVLLPQGLHALKPVAKKVGVDLRGAYLNLDGGFDSARNRKMIFNA |
| Ga0066654_107194461 | 3300005587 | Soil | MVLLPEGLKALKKVAKEVGLDLRGAYLNLDGGFDSA |
| Ga0066905_1007830122 | 3300005713 | Tropical Forest Soil | MVLLPEGLKALKRVAKTVGLTLTGAYLNLDAGFDSTHNRKCIFN |
| Ga0066905_1019482121 | 3300005713 | Tropical Forest Soil | MVLLPEGLKALKDVAKEVGVDLRGAYLNLDGGFDSARNRKCIFNAGL |
| Ga0066905_1019611851 | 3300005713 | Tropical Forest Soil | MGLLPEGLQALKQVATEVGVDLRGASLNLDGGVDSAHHRQGIFKAGRLPNLKEH |
| Ga0066905_1022919162 | 3300005713 | Tropical Forest Soil | VAPINETDMVLFPEGLHALKQVATEVGWDRRGADLNR |
| Ga0066905_1023123251 | 3300005713 | Tropical Forest Soil | VAPVHETDMVLFPDGLKALKHVATEVGLDLRDAYVNLDGG |
| Ga0066903_1013349072 | 3300005764 | Tropical Forest Soil | VAPVNETDMVLLPEGLKALKKVAKEVGVDLRGAYLNLDGGFDSARNRKCIFNQRPA* |
| Ga0066903_1032161913 | 3300005764 | Tropical Forest Soil | MVLLPQGLKALKQVAKQVGLDLRGAYLNLDGGFDSAHNRKCIFNAG |
| Ga0066903_1036922283 | 3300005764 | Tropical Forest Soil | VAPVNATDMVLFPEGLKALKQVAKEVGVDLRGAYLNLDGGFDSAHNR |
| Ga0066903_1054310452 | 3300005764 | Tropical Forest Soil | VAPVNETDMVLFPQGLNALKQVAKQVGLDLRGAYLNLDGGFDSAHNRKCIFNWLL* |
| Ga0066903_1057688632 | 3300005764 | Tropical Forest Soil | MVLLPEGLKALKRVAKEVGLDLRGAYLNLDGGFDSAHNRKCIFNA |
| Ga0068862_1018829382 | 3300005844 | Switchgrass Rhizosphere | MALFPEGLKALKQGAKEVGLDLRGAYLNLDGGFDSKANRKA |
| Ga0081538_100207875 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MALLPEGLNALKRIANTVGLTRTGAYLHLNAGFDSTHNRKDIFN |
| Ga0081538_102091113 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VAPVNETDMVLLPRGLKALKQVAKEVGMDLRGALLNFDGG |
| Ga0081538_103757411 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MAPVNETDMVLLPKGLNALKQVAKEVGLDLRGAYVNLDSGFDSRANRRYSPGNTLRK* |
| Ga0081539_100580162 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VAPVNETDMVLFPEGLKALKKVATEVGVDLRGAYLNLDGGFDSARNRK* |
| Ga0075417_105539731 | 3300006049 | Populus Rhizosphere | MVLFPEGLKALKKVAKEVGLDLREAYLNLDGGFDS |
| Ga0066665_115922782 | 3300006796 | Soil | VAPVNETDMVLLPEGLKALKKVATEVGLDLRGAYL |
| Ga0075428_1025450581 | 3300006844 | Populus Rhizosphere | MLLFPESLKALKRVAKEVGLDLRGAYLNLDGGFDSAHNRKCIFN |
| Ga0075421_1012367471 | 3300006845 | Populus Rhizosphere | VAPVNETDMVLLPEGLKALKDVAKEVGLDLRGAYLNLDGGFDSAHN |
| Ga0075421_1027491812 | 3300006845 | Populus Rhizosphere | MVLLPEGLKALKRVAKEVGVDLRGAYLNLDGGFDSTHN |
| Ga0075431_1004660961 | 3300006847 | Populus Rhizosphere | VAPVNETDIVLFPEGLKALKKVAKEVGLDLRGAYVNL |
| Ga0075420_1007149141 | 3300006853 | Populus Rhizosphere | MVLFPEGLHALKQVAKEVRVDLRGAYFNLDGGFDSARNRKMIFNAG |
| Ga0075420_1008500001 | 3300006853 | Populus Rhizosphere | MVLFPEGLKALKQVARAVGLDLRGAYLNLDGGFDS |
| Ga0075420_1018809341 | 3300006853 | Populus Rhizosphere | MLLFPESLKALKRVAKEVGLDLRGAYLNLDGGFDS |
| Ga0075429_1001168311 | 3300006880 | Populus Rhizosphere | MVLLPQGLKALKQVAKQVGLDLTGAYLNLDGGFDSAH |
| Ga0075429_1002998611 | 3300006880 | Populus Rhizosphere | MFSRKRDYSLKALQVGKQTGLSFKGASIHLDGGFDSASNRKAIFNA |
| Ga0075429_1007776771 | 3300006880 | Populus Rhizosphere | VAPVNETDLVLLPQGLHALKQVAKQVGLDLTGAYLNLDGG |
| Ga0075429_1013393111 | 3300006880 | Populus Rhizosphere | MVLFPEGLKGLKRVAKEVGVDLRGAYLNLDGGLDSARNRKCIFNAGLIP |
| Ga0099793_100778733 | 3300007258 | Vadose Zone Soil | VAPVNETDMVLLPEGLQALKEVAKEVGLDLRGAYLNLDGGFDSTHN |
| Ga0099793_100792483 | 3300007258 | Vadose Zone Soil | MILLPKGLKALQQVAKQVGLDLRGAYLNLDGGFDS |
| Ga0066710_1019653913 | 3300009012 | Grasslands Soil | MVLLPDGLKALKKVAKQVSLDLRDAYVNLDAGFDSTYNRKCIFN |
| Ga0066710_1023665011 | 3300009012 | Grasslands Soil | MVLLPQGLKALKEVAKQVGLDVRGAYLNLDGGFDSAHNRKCIFNA |
| Ga0099829_104431212 | 3300009038 | Vadose Zone Soil | VAPVNATAMALLPEGLQALQQGAKEVGFDLRGASLNLDGGFDSTRN |
| Ga0099829_114638221 | 3300009038 | Vadose Zone Soil | VNETDMVLFPEGLKALKQVAKKVGLNLKGAYINLDGGFDSKHNWKMISMLG* |
| Ga0099828_103040182 | 3300009089 | Vadose Zone Soil | MDMVLLPQGLQALKQVAKQVGFDLRGAYLNLDGGFDSTRNRKCIF |
| Ga0099828_107241102 | 3300009089 | Vadose Zone Soil | PKSLHALKQVAKEVGLDVRGAYLNLDGGFDSAPAIPGGR* |
| Ga0099828_108523611 | 3300009089 | Vadose Zone Soil | MVLLPEGLQALKQVAKQVGLDLRGAYLNLDGGCDFAHNRKC |
| Ga0099828_115336192 | 3300009089 | Vadose Zone Soil | MMLFPEGLHALKQVAKEVGLDLKGAYLNLDGGFDSAR |
| Ga0099828_119001621 | 3300009089 | Vadose Zone Soil | MVLLPEGLKALKKVAKKVGLALRGAYLNPDAGFDSTHN |
| Ga0099827_100261426 | 3300009090 | Vadose Zone Soil | VAPVNETDMVLFPEGLKALKEVAKEVGLDLRGAYLNLDGGFDS |
| Ga0099827_107778931 | 3300009090 | Vadose Zone Soil | MVLFPEGLKALKQVAKKVGLNLKGAYINLDGGFDSKHNWKMI |
| Ga0099827_110583042 | 3300009090 | Vadose Zone Soil | MVLFPEGLQALKQVAKQVGLDLRGAYVNLDGGFDSTY |
| Ga0105240_111055403 | 3300009093 | Corn Rhizosphere | MVLFPEGLKALKEVAKEIELDLRGAYLNLDGGFDAAHNR |
| Ga0075418_106896262 | 3300009100 | Populus Rhizosphere | MVLFLEGLKALKQVAKEVGVDLRGAYLNLDGGFDSIANRKCIFNAG |
| Ga0075418_129285071 | 3300009100 | Populus Rhizosphere | MVLLPESLHALKQVAKEVGLDLRGAYLNLDGGFDSAHNRKC |
| Ga0075418_129561141 | 3300009100 | Populus Rhizosphere | VAPVNETDMVLLAEGLKALKKVAKEVGLDLRGAYLNLDGGFD |
| Ga0099792_104152861 | 3300009143 | Vadose Zone Soil | MVLLPEGLQALKKVAKEVGVDLRGAYLNLDGGFDSAHNRKC |
| Ga0114129_106433893 | 3300009147 | Populus Rhizosphere | MVLLPEGLKALKDVAKEVGLDLRGAYLNLDGGFDSAHNRKCIF |
| Ga0114129_107335293 | 3300009147 | Populus Rhizosphere | VAPVNETDMVLLPEGLKALKQVAKEVGVDLRGASLNLDGGFDSRHNRKCIFNAGLIP |
| Ga0111538_111786983 | 3300009156 | Populus Rhizosphere | VAPVNETDMVLYPESLKALKKVAKEVGVDLCGAYINLDGGFDSA |
| Ga0111538_112763551 | 3300009156 | Populus Rhizosphere | VAPVNETDMVLFPEGLKALKKVAKEVGLDLRGAYLNLDGGFDSARNRKCIF |
| Ga0111538_133913082 | 3300009156 | Populus Rhizosphere | VAPVNETAMVLFPEGLKALKKVAKEVGLDLRGAYLNLDGGFDSA |
| Ga0105092_103902272 | 3300009157 | Freshwater Sediment | VNEADMVLLPKGLQALKKVAKQVGVDLRGAYINLDGGFDSTHNRKRSSMRG* |
| Ga0105249_104822851 | 3300009553 | Switchgrass Rhizosphere | VAPVNETAMVLLPEGLQALKQVAKEVGLDLRGAYLNLDGGFDSAHH |
| Ga0105249_122123112 | 3300009553 | Switchgrass Rhizosphere | VAPVNETDMVLLPEGLKALKQVAKEVGVDLRGAYLNLDGGFDSRHNRKLIFNAG |
| Ga0105071_10485132 | 3300009808 | Groundwater Sand | MVLLPQGLKALKQVAKQVGADVRGAYLNLDGGFDSARNRQCMFNAGLIPNIK |
| Ga0105071_11140152 | 3300009808 | Groundwater Sand | MILLPQGRKALKQVAKQVGADLRGASLNLDGGFAS |
| Ga0105057_10611421 | 3300009813 | Groundwater Sand | VAPVNETDIVLLPESLKALKQVATEVGLDLKGACLNLDGGF |
| Ga0105064_11037012 | 3300009821 | Groundwater Sand | VNETDMVLFPEGLHALKQVAKEVGLDLKGAYLNLDGGFDSARNRKCIF |
| Ga0126315_107839932 | 3300010038 | Serpentine Soil | MVLLPEGLQALKRVAKTVGLTLTGAYLNLDAGFDSTHNRTCMFN |
| Ga0126312_106441941 | 3300010041 | Serpentine Soil | MVLLPEGLQALKKMATEVGVDLRGAYLNLDGGFDSAHN |
| Ga0126384_101240082 | 3300010046 | Tropical Forest Soil | MLLLPDSLNALKQAAKMTGLVLTGAYRNLDSGFDSTHNR* |
| Ga0126384_103516421 | 3300010046 | Tropical Forest Soil | VNDTDLGLLLKGVKALKKVAKQVGLDLRGAYRNLD |
| Ga0126382_104008642 | 3300010047 | Tropical Forest Soil | MVLLPERLKVLKRVVKTVGLTLTGASLNLDAGFDAT |
| Ga0126382_107031313 | 3300010047 | Tropical Forest Soil | MILLPEGLKALKRVAKTVGLDLGGAYLNLDAGFDSTHNR |
| Ga0126382_107418112 | 3300010047 | Tropical Forest Soil | MVLLPESLKALKRVAKMVGLDLRGAYLNLDAGFDSTHNR |
| Ga0126382_120385901 | 3300010047 | Tropical Forest Soil | MAPVNTADMGLLPEGLRSLKLVAKTVGLTRTGAYLNLDSGFDSTHH |
| Ga0126382_121841361 | 3300010047 | Tropical Forest Soil | LKALKEVAKEVGLDLRGAYLNLDGGFDSAHNRKCIFNAG |
| Ga0126373_106188973 | 3300010048 | Tropical Forest Soil | MVLFPEGLKALKKVAKEVGLDLKGAYLNLDGGFDSAHNRTCIFNA |
| Ga0126373_117730822 | 3300010048 | Tropical Forest Soil | MILLPEGLQALKKVAKEVGVDLRGAYLNLDGGFDSAHNR |
| Ga0127498_10746642 | 3300010124 | Grasslands Soil | MVLLPEGLKALKEVAKEVGLDLRGAYVNLDGGFDSTRNRKMIF |
| Ga0126321_10020701 | 3300010145 | Soil | MAPVNETDMVLLPQGLKALKKVAKEVGLDLRGAYLNLDGGFDSAHNRKC |
| Ga0134109_104006111 | 3300010320 | Grasslands Soil | MVLLPEGLHALKQMAKEGGLDLRGAYLNLDGGFDSAHNRK |
| Ga0134086_101743891 | 3300010323 | Grasslands Soil | VAPVNETDMVLLPEGLQALKQVAKEVGVDLRGAYLNLDGGFDSTRNRNCIFNA |
| Ga0134080_104076292 | 3300010333 | Grasslands Soil | MVLLPESLQALKKVAKEVGVDLRGAYLNLDGGFDTAHNRKCIFNAGLI |
| Ga0126376_110996933 | 3300010359 | Tropical Forest Soil | MVLLPEGLRALKKVAKEVGLDLRGAYLNLDGGFDSAHNRKCIFNAG |
| Ga0126376_115032012 | 3300010359 | Tropical Forest Soil | MVLLPEGLKALKKVAKEVGLDLRGAYLNLDGGFDSARNRKCINWLRVYK* |
| Ga0126377_107304941 | 3300010362 | Tropical Forest Soil | VNETDMVLLLESLKALKGVAKTVGLTLTGAYLNLDAGFDSTHNRKC |
| Ga0126377_115771202 | 3300010362 | Tropical Forest Soil | MVLLPDGLNALKRVAKVTGLVLTGAYLNLDAGFDSTHHRTCMF |
| Ga0126377_122988111 | 3300010362 | Tropical Forest Soil | VAPVNETDLRLVPEGLHALQPMAKEGGWALRGASFNLH |
| Ga0126377_123245171 | 3300010362 | Tropical Forest Soil | VAPVNETDMLLFPEGLKALKQVAKQAGVDLKGAYLNLDGGFDSAHNRKCIFNAG |
| Ga0126377_124955031 | 3300010362 | Tropical Forest Soil | VNETDMVLFPDGLKALKRVAKMTGLVLTGAYLNLDSGF |
| Ga0126377_132181451 | 3300010362 | Tropical Forest Soil | MMLLPQSLQALKQVAKEVGVDLRGAYLNLDGGFDSTRNRKCIFN |
| Ga0126377_133902762 | 3300010362 | Tropical Forest Soil | MILVPQGLQALKQVATQVGADLRDASLNLDGGCVGRQPCTP |
| Ga0126377_135943211 | 3300010362 | Tropical Forest Soil | VAPVNETDMVLLPEGLQALKQVAKEVGVDLRGAYLNLDGGFDSRHNRKCIFNAGLIPN |
| Ga0126379_104676443 | 3300010366 | Tropical Forest Soil | MVLLPKGLKALKQVATEVGVDLRDAYLNLDGGFDSIANRKSIF |
| Ga0126379_122490882 | 3300010366 | Tropical Forest Soil | MVLFPEGLKALKKVAKEVGLDLRGAYLNLDGGFDSA |
| Ga0126379_122739371 | 3300010366 | Tropical Forest Soil | MVLLPKGLKALKQVAKEVGLDLRGAYVNLDGGFDSRANRKCI |
| Ga0126383_106168801 | 3300010398 | Tropical Forest Soil | MILFPEGLHALKQVAKEVGLDLRGAYFNLDGGFDSARNRKMI |
| Ga0126383_122979663 | 3300010398 | Tropical Forest Soil | MILLPEGLKALKRVAKTVGLDLGGAYLNLDAGFDSTHNRKC |
| Ga0126383_126617001 | 3300010398 | Tropical Forest Soil | MVLFPEGLQALKRGAKEVGVDLKGASLNLDGGFDAAHNRKGIFNAGLMPNIK |
| Ga0134127_117280782 | 3300010399 | Terrestrial Soil | MALFPEGLKALKQGAKEVGLDLRGAYLNLDGGFDSK |
| Ga0137392_114701171 | 3300011269 | Vadose Zone Soil | TDMVLLPEGLKALKKVAKEVGLDLKGAYLNLGRL* |
| Ga0137391_100404751 | 3300011270 | Vadose Zone Soil | MILLPQGLKALKQMAKEVGLDLRGAYLNLDGGFDSARNRK |
| Ga0137391_101318812 | 3300011270 | Vadose Zone Soil | MVLLPKGLNALKKVAKQVGLDLRGAYFNLDGGFDST |
| Ga0137436_11268052 | 3300011423 | Soil | MVLLPQSLKALKQVAKQVGLDLRGAYRNLDGGFDST |
| Ga0137426_11712051 | 3300011435 | Soil | MVLLPDALKALKQVTKEVGLDLRGAHLNLDGGFDSPHNRK |
| Ga0137430_11037273 | 3300012041 | Soil | VAPVNETEMVLLPKGLHALKQVAKKVGLDLRGAYLNLDG |
| Ga0137389_109898932 | 3300012096 | Vadose Zone Soil | VAPVNETDMVLLPESLQALKKVAKEVGVDLRGAYLNLDGGFDSAHNR |
| Ga0137388_107467972 | 3300012189 | Vadose Zone Soil | VAPVNETDMVLLPEGLKALKEVAKEVGLDLRGAYLNLDGGFDSAHNR |
| Ga0137383_108923781 | 3300012199 | Vadose Zone Soil | KALKEVAKEVGLDFRGAYLNLDGGFDSTRNRKCIFDAGLIPNIR* |
| Ga0137374_111042492 | 3300012204 | Vadose Zone Soil | MVLLPESLQALKKVAKEVGLDLRGAYLNLDGGFDSAHNRKCIFNA |
| Ga0137362_104055043 | 3300012205 | Vadose Zone Soil | MVLLPQGLHALKQVAKEVGLDVRGAYFNLDGGFDSAHHR |
| Ga0137362_105887032 | 3300012205 | Vadose Zone Soil | MVLLPQGLKALKQVAKQVGLDLTGAYLNLDGGFDSAHNR |
| Ga0137362_106596282 | 3300012205 | Vadose Zone Soil | VNETDMVLLPDGLKALKRVAKEVGLDLKGAYLNLDGGFDSA |
| Ga0137381_116478242 | 3300012207 | Vadose Zone Soil | MVLLPKGWHALKQVAKKVGVDLRGAYLNLDGGFDAARNRKCIFNAEM |
| Ga0137381_117014251 | 3300012207 | Vadose Zone Soil | VAPVNETDTVLFPEGLKALKQVAKEVGLGLRGAYLKPRWRL |
| Ga0137379_116012792 | 3300012209 | Vadose Zone Soil | MVLLPQSLQALKQVAKQVGLDLKGAYLNLDGGFDSA |
| Ga0137377_101151341 | 3300012211 | Vadose Zone Soil | MVLLPESLKALKRVAKEAGLDLRGAYLNLDGGFDSAHN |
| Ga0137377_119086141 | 3300012211 | Vadose Zone Soil | VAPVNETDMVLLPEGLQALKKVAKEVGLDLRGAYLNLDGG |
| Ga0137366_100171808 | 3300012354 | Vadose Zone Soil | MLLPQGLKALKQVGKQVGLDLRGAYLNLDGGFDSAHNRKCIFN |
| Ga0137369_101642461 | 3300012355 | Vadose Zone Soil | MILLPQGLNALKKVAKQVGLDLRGAYLNLDGGFDSGHNRKCIFNA |
| Ga0137369_105280813 | 3300012355 | Vadose Zone Soil | VAPVNETDMVLFPESLKALKEVAKEVGLDLKGAYLNLDGGFDSTRNRKMIFN |
| Ga0137384_110534772 | 3300012357 | Vadose Zone Soil | MVLLPKGLQALKQVAKKVDLDLRGAYLNLDGGFDSARNRKMIF |
| Ga0137368_108712942 | 3300012358 | Vadose Zone Soil | MASVNETDMVLLPEGLKALKKVAKKVSLDLRGAYLNLDGGFDSAHNRKRIF |
| Ga0137360_102082661 | 3300012361 | Vadose Zone Soil | VAPVNETDMVLFPEGLKALKDVAKEVGLDLRGAYLNLDGGFD |
| Ga0137390_114940891 | 3300012363 | Vadose Zone Soil | MVLLPDGLKALKRVAKEVGLDLKGAYLNLDGGFDAAHN |
| Ga0134059_10516861 | 3300012402 | Grasslands Soil | VALVNETDMVLLPEGLKALKKVAKEVGIDLRGTYLNLD |
| Ga0157336_10001391 | 3300012477 | Arabidopsis Rhizosphere | MVLLPEGLKALKRVATEVGLDLRGAYLNLDGGFDSARNRKCI |
| Ga0157336_10132771 | 3300012477 | Arabidopsis Rhizosphere | VAPVNETDMVLVPESLKALKEVAKEVGLDLKGAYLNLD |
| Ga0157336_10283622 | 3300012477 | Arabidopsis Rhizosphere | VAPVNETDMVLLPQGLNALKHVAKQVGLDLRGAYLNLDGGFDSA |
| Ga0157337_10090221 | 3300012483 | Arabidopsis Rhizosphere | MVLLPESLHALKQVAKEVGLDLRGAYLNLDGGFDSAHNRKCIFNAG |
| Ga0157339_10119353 | 3300012505 | Arabidopsis Rhizosphere | MVLLPEGLKALKRVATEVGLDLRGAYLNLDGGFDSA |
| Ga0157334_10270031 | 3300012509 | Soil | MVLLPEGLKALKQVAKEVGLDLRGAYLNLDGGFDST |
| Ga0157330_10205682 | 3300012514 | Soil | MVLLPEGLHALKQVAQEVGLDLRGAYLNLDGGFDSARNRKCIFNAGLSLISPRIP |
| Ga0137358_106928941 | 3300012582 | Vadose Zone Soil | MILLPEGLKALKRVAKTVGLDLGGAYLNLDAGFDSTHN |
| Ga0137317_10271921 | 3300012672 | Soil | VAPVNETDMVLLPEGLQALKKVAKEVGVDLRGAYLNLDGGFDSVHNRKCIFNAGLIPNIP |
| Ga0157303_100772523 | 3300012896 | Soil | VAPVNKADVVLFPESLQALKKVAKEVGLDLRGAYLNLDGGFDSIRNRKMGDVSIQLIL |
| Ga0157286_100505431 | 3300012908 | Soil | MVLFPEGLKALKKVAKEVRLDLRGAYLNLDGGFDSARNRKCI |
| Ga0137396_104351081 | 3300012918 | Vadose Zone Soil | VAPVNETDMVLLPEGLQALKQMAKEVGVDLRGASLNLDGGFDSRHNRKCIF |
| Ga0137394_105512102 | 3300012922 | Vadose Zone Soil | VAPVHETDMMLLPEGLQALKKVAKEVGLDLRGAYLNLDG |
| Ga0137394_115934642 | 3300012922 | Vadose Zone Soil | VAPVNETDMVLLPKGLKALKEVAKEVGLALRGAYLNLDGGFD |
| Ga0137416_107563062 | 3300012927 | Vadose Zone Soil | MALLPEGLKALKQVAKEVGLDLRGAYLNLDGGFDSTR |
| Ga0137404_104290572 | 3300012929 | Vadose Zone Soil | VAPVKETDMVLLPQGLNALKKVATQVGLDRRGAYLNLDGGFDSAHNRKCIVNAGLIP |
| Ga0137404_114674452 | 3300012929 | Vadose Zone Soil | MVLLPKSLKALKQVAKQVGLDLRGAYVNLDGGFDSIANRKCIF |
| Ga0137407_100995732 | 3300012930 | Vadose Zone Soil | MALLPKSLKALKQVAKQVGLDLRGASVNLDGGFDSTANRKGCVFFATTQS* |
| Ga0137407_103865132 | 3300012930 | Vadose Zone Soil | MVLLPEGLKALKKVAKEVGVDLRGAYLNLDGGFDSAHNRKCIFNAGLIPN |
| Ga0137407_112002851 | 3300012930 | Vadose Zone Soil | VAPVNETDMVLLPEGLKALKQVAKEVGVDLRGAYLNLDGGFDSRHNRKCLLN |
| Ga0137410_110313301 | 3300012944 | Vadose Zone Soil | VAPVNETDMVLFPEGLKALKDVAKEVGLDLRGAYLNLDGGFDSTHNRK |
| Ga0126375_104307792 | 3300012948 | Tropical Forest Soil | MVLLPQGLKALKQVAKQVGLDLRGAYLNLDGGFDSAHNRKCIF |
| Ga0126375_104349281 | 3300012948 | Tropical Forest Soil | VAPVNETDMVLLPQSLKALKQVAKQVGLDLTGAYLNLDGGFD |
| Ga0126375_119686771 | 3300012948 | Tropical Forest Soil | MVLLPEGLKALKKVATEVGVDLHGAYLNLDGGFDSAHNRKCIFHAGL |
| Ga0126369_111461831 | 3300012971 | Tropical Forest Soil | MVLLPQGLKALKRVAKEVGVDLRGAYLNLDGGFDSTHNRK |
| Ga0126369_133610602 | 3300012971 | Tropical Forest Soil | MVLFPKGLQALKKVAKEVGLDLRGAYLNLDGGFDSA |
| Ga0163162_100838634 | 3300013306 | Switchgrass Rhizosphere | MVLLPQGLKALKRVATEVGVDLRGAYLNLDGGFVSPHHR |
| Ga0163162_109505623 | 3300013306 | Switchgrass Rhizosphere | MVLLPEGLKALKKVAKEVGVDLRGAYLNLDGGFDSARNRKCIFNAGLIPNIK |
| Ga0163162_128457692 | 3300013306 | Switchgrass Rhizosphere | MVLFPKGLKALKHVAQEVGLDRRGASLNLDGGFDAAHN |
| Ga0134081_101245271 | 3300014150 | Grasslands Soil | VAPVNETDMVLLPQGLNALKQVAKQVGLDLRGAYLNLDGGFDSAHNRKCI |
| Ga0157379_112864262 | 3300014968 | Switchgrass Rhizosphere | VAPVNETDMVLLPQGLNALKQVAKQVGLDLRGAYLNLDGGFDS |
| Ga0137405_10520762 | 3300015053 | Vadose Zone Soil | MVLLPKGLKALKQVAKQVGLDLKGACLNLDGGFDSTHNRKCIFNAG |
| Ga0137405_13171472 | 3300015053 | Vadose Zone Soil | MVLLPQGLQALKQVAKEVGVDLRGAYLNLDGGFDSTRNRKCIFMPA* |
| Ga0137420_11745141 | 3300015054 | Vadose Zone Soil | MALLPQGLKALMKQVAKEVGVDLRGAYLNLDGGFDSTRNRKCIFNA |
| Ga0137403_100928615 | 3300015264 | Vadose Zone Soil | VAPVKETDMVLLPQGPNALKKVAKQVGLDLRGADLNRDGG |
| Ga0134085_102438432 | 3300015359 | Grasslands Soil | VAPVNETDMVLLPEGLKALKKIAKEVGLDLKGAYLNLDGGFDSGCCPSKP* |
| Ga0132257_1030495712 | 3300015373 | Arabidopsis Rhizosphere | MVLLPEGLRALKKVATEVGLDLRGAYFNLDGGFDSAHNRKCIF |
| Ga0182036_110268003 | 3300016270 | Soil | VAPVNETDIVLFPEGLQALKEVAKEVGLDLHGAYFNLDGGFDSARNRK |
| Ga0182041_102999191 | 3300016294 | Soil | VAPVNETDMVLLPEGLQALKQVAKEVGVDLRGAYFNLDGGFDSTRN |
| Ga0182039_106351991 | 3300016422 | Soil | MVLLPKGLKALKQVATEVGVDLRDAYLNLDGGFDSIANR |
| Ga0182039_119049121 | 3300016422 | Soil | VAPVNETDMVLLPEGLQALNQVAKEVGVDLRGAYFNLD |
| Ga0163161_120260462 | 3300017792 | Switchgrass Rhizosphere | VAPVNETDTVLFPEGLKALKQVAKEVGVDLKGAYL |
| Ga0190266_112095682 | 3300017965 | Soil | MVLFPEGLQALKRVAKEVRLDLRAAYLNLDGGFDSVRNRKCIF |
| Ga0184610_10329612 | 3300017997 | Groundwater Sediment | MILLPQGLKALKQVAKQVGADLRGASLNLDGGCDAARHRN |
| Ga0184609_102354403 | 3300018076 | Groundwater Sediment | MVLFPEGLKALKRVAKMTGLVLTGAYLNLDGGFDSTYNRKLIFNAGMI |
| Ga0184639_103022233 | 3300018082 | Groundwater Sediment | MVLLPQGLQALKKVAKEVGLDLRGAYVNLDGGFESTRN |
| Ga0066667_106076933 | 3300018433 | Grasslands Soil | MVLFPDGLKALKNVAKQVGLDLRGAYVNLDGGFDSKR |
| Ga0190269_115696181 | 3300018465 | Soil | VAPVNETDMVLLPQGLNALKKVAKQVGLDLRGAYLTLEDGFDSTHHRKCIFKA |
| Ga0190268_104547271 | 3300018466 | Soil | MGLLPESLQALKKVAKEVGLDLRGAYLNLDGGFDSAHNRKCIFNA |
| Ga0066662_109257931 | 3300018468 | Grasslands Soil | MVLLPQGLKALKQVAKQVGLDLRGAYLNLDGGFDSARNRKC |
| Ga0184646_13641162 | 3300019259 | Groundwater Sediment | MAQWPQRLRAVKQVAQQVGLDLRGAYLTLDGCFDAKDNR |
| Ga0179594_100891751 | 3300020170 | Vadose Zone Soil | MVLRPKGLQALKKVAKQVGLDLRGAYLNLDAGFDSTHNRKC |
| Ga0187846_101957733 | 3300021476 | Biofilm | MVLLPEGLKALKDVAKEVGVDLRGAYLNLDGGFDSARNRKSLFGT |
| Ga0126371_114406423 | 3300021560 | Tropical Forest Soil | VAPVNETDMVLLPESLRALKKVAKEVGLDLRGAYFNLDGGFDSTRNR |
| Ga0207710_106075082 | 3300025900 | Switchgrass Rhizosphere | MILFPEGLKALKQVAKEVGFDLKGAYLNLDGGFDSARNRKCIFNAGLIPNIP |
| Ga0207660_108069522 | 3300025917 | Corn Rhizosphere | VLFPEGLKALKEVAKELGLDLRGAYLNLDGGFDSAHNRVLYT |
| Ga0207657_108804001 | 3300025919 | Corn Rhizosphere | VAPVNETDMVLLPEGLKALKQVAKEVGVDLRGAYLNLDG |
| Ga0207646_113829361 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPVNETDMVLLPQGLKALKQVAKEVGVDLRGAYVNLDGGFDSRHN |
| Ga0207644_114069782 | 3300025931 | Switchgrass Rhizosphere | MILFPEGLKALKQVAKEVGFDLKGAYLNLDGGFDSARNRKC |
| Ga0207665_110305051 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MALLPEGLKALKKMAKEVGVDLRGAYLNLDGGFDSAHNRKCIFNAGLIPNIK |
| Ga0207712_109297892 | 3300025961 | Switchgrass Rhizosphere | MVLLPEGLKALKKVAKEVGVDLRGAYLNLNGGFDSAHNRKCIFNAGMV |
| Ga0207703_109709431 | 3300026035 | Switchgrass Rhizosphere | MVLLPQGLKALKRVATEVGVNLRGAYLNLDGGFDSTHNRKGIFNAGLIPN |
| Ga0207703_113224642 | 3300026035 | Switchgrass Rhizosphere | MVLLPESLQALKKVAKEVGLDLRGAYLNLDGGFDSAHNRKCIFN |
| Ga0207674_101988013 | 3300026116 | Corn Rhizosphere | MVLFPEGLKALKKVAKEVGLDLRGAYFNLDGGFDSARN |
| Ga0207698_112678862 | 3300026142 | Corn Rhizosphere | MILFPEGLKALKQVAKEVGFDLKGAYLNLDGGFDSARNRQCIFN |
| Ga0209027_11910271 | 3300026300 | Grasslands Soil | MVLLPEGLKALKKVAKEVGLDLREAYLNLDGGFDST |
| Ga0209239_10660801 | 3300026310 | Grasslands Soil | MVLLPEGLNALKRLAKMVGLDLRGADLNLDAGFDATHNRPCMF |
| Ga0209803_12297072 | 3300026332 | Soil | VAPVNETDMVLLPEGLQALKQVAKEVGVDLRGAYLNLDGGFDSRHNRKCIFNAGLI |
| Ga0257170_10203302 | 3300026351 | Soil | MVLLPESLQALKKVAKEVGLDLRGASLNLDGGFDSRHNRKCIF |
| Ga0257171_10830032 | 3300026377 | Soil | MVLFPESLKALKKVAKEVGLDLRGAYLNLDGGFDSARNRKCIFN |
| Ga0209877_10262661 | 3300027032 | Groundwater Sand | MGLLPQGLQALKQVAKQVGLALRGAYLNLDGGFDSARNRKGIF |
| Ga0209897_10659521 | 3300027169 | Groundwater Sand | VAPVNETDIVLLPESLKALKQVATEVGLDLKGACLNLDGGFDSTYNRKLVD |
| Ga0209861_10675201 | 3300027332 | Groundwater Sand | MVLLPKGLHALKQVAKQVGLDLRGAYLNLDGGFDSTHNRKCI |
| Ga0209842_10529571 | 3300027379 | Groundwater Sand | MVLLPKGLHALKQVAKEIGLDLRGAYLNLDGGFDSAHNRKCIF |
| Ga0207981_10629531 | 3300027560 | Soil | MVLLPESLKALKKVAKEVGLDLRGASLNLDGGFASAHNRQGLFNAG |
| Ga0209874_10589831 | 3300027577 | Groundwater Sand | MVLLPKGLKALKQVAKEVGLDLRGAYVNLDGGFDSTYKRKMIFNAGMI |
| Ga0209388_11006871 | 3300027655 | Vadose Zone Soil | VAPVNETDMVLFPEGLQALKEVAKEVGLDLRGAYLNLDGGFDSTHNRK |
| Ga0209180_104468492 | 3300027846 | Vadose Zone Soil | MVLLPEGLKALKKIAKEVGLDLKGAYLNLDGGFDSAH |
| Ga0209814_101072864 | 3300027873 | Populus Rhizosphere | MGLVPESLPALKKVAKEVGLARRGASLNLDGGFDS |
| Ga0209283_107865522 | 3300027875 | Vadose Zone Soil | MLFPEGLHALKQVAKEVGLDLKGAYLNLDGGFDSAR |
| Ga0207428_107225021 | 3300027907 | Populus Rhizosphere | MVLLPESLQALKKVAKEVGLDLRGAYLNLDGGFDSIANRKC |
| Ga0209382_101863631 | 3300027909 | Populus Rhizosphere | MVLLPEGLKALKKVAKEVGVDLRGAYLNLDGGFDSAHNRKCIFNAGM |
| Ga0247821_111778032 | 3300028596 | Soil | MVLLPKSLHALKQVAKEVGLDLRGAYLNLDGGFDSAHNRK |
| Ga0307311_101936421 | 3300028716 | Soil | MVLLPEGLKALKKMAKEVGVDLRGAYLNLDGGFDSAHN |
| Ga0307281_102503121 | 3300028803 | Soil | VAPVNETDMVLLPEGLKALKKVAKEVGVDLRGAYLNLDGG |
| Ga0307308_104380032 | 3300028884 | Soil | VAPVNETDMVLLPESLQALKKAAKEVGLDLRGAYLNLDGGFDSAHN |
| Ga0247646_11123452 | 3300030546 | Soil | MVLLPDALKALKQVAKEVGVDLSGYLLKLDGGFDSA |
| Ga0308204_101311762 | 3300031092 | Soil | MVLLPDGLKALKKVAKRVGLDLREAYVNLDAGFDSTYNRKCIFNVR |
| Ga0308197_100806441 | 3300031093 | Soil | MVLVPEGLKALKKVAQEVGVDLRGASLNLDGGFDSAHNRTCIFNLIDSP |
| Ga0308199_11108292 | 3300031094 | Soil | VAPVNETDMVLLPDSLKALKKVAKEVGLDLRGAYL |
| Ga0308199_11408691 | 3300031094 | Soil | VAPVNETDMVLVPEGLKALKKVAQEVGVDLRGASLNL |
| Ga0308187_101154082 | 3300031114 | Soil | MVLLPEGLKALKKIAKEVGLDLTGAYLNLDGGFDSAHNRKCIFNAGMIP |
| Ga0307497_106021101 | 3300031226 | Soil | MVLLPQGLKALKQMAKEVGLDLKGAYLNLDGGFDSARNRKGI |
| Ga0308179_10481031 | 3300031424 | Soil | MVLLPESLHALKQVAKEVGLDLRGAYLNLDGGFDSVHNRKCIFNA |
| Ga0310887_104115051 | 3300031547 | Soil | MVLLPEGLKALKKVAKEVGLDLRGAYLNLDGGFDSAHNRKCIFNA |
| Ga0307469_112682672 | 3300031720 | Hardwood Forest Soil | MILLPEGLKALKKVAKQVGLDLKGAYLNLDAGFDST |
| Ga0318548_106372712 | 3300031793 | Soil | MVLLPKGLKALKQVATEVGVDLRDAYLNLDGGFDSIANRKSIFNAGLIP |
| Ga0307413_109503572 | 3300031824 | Rhizosphere | MVLLPEGLKALKEVAKEVGLDLRGAYLNLDGGFDS |
| Ga0306925_120177902 | 3300031890 | Soil | MVLFPEGLKALKKVAKEVGLDLKGAYLNLDGGFDSAHNRKCIFNAGL |
| Ga0306921_104167871 | 3300031912 | Soil | MVLLPESLKALKKVAKEVELDLRGASLNLDGGFDSTYNRTCMFN |
| Ga0310891_100990071 | 3300031913 | Soil | MVLFPEGLKALKKVAKEVGLDLRGAYLNLDGGFDSARN |
| Ga0307416_1005274923 | 3300032002 | Rhizosphere | MILLPQRLKALRQVAKQVGADLRGTFLNLDGGCDAARHR |
| Ga0307416_1009321273 | 3300032002 | Rhizosphere | MLLFPEGLKALKKVAKEVGVELQGAYLNLDGGFDS |
| Ga0318553_105755612 | 3300032068 | Soil | VAPVNETDMVLLPKGLKALKQVATEVGVDLRDAYLNLD |
| Ga0318518_107267081 | 3300032090 | Soil | VAPVNETDVVLLPQGLQALKKVATEVGLDLRGASRHLDGGCD |
| Ga0307470_110603822 | 3300032174 | Hardwood Forest Soil | MILLPQGLKALKQVAKQVGLDLRGAYLNLDGGFDSAHNRK |
| Ga0307471_1021713262 | 3300032180 | Hardwood Forest Soil | MVWLPAGLKALKDVAKKTGFVLEGAYLNLDGGFDSKHHRKMIFNAGMIPN |
| Ga0307472_1018487481 | 3300032205 | Hardwood Forest Soil | MVLLPESLKALKKVAKEVGLDLRGAYLNLDGGFDS |
| Ga0318519_108736342 | 3300033290 | Soil | VLLPKSLQALKQVAKEVGLDVRGAYLNLDGGFDSAHNRKCIFNAGLIPNI |
| Ga0247830_111113532 | 3300033551 | Soil | MVLFPEGLHALKQVAKEVGVDLRGAYFNLDGGFDSARNRKMIFNAGLIP |
| Ga0247830_111499611 | 3300033551 | Soil | VAPVNETDMVLLPEGLKALKQVAKEVGVDLRGAYLNLDGGVDSS |
| Ga0370546_041824_444_581 | 3300034681 | Soil | MILLPKGLKALKQVAKQVGLDLRGAYVNLDGGFDSTHGRVPVACG |
| ⦗Top⦘ |