


| Basic Information | |
|---|---|
| Family ID | F014169 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 265 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AYHEKGESKGKPYEYHDRLTDVWMKIAGRWQVIASHYSVPSK |
| Number of Associated Samples | 203 |
| Number of Associated Scaffolds | 265 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.64 % |
| % of genes near scaffold ends (potentially truncated) | 95.09 % |
| % of genes from short scaffolds (< 2000 bps) | 89.06 % |
| Associated GOLD sequencing projects | 192 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.170 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.358 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.660 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.792 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 44.29% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 265 Family Scaffolds |
|---|---|---|
| PF00557 | Peptidase_M24 | 10.57 |
| PF01321 | Creatinase_N | 3.77 |
| PF05239 | PRC | 1.89 |
| PF13474 | SnoaL_3 | 1.89 |
| PF02627 | CMD | 1.51 |
| PF01906 | YbjQ_1 | 1.51 |
| PF02633 | Creatininase | 1.51 |
| PF08332 | CaMKII_AD | 1.13 |
| PF05036 | SPOR | 1.13 |
| PF01872 | RibD_C | 1.13 |
| PF14534 | DUF4440 | 1.13 |
| PF04674 | Phi_1 | 1.13 |
| PF05935 | Arylsulfotrans | 1.13 |
| PF16491 | Peptidase_M48_N | 1.13 |
| PF00990 | GGDEF | 1.13 |
| PF08241 | Methyltransf_11 | 0.75 |
| PF00188 | CAP | 0.75 |
| PF00571 | CBS | 0.75 |
| PF09972 | DUF2207 | 0.75 |
| PF02190 | LON_substr_bdg | 0.75 |
| PF10012 | DUF2255 | 0.75 |
| PF00430 | ATP-synt_B | 0.75 |
| PF01381 | HTH_3 | 0.75 |
| PF12849 | PBP_like_2 | 0.75 |
| PF00294 | PfkB | 0.75 |
| PF11528 | DUF3224 | 0.75 |
| PF00593 | TonB_dep_Rec | 0.75 |
| PF13240 | zinc_ribbon_2 | 0.75 |
| PF00501 | AMP-binding | 0.38 |
| PF13561 | adh_short_C2 | 0.38 |
| PF00708 | Acylphosphatase | 0.38 |
| PF00175 | NAD_binding_1 | 0.38 |
| PF00155 | Aminotran_1_2 | 0.38 |
| PF14559 | TPR_19 | 0.38 |
| PF01740 | STAS | 0.38 |
| PF00005 | ABC_tran | 0.38 |
| PF01850 | PIN | 0.38 |
| PF00144 | Beta-lactamase | 0.38 |
| PF01594 | AI-2E_transport | 0.38 |
| PF03965 | Penicillinase_R | 0.38 |
| PF13437 | HlyD_3 | 0.38 |
| PF00912 | Transgly | 0.38 |
| PF02878 | PGM_PMM_I | 0.38 |
| PF13493 | DUF4118 | 0.38 |
| PF04542 | Sigma70_r2 | 0.38 |
| PF05015 | HigB-like_toxin | 0.38 |
| PF07238 | PilZ | 0.38 |
| PF13517 | FG-GAP_3 | 0.38 |
| PF07969 | Amidohydro_3 | 0.38 |
| PF03130 | HEAT_PBS | 0.38 |
| PF04679 | DNA_ligase_A_C | 0.38 |
| PF12867 | DinB_2 | 0.38 |
| PF12244 | DUF3606 | 0.38 |
| PF02609 | Exonuc_VII_S | 0.38 |
| PF00072 | Response_reg | 0.38 |
| PF01738 | DLH | 0.38 |
| PF05170 | AsmA | 0.38 |
| PF13466 | STAS_2 | 0.38 |
| PF10094 | DUF2332 | 0.38 |
| PF11154 | DUF2934 | 0.38 |
| PF02954 | HTH_8 | 0.38 |
| PF13515 | FUSC_2 | 0.38 |
| PF06751 | EutB | 0.38 |
| PF01757 | Acyl_transf_3 | 0.38 |
| PF00925 | GTP_cyclohydro2 | 0.38 |
| PF08240 | ADH_N | 0.38 |
| PF11695 | DUF3291 | 0.38 |
| PF00581 | Rhodanese | 0.38 |
| PF05016 | ParE_toxin | 0.38 |
| PF06127 | Mpo1-like | 0.38 |
| PF13174 | TPR_6 | 0.38 |
| PF01645 | Glu_synthase | 0.38 |
| PF06537 | DHOR | 0.38 |
| PF00248 | Aldo_ket_red | 0.38 |
| PF13560 | HTH_31 | 0.38 |
| PF00069 | Pkinase | 0.38 |
| PF00882 | Zn_dep_PLPC | 0.38 |
| PF10604 | Polyketide_cyc2 | 0.38 |
| PF13590 | DUF4136 | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 265 Family Scaffolds |
|---|---|---|---|
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 3.77 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 1.51 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.51 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.51 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 1.51 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.51 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.13 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.13 |
| COG4875 | Protein kinase association domain CaMKII_AD, NTF2-like superfamily | Posttranslational modification, protein turnover, chaperones [O] | 1.13 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 0.75 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.75 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.38 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.38 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.38 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.38 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG0807 | GTP cyclohydrolase II | Coenzyme transport and metabolism [H] | 0.38 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.38 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.38 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.38 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.38 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.38 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG1722 | Exonuclease VII small subunit | Replication, recombination and repair [L] | 0.38 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.38 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.38 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.38 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.38 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.38 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.38 |
| COG4303 | Ethanolamine ammonia-lyase, large subunit | Amino acid transport and metabolism [E] | 0.38 |
| COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 0.38 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.38 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.17 % |
| Unclassified | root | N/A | 12.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908006|FWIROz_GKA24FP02J16SJ | Not Available | 513 | Open in IMG/M |
| 2199352024|deeps_contig98133.57777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300001593|JGI12635J15846_10836268 | Not Available | 527 | Open in IMG/M |
| 3300001686|C688J18823_10965245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10242075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300004091|Ga0062387_100672722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300004092|Ga0062389_100079551 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
| 3300004092|Ga0062389_103299717 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300004152|Ga0062386_101574720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300004479|Ga0062595_100282763 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300004479|Ga0062595_102025320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300004635|Ga0062388_102335033 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005175|Ga0066673_10404579 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005176|Ga0066679_11011128 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005178|Ga0066688_10866487 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005179|Ga0066684_11027405 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005181|Ga0066678_10684836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300005181|Ga0066678_10944572 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005332|Ga0066388_100477799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1885 | Open in IMG/M |
| 3300005343|Ga0070687_100616582 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005434|Ga0070709_10111482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1840 | Open in IMG/M |
| 3300005434|Ga0070709_10582674 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005436|Ga0070713_100053790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3337 | Open in IMG/M |
| 3300005436|Ga0070713_101906743 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005436|Ga0070713_102392403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300005439|Ga0070711_100335073 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300005439|Ga0070711_101994605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 510 | Open in IMG/M |
| 3300005454|Ga0066687_10466937 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300005467|Ga0070706_100482413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1153 | Open in IMG/M |
| 3300005468|Ga0070707_100054046 | All Organisms → cellular organisms → Bacteria | 3850 | Open in IMG/M |
| 3300005468|Ga0070707_100475637 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005468|Ga0070707_100668421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300005471|Ga0070698_100972100 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005533|Ga0070734_10492037 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005535|Ga0070684_100149343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2116 | Open in IMG/M |
| 3300005535|Ga0070684_102158033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300005536|Ga0070697_100430412 | Not Available | 1147 | Open in IMG/M |
| 3300005536|Ga0070697_100858931 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005538|Ga0070731_10886199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300005541|Ga0070733_10296679 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300005541|Ga0070733_10812358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300005542|Ga0070732_10814558 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005544|Ga0070686_101928162 | Not Available | 505 | Open in IMG/M |
| 3300005545|Ga0070695_100521037 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005553|Ga0066695_10141831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1493 | Open in IMG/M |
| 3300005559|Ga0066700_11002063 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005561|Ga0066699_11019197 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005564|Ga0070664_100003563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12571 | Open in IMG/M |
| 3300005564|Ga0070664_100067297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3061 | Open in IMG/M |
| 3300005568|Ga0066703_10539719 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005575|Ga0066702_10072625 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300005575|Ga0066702_10124297 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300005576|Ga0066708_10540847 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005602|Ga0070762_10715862 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005602|Ga0070762_11226312 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005614|Ga0068856_101307042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300005718|Ga0068866_10410992 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005842|Ga0068858_100126931 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300006028|Ga0070717_10077283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2787 | Open in IMG/M |
| 3300006028|Ga0070717_10844025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300006046|Ga0066652_101852726 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006175|Ga0070712_101417390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 606 | Open in IMG/M |
| 3300006176|Ga0070765_101220753 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300006237|Ga0097621_100663379 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300006804|Ga0079221_11092791 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006806|Ga0079220_10176556 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300006881|Ga0068865_100508262 | Not Available | 1006 | Open in IMG/M |
| 3300007255|Ga0099791_10675671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300007788|Ga0099795_10042011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1630 | Open in IMG/M |
| 3300009088|Ga0099830_10225635 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300009088|Ga0099830_11304982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300009088|Ga0099830_11545758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 553 | Open in IMG/M |
| 3300009089|Ga0099828_10056783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3270 | Open in IMG/M |
| 3300009143|Ga0099792_10398393 | Not Available | 842 | Open in IMG/M |
| 3300009162|Ga0075423_10534391 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300009545|Ga0105237_12107468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300009683|Ga0116224_10142044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| 3300009762|Ga0116130_1085115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300010048|Ga0126373_12134902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300010159|Ga0099796_10285511 | Not Available | 695 | Open in IMG/M |
| 3300010343|Ga0074044_10225171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1242 | Open in IMG/M |
| 3300010360|Ga0126372_12301587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300010360|Ga0126372_13131353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300010361|Ga0126378_11433967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 782 | Open in IMG/M |
| 3300010361|Ga0126378_12362122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300010396|Ga0134126_10448623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1493 | Open in IMG/M |
| 3300010398|Ga0126383_12711681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 578 | Open in IMG/M |
| 3300011120|Ga0150983_14653889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 601 | Open in IMG/M |
| 3300011270|Ga0137391_10580368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300011270|Ga0137391_11001486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300011271|Ga0137393_11076901 | Not Available | 683 | Open in IMG/M |
| 3300012096|Ga0137389_10298762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300012202|Ga0137363_10195788 | Not Available | 1618 | Open in IMG/M |
| 3300012202|Ga0137363_11248262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300012203|Ga0137399_10280640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1372 | Open in IMG/M |
| 3300012203|Ga0137399_10692245 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300012205|Ga0137362_11365908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300012207|Ga0137381_10816879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300012210|Ga0137378_11265032 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012349|Ga0137387_10412859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300012349|Ga0137387_11160346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300012351|Ga0137386_10434017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300012351|Ga0137386_11212395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300012357|Ga0137384_10353261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1218 | Open in IMG/M |
| 3300012362|Ga0137361_11856046 | Not Available | 520 | Open in IMG/M |
| 3300012363|Ga0137390_11285420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300012683|Ga0137398_10592506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300012917|Ga0137395_10482760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300012918|Ga0137396_10099787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2071 | Open in IMG/M |
| 3300012918|Ga0137396_10764560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300012923|Ga0137359_11190011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 650 | Open in IMG/M |
| 3300012924|Ga0137413_10021369 | All Organisms → cellular organisms → Bacteria | 3409 | Open in IMG/M |
| 3300012925|Ga0137419_10656597 | Not Available | 847 | Open in IMG/M |
| 3300012925|Ga0137419_10663414 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012925|Ga0137419_11493960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 572 | Open in IMG/M |
| 3300012925|Ga0137419_11668257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 543 | Open in IMG/M |
| 3300012927|Ga0137416_10007172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6441 | Open in IMG/M |
| 3300012927|Ga0137416_11739322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 569 | Open in IMG/M |
| 3300012927|Ga0137416_12233622 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012958|Ga0164299_11529867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300012958|Ga0164299_11561806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300012971|Ga0126369_12781016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300012984|Ga0164309_10578507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300012986|Ga0164304_10471746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300012986|Ga0164304_11143795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300012987|Ga0164307_11087239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300013296|Ga0157374_10801398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 958 | Open in IMG/M |
| 3300013772|Ga0120158_10462584 | Not Available | 568 | Open in IMG/M |
| 3300014325|Ga0163163_12910151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300015053|Ga0137405_1304201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1783 | Open in IMG/M |
| 3300015193|Ga0167668_1000858 | All Organisms → cellular organisms → Bacteria | 6082 | Open in IMG/M |
| 3300015241|Ga0137418_10192762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1767 | Open in IMG/M |
| 3300015245|Ga0137409_10623701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 909 | Open in IMG/M |
| 3300015357|Ga0134072_10227168 | Not Available | 660 | Open in IMG/M |
| 3300015373|Ga0132257_102499320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 671 | Open in IMG/M |
| 3300016371|Ga0182034_10771541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300016371|Ga0182034_11491241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300016387|Ga0182040_10563407 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300016750|Ga0181505_10680080 | All Organisms → cellular organisms → Bacteria | 4792 | Open in IMG/M |
| 3300017823|Ga0187818_10328520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300017932|Ga0187814_10369626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300017937|Ga0187809_10268103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 622 | Open in IMG/M |
| 3300017943|Ga0187819_10002226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10231 | Open in IMG/M |
| 3300017955|Ga0187817_10037105 | All Organisms → cellular organisms → Bacteria | 2973 | Open in IMG/M |
| 3300017959|Ga0187779_10124870 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300017959|Ga0187779_11187778 | Not Available | 536 | Open in IMG/M |
| 3300017966|Ga0187776_11464951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300017995|Ga0187816_10181110 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300018006|Ga0187804_10267440 | Not Available | 740 | Open in IMG/M |
| 3300018020|Ga0187861_10139143 | Not Available | 1131 | Open in IMG/M |
| 3300018040|Ga0187862_10500974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300018042|Ga0187871_10637054 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300018060|Ga0187765_10480897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300018062|Ga0187784_11614593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 513 | Open in IMG/M |
| 3300018085|Ga0187772_10041454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2792 | Open in IMG/M |
| 3300018089|Ga0187774_10851036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300018090|Ga0187770_10057988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2806 | Open in IMG/M |
| 3300020199|Ga0179592_10091728 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1394 | Open in IMG/M |
| 3300020199|Ga0179592_10160685 | Not Available | 1026 | Open in IMG/M |
| 3300020580|Ga0210403_10009841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7807 | Open in IMG/M |
| 3300020580|Ga0210403_10068713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2845 | Open in IMG/M |
| 3300020580|Ga0210403_10142308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1959 | Open in IMG/M |
| 3300020580|Ga0210403_10512926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300020581|Ga0210399_11587204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300020582|Ga0210395_10090326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2261 | Open in IMG/M |
| 3300020582|Ga0210395_10734391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300020582|Ga0210395_11201019 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300020583|Ga0210401_10101005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2710 | Open in IMG/M |
| 3300021168|Ga0210406_10406184 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300021168|Ga0210406_10684394 | Not Available | 792 | Open in IMG/M |
| 3300021171|Ga0210405_10043367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3572 | Open in IMG/M |
| 3300021171|Ga0210405_10777276 | Not Available | 735 | Open in IMG/M |
| 3300021171|Ga0210405_11210422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300021178|Ga0210408_10294865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1293 | Open in IMG/M |
| 3300021401|Ga0210393_10105113 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
| 3300021401|Ga0210393_11136449 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021402|Ga0210385_10881295 | Not Available | 687 | Open in IMG/M |
| 3300021405|Ga0210387_10925276 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300021405|Ga0210387_11180914 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300021477|Ga0210398_10279268 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300021478|Ga0210402_11000719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300021478|Ga0210402_11281305 | Not Available | 660 | Open in IMG/M |
| 3300021479|Ga0210410_11238472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300021479|Ga0210410_11814079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300021559|Ga0210409_10407948 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300021559|Ga0210409_11700162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300021560|Ga0126371_13064214 | Not Available | 566 | Open in IMG/M |
| 3300022726|Ga0242654_10149151 | Not Available | 779 | Open in IMG/M |
| 3300022726|Ga0242654_10223980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300024251|Ga0247679_1008022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1815 | Open in IMG/M |
| 3300024251|Ga0247679_1054859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300024286|Ga0247687_1031757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300024287|Ga0247690_1023376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300025581|Ga0208355_1105833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300025898|Ga0207692_10501625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300025905|Ga0207685_10238828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300025910|Ga0207684_11148386 | Not Available | 645 | Open in IMG/M |
| 3300025915|Ga0207693_11338796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300025917|Ga0207660_10872415 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300025927|Ga0207687_10681755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300025928|Ga0207700_10277077 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300025928|Ga0207700_11116693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 705 | Open in IMG/M |
| 3300025929|Ga0207664_11422526 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300025944|Ga0207661_11937009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300026023|Ga0207677_10659592 | Not Available | 924 | Open in IMG/M |
| 3300026078|Ga0207702_12183394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300026309|Ga0209055_1076005 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300026315|Ga0209686_1131074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300026328|Ga0209802_1205287 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300026351|Ga0257170_1068041 | Not Available | 503 | Open in IMG/M |
| 3300026497|Ga0257164_1076790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 561 | Open in IMG/M |
| 3300026499|Ga0257181_1050353 | Not Available | 691 | Open in IMG/M |
| 3300026547|Ga0209156_10414742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300026548|Ga0209161_10470723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300026557|Ga0179587_10342829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300027070|Ga0208365_1015943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300027394|Ga0209904_1003125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300027562|Ga0209735_1004103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2632 | Open in IMG/M |
| 3300027826|Ga0209060_10214788 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300027842|Ga0209580_10596574 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027842|Ga0209580_10700058 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027869|Ga0209579_10574858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300027869|Ga0209579_10608919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300027894|Ga0209068_10739360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300027898|Ga0209067_10912386 | Not Available | 516 | Open in IMG/M |
| 3300028379|Ga0268266_11216080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300028536|Ga0137415_10524633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 993 | Open in IMG/M |
| 3300028800|Ga0265338_10801190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300028808|Ga0302228_10024595 | All Organisms → cellular organisms → Bacteria | 3063 | Open in IMG/M |
| 3300029984|Ga0311332_10455446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300029998|Ga0302271_10473440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300030053|Ga0302177_10402216 | Not Available | 717 | Open in IMG/M |
| 3300030617|Ga0311356_11981094 | Not Available | 515 | Open in IMG/M |
| 3300031249|Ga0265339_10359649 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031344|Ga0265316_10749674 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300031474|Ga0170818_101217414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300031708|Ga0310686_105093292 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300031715|Ga0307476_10234245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1338 | Open in IMG/M |
| 3300031720|Ga0307469_11093639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300031753|Ga0307477_10587139 | Not Available | 752 | Open in IMG/M |
| 3300031753|Ga0307477_10605898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300031754|Ga0307475_10367854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1155 | Open in IMG/M |
| 3300031820|Ga0307473_10271045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300031820|Ga0307473_11289586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300031823|Ga0307478_10295313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
| 3300031823|Ga0307478_10380583 | Not Available | 1166 | Open in IMG/M |
| 3300031823|Ga0307478_11765571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300031833|Ga0310917_10130173 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300031962|Ga0307479_10471939 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300031962|Ga0307479_10495462 | Not Available | 1205 | Open in IMG/M |
| 3300031962|Ga0307479_10501395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1197 | Open in IMG/M |
| 3300032180|Ga0307471_101326858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300032180|Ga0307471_102087874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 712 | Open in IMG/M |
| 3300032180|Ga0307471_103697556 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300032205|Ga0307472_100006284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5582 | Open in IMG/M |
| 3300032261|Ga0306920_102896928 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300032782|Ga0335082_10844095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300032783|Ga0335079_10616632 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300032828|Ga0335080_10068203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3942 | Open in IMG/M |
| 3300032829|Ga0335070_11475755 | Not Available | 620 | Open in IMG/M |
| 3300032892|Ga0335081_10617200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1334 | Open in IMG/M |
| 3300032954|Ga0335083_10224945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1697 | Open in IMG/M |
| 3300033004|Ga0335084_10945549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300033475|Ga0310811_11096114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 676 | Open in IMG/M |
| 3300033826|Ga0334847_000384 | All Organisms → cellular organisms → Bacteria | 3122 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.02% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.64% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.13% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.13% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.13% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.38% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.38% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.38% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.38% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.38% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.38% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.38% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.38% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.38% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908006 | Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2 | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIROz_02632370 | 2124908006 | Soil | VTGAYHETGRSNGKPYEYHDRLTDVWVKTGTNWQVIASHYSVPLRQ |
| deeps_00833340 | 2199352024 | Soil | VTGAYHETGTSKGKRYEYRDRLTDVWMKIDGQWRLIAA |
| JGI12635J15846_108362682 | 3300001593 | Forest Soil | YHEKGTSNKKPYEYHDRLTDVWVKVGSNWQVIASHYSVPTKG* |
| C688J18823_109652452 | 3300001686 | Soil | KGKPYEYHDRMTDTWINTDGKWLVFASHYSIPVK* |
| JGIcombinedJ51221_102420752 | 3300003505 | Forest Soil | VVTGAYHEKGQSNHKPYEYRDRLTDVWVKSGNSWRVLASHYSVPLK* |
| Ga0062387_1006727221 | 3300004091 | Bog Forest Soil | AIVTGAYHEKGDSRGKSYEYHDRLTDVWMKNGGKWQVVASHYSVPVK* |
| Ga0062389_1000795514 | 3300004092 | Bog Forest Soil | VVTGAYHERGKSNGKPYEYHDRLTDVWVKVGNNWRVLASHYAVPTK* |
| Ga0062389_1032997171 | 3300004092 | Bog Forest Soil | HERGESSGKRYEYHDRFTDIWMKAGGKWQVVASHYSMPVK* |
| Ga0062386_1015747202 | 3300004152 | Bog Forest Soil | MHGNTAIVTGAYHEKGTSSGKPYEYHDRLTDVWMLIDGRWQVVASHYAIPAK* |
| Ga0062595_1002827633 | 3300004479 | Soil | AVVTGAYYEKGKQDGKSYEYHDRLTDVWVKSEAGWQVIASHYSVPVK* |
| Ga0062595_1020253202 | 3300004479 | Soil | AVVTGAYYERGTSKGKPYEYRDRFTDVWVGVENKWRILASHYSIPMK* |
| Ga0062388_1023350332 | 3300004635 | Bog Forest Soil | AYHERGESSGKRYEYHDRFTDIWIKAGGKWQVVASHYSMPVK* |
| Ga0066673_104045791 | 3300005175 | Soil | ERGKSNGKPYEYHDRLTDVWMKVGGKWQVISSHYSVPMKQ* |
| Ga0066679_110111282 | 3300005176 | Soil | TGAYHEKGTSKGKPYEYRDRYTDIWMSIGGNWQLIASHFAVPFKG* |
| Ga0066688_108664871 | 3300005178 | Soil | GNVAVVTGGYHEKGTSKGKPYEYRDRFTDVWMNVAGAWQLIASHYSVPTKD* |
| Ga0066684_110274052 | 3300005179 | Soil | SIAVVTGAYHERGVLAGKPYDYHDRLTDVWMKTNAKWQLIASHYSLPANP* |
| Ga0066678_106848362 | 3300005181 | Soil | VTAAYHEKGTSNGKLYESRDRATDVWMRNANGGWQVIAAHYSIPARQ* |
| Ga0066678_109445721 | 3300005181 | Soil | GYHEKGTSKGKPYEYRDRFTDVWMNTAGAWQLIASHYSVPTKE* |
| Ga0066388_1004777991 | 3300005332 | Tropical Forest Soil | GNVAIVTGAYHERGTSKGKHYEYRDRMTDVWLKTGSAWQLIASQYSVPLQQ* |
| Ga0070687_1006165822 | 3300005343 | Switchgrass Rhizosphere | VRLRGNVAIVTGAYHEKGKTKGKPYEYHDRMTDTWINADGKWLVLASHYSIPAK* |
| Ga0070709_101114821 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ERGTSKGKPYEYRDRFTDVWVGVENKWRILASHYSIPMK* |
| Ga0070709_105826741 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TGAYHEHGESGGKPYDYRDRLTDIWIKTGGKWQVIASHYSVPFKP* |
| Ga0070713_1000537901 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TAVVTGAYHEAGTENGKRYEYRDRLTDVWMNVGGNWQVIASHYSVPVK* |
| Ga0070713_1019067431 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVVTGAYHETGTSKNKRYEYRDRLTDVWMKVDGQWRLIAAQYSVPLAQ* |
| Ga0070713_1023924032 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AYHETGTFKGKHYEYHDRLTDVWMKIDGQWRLIAAQYSVPLAQ* |
| Ga0070711_1003350731 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RGDSSGKRYEYRDRLTDVWMKVGGKWQVVASHYSVPFKQ* |
| Ga0070711_1019946052 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GAYHEKGESKGKPYEYRDRLTDVWMNTGGRWQVIASHYSVPFNP* |
| Ga0066687_104669371 | 3300005454 | Soil | VTGGYHEKGTSKGKPYEYRDRFTDVWMNVAGAWQLIASHYSVPTKD* |
| Ga0070706_1004824133 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGAYHEKGTEKGKPYEFHDRFTDVWMNNNRGWQLIVSHYSVPARQ* |
| Ga0070707_1000540462 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | YHEKGISKGKPYEYHDRTDVWMNINGKWQVIASHYSIPTSQ* |
| Ga0070707_1004756372 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TGAYHERGESHGKPYEYHDRLTDVWMKVGGTWQVIASHYSVPMKE* |
| Ga0070707_1006684212 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGNTAVVTGAYHEKGISKGKPYEYHDRTDVWMNINGKWQVIASHYSIPTS |
| Ga0070698_1009721001 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AVVTGAYHEKGTEKGKAYEYHDRFTDVCINNGRWQLIVSHYSIPARQ* |
| Ga0070734_104920371 | 3300005533 | Surface Soil | RIHATTGIVTGVYHERGTTKGKAYEYRDRFTDVWKKKNGKWLMIASHYAIPLKAE* |
| Ga0070684_1001493432 | 3300005535 | Corn Rhizosphere | AYHEKGSSRSKRYEYRDRLTDVWMKVDGKWQVISSHYSVPFKP* |
| Ga0070684_1021580332 | 3300005535 | Corn Rhizosphere | AYHETGTSKGKRYEYRDRLTDVWMKIDGQWRLIAAQYSVPLEQ* |
| Ga0070697_1004304122 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AYHEKGKSNGKPYEYRDRLTDVWMKVGNKWQVISSHYSVPLKQ* |
| Ga0070697_1008589311 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VRGNVAIVTGAYHEKGKTKGKPYEYHDRMTDTWINADGKWLVLASHYSIPAK* |
| Ga0070731_108861991 | 3300005538 | Surface Soil | DGKRYEYHDRFTDVWMKNGGKWQVISSHYSIPAK* |
| Ga0070733_102966793 | 3300005541 | Surface Soil | AVVTGAYHERGESNGKRYEYHDRLTDVWMKVGGKWQVVASHYSVPLRP* |
| Ga0070733_108123581 | 3300005541 | Surface Soil | DTAIVTGAYHEKGESSGKPYEYHDRLTDTWMKVGGRWQVVASHYSVPYKQ* |
| Ga0070732_108145582 | 3300005542 | Surface Soil | GAYYEKGIEAGKPYEYHDRLTDVWMKAQNRWKLIASHYSLRNQ* |
| Ga0070686_1019281622 | 3300005544 | Switchgrass Rhizosphere | GNVAIVTGAYHEKGKTKGKPYEYHDRMTDTWINADGKWLVLASHYSIPAK* |
| Ga0070695_1005210371 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GAYHEKGKTKGKPYEYHDRMTDTWINADGKWLVLASHYSIPAK* |
| Ga0066695_101418315 | 3300005553 | Soil | VIAAYHERGELGGKSYDYHDPLTDVWMKISGKWQLIASHYSLPANP* |
| Ga0066700_110020632 | 3300005559 | Soil | TGGYHEKGTSKGKPYEYRDRFTDVWMNVAGAWQLIASHYSVPTKE* |
| Ga0066699_110191971 | 3300005561 | Soil | SKGKPYEYRDRFTDVWMNVAGAWQLIASHYSVPTKD* |
| Ga0070664_1000035631 | 3300005564 | Corn Rhizosphere | AYHEKGNSGGKRYEYHDRLTDVWMKIDGRWQVISSHYSVPLRQ* |
| Ga0070664_1000672973 | 3300005564 | Corn Rhizosphere | SRSKRYEYRDRLTDVWMKVDGKWQVISSHYSVPFKP* |
| Ga0066703_105397192 | 3300005568 | Soil | VVTGAYHEKGISNGKPYEYHDRLTDVWLRKEGNWQVIASHYSVPTK* |
| Ga0066702_100726254 | 3300005575 | Soil | VTGAYHEKGTSKGKPYEYHDRYTDIWQNAGGNWQLIASHFSVPSKT* |
| Ga0066702_101242972 | 3300005575 | Soil | TAAYHERGELGGKSYDYHDRVTDVWMKSGGKWQLIVSHYSVPASI* |
| Ga0066708_105408472 | 3300005576 | Soil | HMHENIAVVTAGYHERGEFGGKSYDYHDRLTDVWMKIGRKWQLIASHYSVPKSL* |
| Ga0070762_107158621 | 3300005602 | Soil | GNTAIVTGAYHERGESNGKSYEYHDRLTDVWMRVGGKWQVVASHYSIPSK* |
| Ga0070762_112263121 | 3300005602 | Soil | AVVTGAYHERGNTNGKRYEYRDRFTDVWMKTGSKWEVVASHYSVPAK* |
| Ga0068856_1013070422 | 3300005614 | Corn Rhizosphere | TGAYHEKGVFRGKPYEYHDRFTDVWMNKNGKWQVIASHYSIPSSD* |
| Ga0068866_104109922 | 3300005718 | Miscanthus Rhizosphere | TGAYHEKGKTKGKPYEYHDRMTDTWINADGKWLVLASHYSIPAK* |
| Ga0068858_1001269311 | 3300005842 | Switchgrass Rhizosphere | NSGGKRYEYHDRLTDVWMIIDGRWQVISSHYSVPLRQ* |
| Ga0070717_100772831 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SNRKPYEYHDRLTDVWVKAGNNWQVIASHYSVPTK* |
| Ga0070717_108440252 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TAVVTGAYHEKGTEKGKPYEYRDRFTDVWMNINDRWQVIASHYSLRAQ* |
| Ga0066652_1018527261 | 3300006046 | Soil | EKGISNGKPYEYHDRLTDVWLRKEGNWQVIASHYSVPTK* |
| Ga0070712_1014173901 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NTAVVTGAYHEKGTEKGKPYEYRDRFTDVWMNINDRWQVIASHYSLRAQ* |
| Ga0070765_1012207532 | 3300006176 | Soil | EKGTSKGKPYEYRDRFTDVWMNMNGPWQVIASHYSIPASP* |
| Ga0097621_1006633791 | 3300006237 | Miscanthus Rhizosphere | AVVTGAYHEKGDSGGKPYEYHDRLTDVWMKVGGKWQVVASHYSVPYKP* |
| Ga0079221_110927911 | 3300006804 | Agricultural Soil | TYHERGVLNGKPYDYHDRLTDVWVKTGGRWQLIASHYSLPASP* |
| Ga0079220_101765562 | 3300006806 | Agricultural Soil | YHEKGKTKGKPYEYHDRMTDTWINADGKWLVLASHYSIPAK* |
| Ga0068865_1005082624 | 3300006881 | Miscanthus Rhizosphere | GNSGGKRYEYHDRLTDVWMKIDGRWQVISSHYSVPLRQ* |
| Ga0099791_106756711 | 3300007255 | Vadose Zone Soil | VIIGAYHEKGLSKGKPYEYRDRFTDVWTKFNGTWQVVASHYSIPVS* |
| Ga0099795_100420111 | 3300007788 | Vadose Zone Soil | AYHERGVLDGKSYDYRDRLTDVWMKIAGKWQLIASHYSLPGNP* |
| Ga0099830_102256353 | 3300009088 | Vadose Zone Soil | GAYHERGQSDGKPYEYHDRLTDVWMKVGGKWQVVASHYSVPVK* |
| Ga0099830_113049821 | 3300009088 | Vadose Zone Soil | TGAYREKGTEKGKPYEYRDRLTDVWMNINGSWRLIASHYSLRASQ* |
| Ga0099830_115457582 | 3300009088 | Vadose Zone Soil | YVAVVTGAYHERGTSNHKPYEYHDRLTDVWVKVGNTWQVIASHYSVPVKQ* |
| Ga0099828_100567836 | 3300009089 | Vadose Zone Soil | RIHGNTAVVTGAYREKGTEKGKPYEYRDRLTDVWMNINGRWQLIASHYSLRASQ* |
| Ga0099792_103983932 | 3300009143 | Vadose Zone Soil | VRGYVAVVTGAYHEKGTSNHKPYEYHDRLTDVWVKVGNTWQVIASHYSIPVKQ* |
| Ga0075423_105343913 | 3300009162 | Populus Rhizosphere | VRLRGNVAIVTGAYHEKGKTKGKPYEYHDRMTDTWINADGKWLVLASHYSIPVK* |
| Ga0105237_121074681 | 3300009545 | Corn Rhizosphere | VVTGAYHEKGSSRGKRYEYRDRLTDVWMKIDGGWQVISSHYSVPLKP* |
| Ga0116224_101420441 | 3300009683 | Peatlands Soil | EKGISKGQPYEYHDRFTDVWMNISGRWQIIASHYSNATSQ* |
| Ga0116130_10851152 | 3300009762 | Peatland | AYHEKGISKGQPYEYHDRFTDVWMNINGRWQIIASHYSNATSQ* |
| Ga0126373_121349021 | 3300010048 | Tropical Forest Soil | RLHGYMAVVTGNYHESGAGAKHYEYNDRFTDVWMRGGAKWQLIASHYSVPVR* |
| Ga0099796_102855111 | 3300010159 | Vadose Zone Soil | GKPYEYHDRLTDVWMKFGNKWQVISSHYSVPLKQ* |
| Ga0074044_102251711 | 3300010343 | Bog Forest Soil | VHGDTAIVTGAYHEKGESSGKHYEYHDRLTDTWMKAGGELQVVASHYSVPYKS* |
| Ga0126372_123015871 | 3300010360 | Tropical Forest Soil | RMHDNVGVVTGLYHESGEAAGKPYDYRDRLTDVWMKIGGRWQLIASHYSIPSKL* |
| Ga0126372_131313531 | 3300010360 | Tropical Forest Soil | VTGAYFEKGTSNGQPYEYRDRFTDVWVNGGGEWVIFASHYSIPVKE* |
| Ga0126378_114339671 | 3300010361 | Tropical Forest Soil | ISKGKRYEYRDRFTDVWMKTEGQWLLIASHYSIPVQT* |
| Ga0126378_123621221 | 3300010361 | Tropical Forest Soil | VAVVRGAYHERGESGGKRYEYHDRLTDVWMKSGANWQVIASHYSVPVKLGWGNG* |
| Ga0134126_104486231 | 3300010396 | Terrestrial Soil | NTAIVTGAYHEKGESNGKPYDYHDRLTDCWMKLGGRWQVVASHYSVPFKP* |
| Ga0126383_127116812 | 3300010398 | Tropical Forest Soil | VGSSQGKRYEYHDRLTDVWMKNGGEWQLIAAQYSVPLSK* |
| Ga0150983_146538891 | 3300011120 | Forest Soil | VRVRGYVAVVTGAYHEKGTSNHKPYEYHDRLTDVWVKVGNTWQVIASHYSIPVKQ* |
| Ga0137391_105803683 | 3300011270 | Vadose Zone Soil | GKPYEFHDRLTDVWLLIDSRWQVIASHYSIPVKD* |
| Ga0137391_110014861 | 3300011270 | Vadose Zone Soil | MHGKTAVVTGAYHEKGTSKGKPYEYRDRFTDVWMNIKGSWQVIASHYSLASNH* |
| Ga0137393_110769011 | 3300011271 | Vadose Zone Soil | GAYHERGTSNRKPYEYHDRLTDVWVKVGNTWQVIASHYSIPVKQ* |
| Ga0137389_102987623 | 3300012096 | Vadose Zone Soil | GNIVVVIGAYHEKGLSKGKSYEYRDRFTDVWMNIHGTWQVIASHYSIPAR* |
| Ga0137363_101957882 | 3300012202 | Vadose Zone Soil | SHHKPYEYHDRLTDVWGKVGNTWEVIASHYSVPLKQ* |
| Ga0137363_112482622 | 3300012202 | Vadose Zone Soil | HGNVAVVTGAYHEKGTSKGKGYESRDRLTDVWMMNKNGAWQVIAGHYSIPARQ* |
| Ga0137399_102806401 | 3300012203 | Vadose Zone Soil | HEKGDSGGRRYEYHDRLTDIWMKIDGKWQVVASHYSVPLKQ* |
| Ga0137399_106922451 | 3300012203 | Vadose Zone Soil | SKGKPYEYRDRFTDVWMNINGTWQVIASHYSIPSTQ* |
| Ga0137362_113659081 | 3300012205 | Vadose Zone Soil | GKTAVVTGAYHEKGTSKGKPYEYRDRFTDVWMNANGTWQVIASHYSIPASQ* |
| Ga0137381_108168792 | 3300012207 | Vadose Zone Soil | VVIAAYHERGELGGKSYDYHDRLTDVWMKIGGKWQLIASHYSLPANP* |
| Ga0137378_112650321 | 3300012210 | Vadose Zone Soil | QSKGKPYEYRDRLTDVWMNNGGKWQVVASHYSVPVKE* |
| Ga0137387_104128592 | 3300012349 | Vadose Zone Soil | VVIAAYHERGVLDGKSYDYRDRLTDVWMKIAGKWQLIASHYSLPSNP* |
| Ga0137387_111603461 | 3300012349 | Vadose Zone Soil | NIAVVIAAYHERGELGGKSYDYHDRLTDVWMKIGGKWQLIASHYSLPANP* |
| Ga0137386_104340174 | 3300012351 | Vadose Zone Soil | GAYHEKGTSKGKAYESRDRFTDVWMKTAGGWQVIVSHYSIPASQY* |
| Ga0137386_112123951 | 3300012351 | Vadose Zone Soil | ENTAVVIAAYHERGVLDGKSYDYRDRLTDVWMKIAGKWQLIASHYSLPSNP* |
| Ga0137384_103532613 | 3300012357 | Vadose Zone Soil | AYHEKGTSKGRPYESHDRFTDVWTKTNGGWQVLASHYSIPTSQ* |
| Ga0137361_118560462 | 3300012362 | Vadose Zone Soil | GTSHHKPYEYHDRLTDVWGKVGNTWEVIASHYSVPLKQ* |
| Ga0137390_112854202 | 3300012363 | Vadose Zone Soil | TGAYHEKGKTKGKPYEYRDRFTDTWISFDGKWLVLASHYSIPVK* |
| Ga0137398_105925061 | 3300012683 | Vadose Zone Soil | EKGTSKGKPYEYRDRFTDVWMNINGKWQVIASHYSIPVS* |
| Ga0137395_104827601 | 3300012917 | Vadose Zone Soil | GNTAVVTGAYHEKGTEKGKPYEYRDGVTDVWMNINGRWQVIASHYSLRANQ* |
| Ga0137396_100997871 | 3300012918 | Vadose Zone Soil | IGAYHEKGLSKGKPYEYRDRFTDVWTKFNGTWQVVASHYSIPVSK* |
| Ga0137396_107645601 | 3300012918 | Vadose Zone Soil | TAVVTGAYHEKGTSKGKPYEYRDRFTDVWMNTNGTWQVIASHYSIPASQ* |
| Ga0137359_111900112 | 3300012923 | Vadose Zone Soil | MHGNAAVVTGAYREKGKASGKPFDFHDRFTDVWMSKNGRCQLIVSHYSIPVAN* |
| Ga0137413_100213691 | 3300012924 | Vadose Zone Soil | VVTGAYHETGSSKGKHYEYRDRLTDVWMKMGGQWQVVASH* |
| Ga0137419_106565971 | 3300012925 | Vadose Zone Soil | RGKSNGKPYEYHDRLTDVWMKVGGKWQVISSHYSVPMKQ* |
| Ga0137419_106634143 | 3300012925 | Vadose Zone Soil | GAYHEKGTSKGKPYEYRDRFTDVWMNINGTWQVIASHYSIPASQ* |
| Ga0137419_114939602 | 3300012925 | Vadose Zone Soil | GYVAVVTGAYHERGTSNHKPYEYHDRLTDVWVKVGNTWQVIASHYSVPVKQ* |
| Ga0137419_116682571 | 3300012925 | Vadose Zone Soil | GYVAVVTGAYHERGTSNHKPYEYHDRLTDVWVKVGNTWQVIASHYSVPLK* |
| Ga0137416_100071721 | 3300012927 | Vadose Zone Soil | VIIGAYHEKGLSKGKPYEYRDRFTDVWMKIKGTWQVVASHYSIPVS* |
| Ga0137416_117393222 | 3300012927 | Vadose Zone Soil | TGAYHEKGTSKGKPYEYRDRFTDVWMNINGTWQVIASHYSIPASQ* |
| Ga0137416_122336222 | 3300012927 | Vadose Zone Soil | VAVVTGAYHEKGTSKGKSYESRDRATDVWMRNSDGTWKVIAAHYSIPASQ* |
| Ga0164299_115298672 | 3300012958 | Soil | GTSKGKRYEYRDRLTDVWMKIDGQWRLIAAQYSVPLAQ* |
| Ga0164299_115618062 | 3300012958 | Soil | GSSKGKRYEYRDRLTDVWIKNNGQWQLIASQYSVPVK* |
| Ga0126369_127810161 | 3300012971 | Tropical Forest Soil | HVFGNVAVVTGAYHEIGSSKGKRYEYRDRLTDVWMKNSSQWQLIAAQYSVPLAQ* |
| Ga0164309_105785072 | 3300012984 | Soil | SKGKRYEYRDRLTDVWMKIDGQWRLIAAQYSVPLAQ* |
| Ga0164304_104717462 | 3300012986 | Soil | GAYYEKGKQDGKSYEYHDRLTDVWVKSEAGWQVIASHYSVPVK* |
| Ga0164304_111437951 | 3300012986 | Soil | IHESTAVVIAAYHERGVLDGKSYDYRDRLTDVWMKIGGKWQLIASHYSLPSSL* |
| Ga0164307_110872391 | 3300012987 | Soil | IVNGTYHEKGESNGKPYDYHDRLTDCWVKTGGKWQVVASHYSVPYKQ* |
| Ga0157374_108013981 | 3300013296 | Miscanthus Rhizosphere | KGSSRSKRYEYRDRLTDVWMKVDGKWQVISSHYSVPFKP* |
| Ga0120158_104625841 | 3300013772 | Permafrost | SKGRPYESRDRFTDVWIKNASGWHVLASHYAIPSAQ* |
| Ga0163163_129101512 | 3300014325 | Switchgrass Rhizosphere | AVVTGAYHEKGSSRSKRYEYRDRLTDVWMKVDGEWQVISSHYSVPFKP* |
| Ga0137405_13042012 | 3300015053 | Vadose Zone Soil | MHENIAVVTAGYHERGELGGKPYDYRDRLTDVWMKIGGKWQLIASHYSVPTNL* |
| Ga0167668_10008584 | 3300015193 | Glacier Forefield Soil | MHGKTAVVTGAYHEKRTSKGKSYEYRDRFTDVWMNRNGPWQVIASHYSIPASP* |
| Ga0137418_101927621 | 3300015241 | Vadose Zone Soil | AYHEKGTSKGKPYEYRDRFTDVWMNINGTWQVIASHYSIPASQ* |
| Ga0137409_106237012 | 3300015245 | Vadose Zone Soil | MHGNTIVVTGAYHEKGLSKGKPYEYRDRFTDVWMNINGTWQVIASHYSIPARQ* |
| Ga0134072_102271682 | 3300015357 | Grasslands Soil | QDGKAYEYNYRLTDVWLKNEGTWQVISSHYSVPLK* |
| Ga0132257_1024993202 | 3300015373 | Arabidopsis Rhizosphere | AYHEKGESKGKPYEYRDRLTDVWMNTGGRWQVIASHYSVPFNP* |
| Ga0182034_107715413 | 3300016371 | Soil | EKGTSKGKPYEYHDRLTDVWILMDGRWQLIASHYAVRSK |
| Ga0182034_114912412 | 3300016371 | Soil | HGNTAVVTGAYHEKGTLKDKPYEFHDRMTDVWMLIDGRWQVIVSHYAIPVK |
| Ga0182040_105634071 | 3300016387 | Soil | MHGNTAVVTGAYHEVGSSNGKRYEYRDRLTDVWMSVGGNWQVVASHYSVPIKGQ |
| Ga0181505_106800801 | 3300016750 | Peatland | LSNSKPYEYYDRLTDVWVRAGNGWRVLASQRSVQVK |
| Ga0187818_103285202 | 3300017823 | Freshwater Sediment | NTAVVTGAYHEKGTEKGKAYEYRDRFTDVWVNLNGRWKVIASHYSLRANQ |
| Ga0187814_103696262 | 3300017932 | Freshwater Sediment | VTGAYHERGKSNGKPYEYHDRLTDVWVKVGNNWRVLCSHYSVPLK |
| Ga0187809_102681031 | 3300017937 | Freshwater Sediment | YHEKGVSNGKPYEYHDRLTDVWMKAGGKWQVVASHYSVPYK |
| Ga0187819_100022267 | 3300017943 | Freshwater Sediment | MSDLKVHVHGKVAVVTGAYHEAGTSKRRRYEYRDRFTDVWMHGEAGWQLIASYYAIPEKE |
| Ga0187817_100371051 | 3300017955 | Freshwater Sediment | RGNIAVVTGAYHERGQSNHKPYEYHDRLTDVWVKVGNGWRVLCSHYSSPLKP |
| Ga0187779_101248701 | 3300017959 | Tropical Peatland | HGNTAVVTGTYHEKGTEKGKAYEYYDRFTDVWMNSKGAWQVIVSHYSPQTRE |
| Ga0187779_111877782 | 3300017959 | Tropical Peatland | NIAVVTGAYHERGKSNGKPYEYHDRLTDVWVRVGNNWRVLCSHYSVPVK |
| Ga0187776_114649512 | 3300017966 | Tropical Peatland | VQAQKPYDYRDRFTDVWMNLDGKWQVIVSRFSVPATP |
| Ga0187816_101811101 | 3300017995 | Freshwater Sediment | VTGAYHEKGESDGKPYEYRDRLTDVWMKSGGRWQVVASHYSVPVK |
| Ga0187804_102674401 | 3300018006 | Freshwater Sediment | YHEVGTSKRKPYEYLDRFTDVWMHTNAGWQLVASHYGIPAK |
| Ga0187861_101391432 | 3300018020 | Peatland | VRGGGNIAVVTGAYHERGKSNGKPYEYHDRLTDVWVKAGNNWRVLASHYAVPVK |
| Ga0187862_105009742 | 3300018040 | Peatland | AYHEKGISKGQPYEYHDRFTDVWMNINGRWQIIASHYSSATSQ |
| Ga0187871_106370542 | 3300018042 | Peatland | GNTAIVTGQYHEEGVSSGKPYVYHDRMTDVWMLIDGRWQVVASHYSIPVKGASA |
| Ga0187765_104808972 | 3300018060 | Tropical Peatland | VVTGNYHESGELSGKPYEYRDKITDVWMKFGAKWQLIASHRSPLPAS |
| Ga0187784_116145933 | 3300018062 | Tropical Peatland | SNGKPYEYHDRLTDVWMKSGGKWQVVASHYSVPYK |
| Ga0187772_100414541 | 3300018085 | Tropical Peatland | EKGKAYEYYDRFTDVWLNNKGTWQVIVSHYSSRTKD |
| Ga0187774_108510362 | 3300018089 | Tropical Peatland | SNGKPYEYHDRLTDVWMKFGSKWQVIASHYSVPVK |
| Ga0187770_100579881 | 3300018090 | Tropical Peatland | HEKGVSKGKRYEYHDRLTDVWMKTGGKWQVIASHYSVPYK |
| Ga0179592_100917281 | 3300020199 | Vadose Zone Soil | VTGAYHEKGTSKGKPYEYRDRFTDVWMNLNGTWQVIASHYSIPSSQ |
| Ga0179592_101606851 | 3300020199 | Vadose Zone Soil | RGTSHHKPYEYHDRLTDVWGKVGNTWEVIASHYSVPLK |
| Ga0210403_100098411 | 3300020580 | Soil | YHEKGTSKGKPYEYHDRFTDVWMNMNGTWQVIASHYSIPSSQ |
| Ga0210403_100687133 | 3300020580 | Soil | IGAYHEKGTSKGKPYEYHDRFTDVWMNLNGRWQVIVSHYSIPSN |
| Ga0210403_101423085 | 3300020580 | Soil | AYHERGESHGKPYDYRDRLTDVWMKNSAGWQLIASHYSLPMKL |
| Ga0210403_105129261 | 3300020580 | Soil | YHEKGTSNHKPYEYHDRLTDVWVKVGNTWQVIASHYSVPVKE |
| Ga0210399_115872041 | 3300020581 | Soil | GAYHERGESNGKRYEYHDRFTDVWMKVGGKWQVVASHYSVPVK |
| Ga0210395_100903263 | 3300020582 | Soil | VHGDVAVVTGAYYERGTSKGKPYEYRDRFTDVWVGVENKWRILASHYSIPTK |
| Ga0210395_107343912 | 3300020582 | Soil | YHEKGESNGKPYEYHDRLTDIWMKVGGKWQVVASQYSVPSR |
| Ga0210395_112010192 | 3300020582 | Soil | AYHEKGESEGKTYEYHDRLTDVWMKAGGKWQVIASHYSVPVKP |
| Ga0210401_101010051 | 3300020583 | Soil | GNTGVVTGAYYEKGTEKGKSYEYRDRLTDVWMNINGRWRLIASHYSLRANP |
| Ga0210406_104061843 | 3300021168 | Soil | KTAVVTGAYHEKGTSKGKPYEYRDRFTDVWMNMNGPWQVIASHYSIPASP |
| Ga0210406_106843941 | 3300021168 | Soil | VVTGAYHEKGTSNHKPYEYHDRLTDVWVKVGNSWQVIASHYSVPVKQ |
| Ga0210405_100433675 | 3300021171 | Soil | LQVRMYGNTGVVNGAYYEEGTEKGKSYEYRDRLTDVWMNINGRWRLIASHYSLRANP |
| Ga0210405_107772761 | 3300021171 | Soil | YVAVVTGAYHEKGTSNHKPYEYHDRLTDVWVKVGNTWQVIASHYSIPVKP |
| Ga0210405_112104221 | 3300021171 | Soil | NTGVVTGAYYEKGTEKGKSYEYRDRLTDVWMNINGRWRLIASHYSLRANP |
| Ga0210408_102948651 | 3300021178 | Soil | VVTGAYYEKGTEKGKSYEYRDRLTDVWMNINGRWRLIASHYSLRANP |
| Ga0210393_101051133 | 3300021401 | Soil | HEKGDSSGKPYEYHDRLTDVWMKVSGKWQVVASHYSVPSKQ |
| Ga0210393_111364491 | 3300021401 | Soil | YHEVGTEKGKRYEYHDRLTDTWMLIDGRWQVIASHYSVPIK |
| Ga0210385_108812951 | 3300021402 | Soil | SKHKPYEYHDRLTDVWVRSGKGWQVLASHYSVPQK |
| Ga0210387_109252761 | 3300021405 | Soil | AVVTGAYHEVGESNGKRYEYHDRFTDIWMKSSGKWQVVASHYSVPVK |
| Ga0210387_111809142 | 3300021405 | Soil | GHHHQKGESGGKPYEYHDRLTDVWMKIAGKWQVVASHYSVPYKP |
| Ga0210398_102792683 | 3300021477 | Soil | EVGTEKGKRYEYHDRLTDTWMLLDGRWRVIASHYSVPVK |
| Ga0210402_110007191 | 3300021478 | Soil | VAVVTGAYYERGTSKGTPYEYRDRFTDVWVGAENKWRILASHYSIPMK |
| Ga0210402_112813051 | 3300021478 | Soil | VRGGNIAVVTGAYHELGRSNGKPYEYRDRLTDVWVRVGNGWRVLCSHYSVPSK |
| Ga0210410_112384721 | 3300021479 | Soil | TSKGKPYEYHDRFTDVWMNMNGTWQVIASHYSIPSSQ |
| Ga0210410_118140791 | 3300021479 | Soil | VVTGAYHEKGTSNHKPYEYHDRLTDVWVKAGNTWQVLASHYSVPVKQ |
| Ga0210409_104079484 | 3300021559 | Soil | GAVVTGAYYERGTSKGKPYEYRDRFTDVWVGVENKWRILASHYSIPMK |
| Ga0210409_117001621 | 3300021559 | Soil | IAVVTAGYHERGEFGGKSYDYHDRLTDVWMKIGGKWQLIASHYSVPTSL |
| Ga0126371_130642142 | 3300021560 | Tropical Forest Soil | GESGGKGYDYHDRFTDVWMKVAGKWQVVASQYSTPMK |
| Ga0242654_101491511 | 3300022726 | Soil | VRVRGYVAVVTGAYHEKGTSNHKPYEYHDRLTDVWVKVGNTWQVIASHYSIPVKQ |
| Ga0242654_102239802 | 3300022726 | Soil | HGKTAVVTGAYHEKGTSKGKPYEYHDRFTDVWMNMNGTWQVIASHYSIPSSQ |
| Ga0247679_10080221 | 3300024251 | Soil | VIAAYHERGVLDGKSYDYRDRLTDVWMKIGGKWQLIASHYSLPSNL |
| Ga0247679_10548592 | 3300024251 | Soil | AVVIAAYHERGVLDGKSYDYRDRLTDVWMKIGGKWQLIASHYSLPSNL |
| Ga0247687_10317572 | 3300024286 | Soil | IAVVTAGYHERGELGGKPYDYHDRLTDVWMKIGGKWQLIASHYSVPTSL |
| Ga0247690_10233763 | 3300024287 | Soil | YHERGVLDGKPYDYHDRLTDVWMKIGGKWQLIASHYSLPSSL |
| Ga0208355_11058332 | 3300025581 | Arctic Peat Soil | VVTGAYHEKGTEKSKPYEYRDRFTDVWMNLNGRWQVIASHYSLRAN |
| Ga0207692_105016251 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TGTSKGKRYEYRDRLTDVWMKIDGQWRLIAAQYSVPLAQ |
| Ga0207685_102388281 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TSKSKRYEYRDRLTDVWMKVDGQWRLIAAQYSVPLAQ |
| Ga0207684_111483861 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGAYHERGTSHHKPYEYHDRLTDVWGKVGNTWEVIASHYSVPLKQ |
| Ga0207693_113387961 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | TGSYHEKGISNGKPYEYHDRLTDVWVKKEGSWQVIASHYAVPVK |
| Ga0207660_108724154 | 3300025917 | Corn Rhizosphere | VTGAYYEKGKQDGKSYEYHDRLTDVWVKSEAGWQVIAS |
| Ga0207687_106817552 | 3300025927 | Miscanthus Rhizosphere | VVTGAYHETGTFKGKRYEYRDRLTDVWMKIDGQWRLIAAQYSVPLAQ |
| Ga0207700_102770773 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | HEKGTDKGKPYEYRDRLTDIWMNYNGRWRLVASHYSPLSGH |
| Ga0207700_111166931 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGAYHEKGESKGKPYEYRDRLTDVWMNTGGRWQVIASHYSVPFNP |
| Ga0207664_114225262 | 3300025929 | Agricultural Soil | AYHEKGESKGKPYEYHDRLTDVWMKIAGRWQVIASHYSVPSK |
| Ga0207661_119370091 | 3300025944 | Corn Rhizosphere | HEKGESNGKPYDYHDRLTDCWVKTGGKWQVVASHYSVPYKP |
| Ga0207677_106595922 | 3300026023 | Miscanthus Rhizosphere | NSGGKRYEYHDRLTDVWMKIDGRWQVISSHYSVPLRQ |
| Ga0207702_121833942 | 3300026078 | Corn Rhizosphere | AVVTGAYHEVGSSQGKRYEYHDRLTDVWMKNGSEWQLIAAQYSVPLPK |
| Ga0209055_10760051 | 3300026309 | Soil | GAYHEKGTSKGKPYEYRDRFTDVWLNMNGAWQVIASHYSIPARE |
| Ga0209686_11310741 | 3300026315 | Soil | NIAVVTGAYHERGELGGKAYDYHDRLTDVWMKVGGKWLLIASHYSVPARP |
| Ga0209802_12052873 | 3300026328 | Soil | NIDVVTAGYHERGELGGKPYDYHDRLTDVWMKIGGKWQLIASHYSLPASL |
| Ga0257170_10680411 | 3300026351 | Soil | YVAVVTGAYHERGTSNRKPYEYHDRLTDVWVKVGNTWQVIASHYSVPLKQ |
| Ga0257164_10767901 | 3300026497 | Soil | GAYHEKGKSNGKPYEYRDRLTDVWMKVGNKWQVISSHYSVPLKQ |
| Ga0257181_10503531 | 3300026499 | Soil | NAAVVTGVYHEKGKSNGKPYEYRDRLTDVWMRVGNKWQVISSHYSVPFKQ |
| Ga0209156_104147422 | 3300026547 | Soil | AYHEKGMSKGKPYESRDRLTDVWIKTNGAWQVVAAHYSIPVSE |
| Ga0209161_104707231 | 3300026548 | Soil | VAIVTGAYHEKGMSKRKPYESRDRLTDIWIKTNGAWQVVAAHYSIPVSE |
| Ga0179587_103428291 | 3300026557 | Vadose Zone Soil | GAYHEKGTSKGKPYEYRDRFTDVWMNLNGRWQVIVSHYSIPSP |
| Ga0208365_10159432 | 3300027070 | Forest Soil | GESKGKRYEYHDRFTDIWMKAGGKWQVVASHYSVPMK |
| Ga0209904_10031251 | 3300027394 | Thawing Permafrost | HEKGTEKGKPYEYRDRLTDVWVNLNGRWRVIASHYSLRAN |
| Ga0209735_10041035 | 3300027562 | Forest Soil | MHGKTAVVTGGYHEKGTSKGKPYEYRDRFTDVWMNMNGAWQVIASHYSIPASQ |
| Ga0209060_102147882 | 3300027826 | Surface Soil | MRRKPVYTLTGAYHEKGTDKGKGYEYRDRLTDIWMNYNGNWRLVASHYSLSSSH |
| Ga0209580_105965742 | 3300027842 | Surface Soil | HEKGTSKGKPYEYRDRLTDVWVNGEGAWQLIASHYSIPVK |
| Ga0209580_107000581 | 3300027842 | Surface Soil | GESNGKRYEYHDRLTDVWMKVGGRWQVVASHYSVPVK |
| Ga0209579_105748582 | 3300027869 | Surface Soil | TGAYHEKGESNGKPYEYHDRFTDTWMKLGGKWQVVASHYSVPYKP |
| Ga0209579_106089192 | 3300027869 | Surface Soil | SDGKRYEYHDRFTDVWMKNGGKWQVISSHYSIPAK |
| Ga0209068_107393601 | 3300027894 | Watersheds | AHGNVAVVTGAYHEKGTSKGKPYEYHDRFTDVWMNSGGTWQVIASHYSTPVN |
| Ga0209067_109123861 | 3300027898 | Watersheds | SNGKPYEYRDRLTDVWVREGNSWRVLSSHYSVPLK |
| Ga0268266_112160801 | 3300028379 | Switchgrass Rhizosphere | TGAYHEKGSSRSKRYEYRDRLTDVWMKVDGKWQVISSHYSVPFKP |
| Ga0137415_105246332 | 3300028536 | Vadose Zone Soil | GKTAVVTGAYHEKGTSKGKPYEYRDRFTDVWMNINGTWQVIASHYSIPASQ |
| Ga0265338_108011903 | 3300028800 | Rhizosphere | RGESNGKRYEYHDRLTDVWMKSGGKWQVVASHYSVPFKQ |
| Ga0302228_100245955 | 3300028808 | Palsa | ESNGKRYEYHDRLTDVWMKSGGKWQVVASHYSVPVK |
| Ga0311332_104554462 | 3300029984 | Fen | AYHETGDSKGKPYEYHDRLTDVWMKVDGKWQVIASHYSVPLK |
| Ga0302271_104734401 | 3300029998 | Bog | ETGDSKGKPYEYHDRLTDVWMKVDGKWQVIASHYSVPLK |
| Ga0302177_104022161 | 3300030053 | Palsa | NLRIRMRGNLAVVTGAYHERGESNHKPYEYHDRLTDVWVKVGNSWQVLASHYSVPLK |
| Ga0311356_119810941 | 3300030617 | Palsa | SNHKPYEYHDRLTDVWVKVGNSWQVLASHYSVPLK |
| Ga0265339_103596491 | 3300031249 | Rhizosphere | YHEKGESNGKPYEYHDRLTDVWMKVSGKWQVVASQYSVPSKQ |
| Ga0265316_107496741 | 3300031344 | Rhizosphere | VVTGAYHEKGESNGKPYEYHDRLTDIWMKVGGKWQVVASQYSVPSKQ |
| Ga0170818_1012174142 | 3300031474 | Forest Soil | AVVTGAYHERGDSNGKRYEYHDRLTDVWMKSGGKWQVVASHYSVPIK |
| Ga0310686_1050932921 | 3300031708 | Soil | KGESNGKPYEYHDRLTDVWMKVGGKWQVVASHYSVPSKQ |
| Ga0307476_102342451 | 3300031715 | Hardwood Forest Soil | MHGNTAVITGAYHERGESSGKRYEYHDRFTDIWMKNNGKWQVVASHYSVPMK |
| Ga0307469_110936392 | 3300031720 | Hardwood Forest Soil | VTGAYHEKGTSKGKAYEYRDRFTDVWMNLNGRWQVIVSHYSIPSQ |
| Ga0307477_105871391 | 3300031753 | Hardwood Forest Soil | EKGTEKGKPYEYRDRFTDVWMNINDRWQVIASHYSLRAQ |
| Ga0307477_106058982 | 3300031753 | Hardwood Forest Soil | NTAAVVTGAYHEKGVSQGKPYEYHDRFTDVWMNSEGRWQIIASHYSIPAKN |
| Ga0307475_103678542 | 3300031754 | Hardwood Forest Soil | AVVTAAYHESGELGGKYYDYRDRLTDVWMKIGGKWQLIASHYSLPVNR |
| Ga0307473_102710451 | 3300031820 | Hardwood Forest Soil | VTGAYHEKGTIKGKPYENRDRFTDVWMLIDGRWQVIASHYSISVQ |
| Ga0307473_112895861 | 3300031820 | Hardwood Forest Soil | NTAVVTGAYHEKGTSSGKPYEYHDRLTDVWMLIDGRWQVIASHYAIPAK |
| Ga0307478_102953132 | 3300031823 | Hardwood Forest Soil | VVTGAYHEKGTSKGKPYEYHDRFTDVWMILNGRWQVIVSHYSIPSNL |
| Ga0307478_103805832 | 3300031823 | Hardwood Forest Soil | GAYHEKGTSNHKPYEYHDRLTDVWVKVGNSWEVIASHYSVPLK |
| Ga0307478_117655712 | 3300031823 | Hardwood Forest Soil | TGGYHESGATNGKPYEYHDRLTDVWMLIGGRWQVVASHYSIPAKEGI |
| Ga0310917_101301731 | 3300031833 | Soil | TIKGKPYEYHDRFTDVWMNVDGRWQVIASHYSIPVQ |
| Ga0307479_104719391 | 3300031962 | Hardwood Forest Soil | TAVVTGAYHEKGTEKGKPYEYRDRFTDVWMNINDRWQVIASHYSLRAQ |
| Ga0307479_104954622 | 3300031962 | Hardwood Forest Soil | SNHKPYEYHDRLTDVWVKVGNSWEVIASHYSVPLK |
| Ga0307479_105013952 | 3300031962 | Hardwood Forest Soil | EKGTSKGKPYEYRDRFTDVWMNGNGTWQVIASHYSIPAGQ |
| Ga0307471_1013268582 | 3300032180 | Hardwood Forest Soil | HEKGTIKGKPYEYRDRFTVVRMLIDGRWQLIASHHSIPVQ |
| Ga0307471_1020878742 | 3300032180 | Hardwood Forest Soil | KGKPYEYRDRLTDVWVKSQAGWQVIASHYSVPLTP |
| Ga0307471_1036975562 | 3300032180 | Hardwood Forest Soil | SYHEKGKSDGKGYEYHDRLTDVWIKSAGKWQVVSSHYSVPFKP |
| Ga0307472_1000062841 | 3300032205 | Hardwood Forest Soil | NTVVVTGAYHEKGTVKGKPYEYHDRMTDVWMNIDGRWQVIASHYSIPVQ |
| Ga0306920_1028969281 | 3300032261 | Soil | YHEIGSSKGKRYEYRDRLTDVWMKNGSQWQLIAAQYSVPLAQ |
| Ga0335082_108440952 | 3300032782 | Soil | VTGNYHESGELSGKPYDYRDKVTNVWMKIAAKWQLIASQRTPIPKP |
| Ga0335079_106166321 | 3300032783 | Soil | GESKGKTYEYHDRFTDTWMKVSGKWQVVASHYSVPYKQ |
| Ga0335080_100682035 | 3300032828 | Soil | GESKAKRYEYRDRLTDTWMKLDGRWQVVASHYSVPLAQ |
| Ga0335070_114757552 | 3300032829 | Soil | HEKGQSNGKPYEYHDRLTDVWMKFGNQWQVIASHYSVPVK |
| Ga0335081_106172001 | 3300032892 | Soil | HGNAAVVTGAYHEVGSSKGKHYEYRDRMTDVWMKIDGRWQVIASHYSVPLKR |
| Ga0335083_102249451 | 3300032954 | Soil | VTGAYHEVGESKGKRYEYHDRLTDVWMKSGGKWQVIASHYSVPVH |
| Ga0335084_109455491 | 3300033004 | Soil | VTGAYHEKGESDGKSYEYRDRLTDVWIKNGGKWQVIASHYSVPLK |
| Ga0310811_110961142 | 3300033475 | Soil | AYHETGESKGKPYEYRDRLTDVWMNTGGRWQVIASHYSVPFNP |
| Ga0334847_000384_27_143 | 3300033826 | Soil | MGLSKGKPYEYHDRLTDVWVKVGNSWRVLSSHYSIPMK |
| ⦗Top⦘ |