


| Basic Information | |
|---|---|
| Family ID | F014101 |
| Family Type | Metagenome |
| Number of Sequences | 265 |
| Average Sequence Length | 39 residues |
| Representative Sequence | PNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA |
| Number of Associated Samples | 32 |
| Number of Associated Scaffolds | 265 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 26.98 % |
| % of genes near scaffold ends (potentially truncated) | 88.30 % |
| % of genes from short scaffolds (< 2000 bps) | 87.17 % |
| Associated GOLD sequencing projects | 25 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.283 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater (84.528 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.698 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (88.302 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.18% β-sheet: 0.00% Coil/Unstructured: 81.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 265 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 1.51 |
| PF14329 | DUF4386 | 1.51 |
| PF13676 | TIR_2 | 1.51 |
| PF11185 | DUF2971 | 1.51 |
| PF10592 | AIPR | 1.51 |
| PF03235 | DUF262 | 1.13 |
| PF13175 | AAA_15 | 1.13 |
| PF00069 | Pkinase | 1.13 |
| PF04365 | BrnT_toxin | 0.75 |
| PF03887 | YfbU | 0.75 |
| PF14022 | DUF4238 | 0.75 |
| PF01042 | Ribonuc_L-PSP | 0.75 |
| PF13302 | Acetyltransf_3 | 0.75 |
| PF08867 | FRG | 0.75 |
| PF13391 | HNH_2 | 0.75 |
| PF01381 | HTH_3 | 0.75 |
| PF12697 | Abhydrolase_6 | 0.75 |
| PF07589 | PEP-CTERM | 0.38 |
| PF13560 | HTH_31 | 0.38 |
| PF13271 | DUF4062 | 0.38 |
| PF00893 | Multi_Drug_Res | 0.38 |
| PF08534 | Redoxin | 0.38 |
| PF14534 | DUF4440 | 0.38 |
| PF00692 | dUTPase | 0.38 |
| PF12681 | Glyoxalase_2 | 0.38 |
| PF13649 | Methyltransf_25 | 0.38 |
| PF02518 | HATPase_c | 0.38 |
| PF08241 | Methyltransf_11 | 0.38 |
| PF05257 | CHAP | 0.38 |
| PF01391 | Collagen | 0.38 |
| PF14834 | GST_C_4 | 0.38 |
| PF00226 | DnaJ | 0.38 |
| PF12847 | Methyltransf_18 | 0.38 |
| PF14491 | DUF4435 | 0.38 |
| PF07603 | DUF1566 | 0.38 |
| PF13091 | PLDc_2 | 0.38 |
| PF08861 | DUF1828 | 0.38 |
| PF16162 | DUF4868 | 0.38 |
| PF06094 | GGACT | 0.38 |
| PF13432 | TPR_16 | 0.38 |
| PF00023 | Ank | 0.38 |
| PF13489 | Methyltransf_23 | 0.38 |
| PF00078 | RVT_1 | 0.38 |
| PF14072 | DndB | 0.38 |
| PF05015 | HigB-like_toxin | 0.38 |
| PF00533 | BRCT | 0.38 |
| PF05168 | HEPN | 0.38 |
| PF11528 | DUF3224 | 0.38 |
| PF14384 | BrnA_antitoxin | 0.38 |
| PF13643 | DUF4145 | 0.38 |
| PF01909 | NTP_transf_2 | 0.38 |
| PF14279 | HNH_5 | 0.38 |
| PF07110 | EthD | 0.38 |
| PF01926 | MMR_HSR1 | 0.38 |
| PF13289 | SIR2_2 | 0.38 |
| PF01551 | Peptidase_M23 | 0.38 |
| PF13673 | Acetyltransf_10 | 0.38 |
| PF13304 | AAA_21 | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 265 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.53 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 1.13 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.75 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.75 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.38 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.38 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.38 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.38 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.38 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.28 % |
| Unclassified | root | N/A | 34.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_100451110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1228 | Open in IMG/M |
| 3300005487|Ga0074211_101670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1321 | Open in IMG/M |
| 3300005639|Ga0077110_1015422 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300005982|Ga0075156_10266798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 901 | Open in IMG/M |
| 3300007517|Ga0105045_10085232 | Not Available | 2773 | Open in IMG/M |
| 3300007517|Ga0105045_10113876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → Corallococcus llansteffanensis | 2333 | Open in IMG/M |
| 3300007517|Ga0105045_10184363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1721 | Open in IMG/M |
| 3300007517|Ga0105045_10297810 | Not Available | 1253 | Open in IMG/M |
| 3300007517|Ga0105045_10346710 | Not Available | 1128 | Open in IMG/M |
| 3300007517|Ga0105045_10352855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1115 | Open in IMG/M |
| 3300007517|Ga0105045_10353675 | Not Available | 1113 | Open in IMG/M |
| 3300007517|Ga0105045_10356416 | Not Available | 1107 | Open in IMG/M |
| 3300007517|Ga0105045_10383788 | Not Available | 1053 | Open in IMG/M |
| 3300007517|Ga0105045_10391437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. | 1039 | Open in IMG/M |
| 3300007517|Ga0105045_10415437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 997 | Open in IMG/M |
| 3300007517|Ga0105045_10420694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 988 | Open in IMG/M |
| 3300007517|Ga0105045_10427612 | Not Available | 977 | Open in IMG/M |
| 3300007517|Ga0105045_10438610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JG5 | 960 | Open in IMG/M |
| 3300007517|Ga0105045_10442602 | Not Available | 954 | Open in IMG/M |
| 3300007517|Ga0105045_10484359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300007517|Ga0105045_10501981 | Not Available | 875 | Open in IMG/M |
| 3300007517|Ga0105045_10517875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Quisquiliibacterium → Quisquiliibacterium transsilvanicum | 856 | Open in IMG/M |
| 3300007517|Ga0105045_10519133 | Not Available | 855 | Open in IMG/M |
| 3300007517|Ga0105045_10544517 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300007517|Ga0105045_10550778 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300007517|Ga0105045_10584198 | Not Available | 788 | Open in IMG/M |
| 3300007517|Ga0105045_10598478 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 775 | Open in IMG/M |
| 3300007517|Ga0105045_10632843 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300007517|Ga0105045_10678563 | Not Available | 711 | Open in IMG/M |
| 3300007517|Ga0105045_10721741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella lactea | 682 | Open in IMG/M |
| 3300007517|Ga0105045_10729832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 677 | Open in IMG/M |
| 3300007517|Ga0105045_10765329 | Not Available | 655 | Open in IMG/M |
| 3300007517|Ga0105045_10811269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax carolinensis | 630 | Open in IMG/M |
| 3300007517|Ga0105045_10813467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 629 | Open in IMG/M |
| 3300007517|Ga0105045_10848892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 611 | Open in IMG/M |
| 3300007517|Ga0105045_10897414 | Not Available | 589 | Open in IMG/M |
| 3300007517|Ga0105045_10904621 | Not Available | 586 | Open in IMG/M |
| 3300007517|Ga0105045_10992049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300007521|Ga0105044_10185995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2129 | Open in IMG/M |
| 3300007521|Ga0105044_10231884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium AAP51 | 1825 | Open in IMG/M |
| 3300007521|Ga0105044_10242640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. AJA081-3 | 1767 | Open in IMG/M |
| 3300007521|Ga0105044_10414254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1206 | Open in IMG/M |
| 3300007521|Ga0105044_10598670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus | 924 | Open in IMG/M |
| 3300007521|Ga0105044_10644391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300007521|Ga0105044_10674775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300007521|Ga0105044_10684243 | Not Available | 839 | Open in IMG/M |
| 3300007521|Ga0105044_10733277 | Not Available | 798 | Open in IMG/M |
| 3300007521|Ga0105044_10734193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 797 | Open in IMG/M |
| 3300007521|Ga0105044_10920521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 678 | Open in IMG/M |
| 3300007521|Ga0105044_10987232 | Not Available | 645 | Open in IMG/M |
| 3300007521|Ga0105044_11272384 | Not Available | 541 | Open in IMG/M |
| 3300007799|Ga0105049_10172855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas arboricola | 1894 | Open in IMG/M |
| 3300007799|Ga0105049_10175468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Rugamonas → Rugamonas rubra | 1874 | Open in IMG/M |
| 3300007799|Ga0105049_10300148 | Not Available | 1297 | Open in IMG/M |
| 3300007799|Ga0105049_10308860 | Not Available | 1272 | Open in IMG/M |
| 3300007799|Ga0105049_10489968 | Not Available | 920 | Open in IMG/M |
| 3300007799|Ga0105049_10634045 | Not Available | 767 | Open in IMG/M |
| 3300007799|Ga0105049_10775924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 665 | Open in IMG/M |
| 3300007799|Ga0105049_10880850 | Not Available | 609 | Open in IMG/M |
| 3300007799|Ga0105049_10972584 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300007799|Ga0105049_11005513 | Not Available | 556 | Open in IMG/M |
| 3300007799|Ga0105049_11011183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Chitinimonas → Chitinimonas arctica | 554 | Open in IMG/M |
| 3300009032|Ga0105048_10149937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2929 | Open in IMG/M |
| 3300009032|Ga0105048_10160539 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
| 3300009032|Ga0105048_10166178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium terrae | 2727 | Open in IMG/M |
| 3300009032|Ga0105048_10220556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2235 | Open in IMG/M |
| 3300009032|Ga0105048_10241354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2097 | Open in IMG/M |
| 3300009032|Ga0105048_10273038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus | 1919 | Open in IMG/M |
| 3300009032|Ga0105048_10294127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Chamaesiphonaceae → Chamaesiphon → Chamaesiphon minutus → Chamaesiphon minutus PCC 6605 | 1818 | Open in IMG/M |
| 3300009032|Ga0105048_10365099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas methanica | 1552 | Open in IMG/M |
| 3300009032|Ga0105048_10389517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga → unclassified Candidatus Nitrotoga → Candidatus Nitrotoga sp. 1052 | 1478 | Open in IMG/M |
| 3300009032|Ga0105048_10390241 | Not Available | 1476 | Open in IMG/M |
| 3300009032|Ga0105048_10397260 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300009032|Ga0105048_10446513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → unclassified Bordetella → Bordetella sp. N | 1334 | Open in IMG/M |
| 3300009032|Ga0105048_10450216 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300009032|Ga0105048_10493078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Pseudoduganella → Pseudoduganella rivuli | 1237 | Open in IMG/M |
| 3300009032|Ga0105048_10508506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1208 | Open in IMG/M |
| 3300009032|Ga0105048_10546441 | Not Available | 1143 | Open in IMG/M |
| 3300009032|Ga0105048_10569451 | Not Available | 1107 | Open in IMG/M |
| 3300009032|Ga0105048_10654476 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300009032|Ga0105048_10664226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae | 983 | Open in IMG/M |
| 3300009032|Ga0105048_10665695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 981 | Open in IMG/M |
| 3300009032|Ga0105048_10672223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum | 974 | Open in IMG/M |
| 3300009032|Ga0105048_10684893 | Not Available | 959 | Open in IMG/M |
| 3300009032|Ga0105048_10736112 | Not Available | 907 | Open in IMG/M |
| 3300009032|Ga0105048_10740465 | Not Available | 902 | Open in IMG/M |
| 3300009032|Ga0105048_10768174 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300009032|Ga0105048_10769080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena → Pseudanabaena sp. | 876 | Open in IMG/M |
| 3300009032|Ga0105048_10807896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter salarius | 843 | Open in IMG/M |
| 3300009032|Ga0105048_10820258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 833 | Open in IMG/M |
| 3300009032|Ga0105048_10837274 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300009032|Ga0105048_10916410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 764 | Open in IMG/M |
| 3300009032|Ga0105048_11064926 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300009032|Ga0105048_11075330 | Not Available | 675 | Open in IMG/M |
| 3300009032|Ga0105048_11090364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 668 | Open in IMG/M |
| 3300009032|Ga0105048_11107759 | Not Available | 660 | Open in IMG/M |
| 3300009032|Ga0105048_11334732 | Not Available | 573 | Open in IMG/M |
| 3300009032|Ga0105048_11351326 | Not Available | 568 | Open in IMG/M |
| 3300009032|Ga0105048_11476357 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300009032|Ga0105048_11477190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. PB120 | 531 | Open in IMG/M |
| 3300009083|Ga0105047_10030981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 7872 | Open in IMG/M |
| 3300009083|Ga0105047_10117720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 3278 | Open in IMG/M |
| 3300009083|Ga0105047_10142012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2879 | Open in IMG/M |
| 3300009083|Ga0105047_10149325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas reinekei | 2781 | Open in IMG/M |
| 3300009083|Ga0105047_10178764 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2448 | Open in IMG/M |
| 3300009083|Ga0105047_10197857 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300009083|Ga0105047_10215166 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300009083|Ga0105047_10221162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2102 | Open in IMG/M |
| 3300009083|Ga0105047_10251597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1914 | Open in IMG/M |
| 3300009083|Ga0105047_10285312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. Is79A3 | 1747 | Open in IMG/M |
| 3300009083|Ga0105047_10293289 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300009083|Ga0105047_10321934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1599 | Open in IMG/M |
| 3300009083|Ga0105047_10334595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1554 | Open in IMG/M |
| 3300009083|Ga0105047_10336430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Formivibrio → Formivibrio citricus | 1548 | Open in IMG/M |
| 3300009083|Ga0105047_10369378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1445 | Open in IMG/M |
| 3300009083|Ga0105047_10409224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1338 | Open in IMG/M |
| 3300009083|Ga0105047_10417671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1317 | Open in IMG/M |
| 3300009083|Ga0105047_10430977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1287 | Open in IMG/M |
| 3300009083|Ga0105047_10444306 | Not Available | 1257 | Open in IMG/M |
| 3300009083|Ga0105047_10477039 | Not Available | 1192 | Open in IMG/M |
| 3300009083|Ga0105047_10492744 | Not Available | 1163 | Open in IMG/M |
| 3300009083|Ga0105047_10545715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1076 | Open in IMG/M |
| 3300009083|Ga0105047_10545744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Limnobacter → unclassified Limnobacter → Limnobacter sp. SAORIC-690 | 1076 | Open in IMG/M |
| 3300009083|Ga0105047_10596578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1005 | Open in IMG/M |
| 3300009083|Ga0105047_10679246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 910 | Open in IMG/M |
| 3300009083|Ga0105047_10702622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → Desulfobacter postgatei → Desulfobacter postgatei 2ac9 | 887 | Open in IMG/M |
| 3300009083|Ga0105047_10708189 | Not Available | 882 | Open in IMG/M |
| 3300009083|Ga0105047_10709750 | Not Available | 880 | Open in IMG/M |
| 3300009083|Ga0105047_10790900 | Not Available | 810 | Open in IMG/M |
| 3300009083|Ga0105047_10800240 | Not Available | 803 | Open in IMG/M |
| 3300009083|Ga0105047_10860805 | Not Available | 759 | Open in IMG/M |
| 3300009083|Ga0105047_10890087 | Not Available | 741 | Open in IMG/M |
| 3300009083|Ga0105047_11207487 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009083|Ga0105047_11316444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300009083|Ga0105047_11382664 | Not Available | 534 | Open in IMG/M |
| 3300009083|Ga0105047_11386371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 533 | Open in IMG/M |
| 3300009083|Ga0105047_11461724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga | 513 | Open in IMG/M |
| 3300009083|Ga0105047_11504807 | Not Available | 503 | Open in IMG/M |
| 3300009084|Ga0105046_10300423 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300009084|Ga0105046_10308239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1682 | Open in IMG/M |
| 3300009084|Ga0105046_10319699 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira kmetyi | 1638 | Open in IMG/M |
| 3300009084|Ga0105046_10328480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga aromaticivorans | 1606 | Open in IMG/M |
| 3300009084|Ga0105046_10332467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter phosphatis | 1591 | Open in IMG/M |
| 3300009084|Ga0105046_10342761 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300009084|Ga0105046_10457891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. dw_954 | 1252 | Open in IMG/M |
| 3300009084|Ga0105046_10503226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1164 | Open in IMG/M |
| 3300009084|Ga0105046_10550434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter glycinis | 1087 | Open in IMG/M |
| 3300009084|Ga0105046_10641743 | Not Available | 965 | Open in IMG/M |
| 3300009084|Ga0105046_10661949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 942 | Open in IMG/M |
| 3300009084|Ga0105046_10678101 | Not Available | 925 | Open in IMG/M |
| 3300009084|Ga0105046_10788458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas | 823 | Open in IMG/M |
| 3300009084|Ga0105046_10792108 | Not Available | 820 | Open in IMG/M |
| 3300009084|Ga0105046_10851916 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300009084|Ga0105046_10858935 | Not Available | 770 | Open in IMG/M |
| 3300009084|Ga0105046_10935547 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009084|Ga0105046_10939030 | Not Available | 718 | Open in IMG/M |
| 3300009084|Ga0105046_10956269 | Not Available | 708 | Open in IMG/M |
| 3300009084|Ga0105046_10978548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Oceanospirillum → Oceanospirillum multiglobuliferum | 696 | Open in IMG/M |
| 3300009084|Ga0105046_11016686 | Not Available | 676 | Open in IMG/M |
| 3300009084|Ga0105046_11022680 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009084|Ga0105046_11041159 | Not Available | 664 | Open in IMG/M |
| 3300009084|Ga0105046_11073919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 648 | Open in IMG/M |
| 3300009084|Ga0105046_11504904 | Not Available | 505 | Open in IMG/M |
| 3300009183|Ga0114974_10184309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1285 | Open in IMG/M |
| 3300009686|Ga0123338_10102243 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300010158|Ga0114960_10409320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 662 | Open in IMG/M |
| 3300012044|Ga0136636_10062084 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300012044|Ga0136636_10075328 | Not Available | 1640 | Open in IMG/M |
| 3300012044|Ga0136636_10138060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
| 3300012044|Ga0136636_10172641 | Not Available | 987 | Open in IMG/M |
| 3300012044|Ga0136636_10194500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 917 | Open in IMG/M |
| 3300012044|Ga0136636_10245317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. | 793 | Open in IMG/M |
| 3300012044|Ga0136636_10347080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga | 639 | Open in IMG/M |
| 3300012044|Ga0136636_10431148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella lactea | 560 | Open in IMG/M |
| 3300012044|Ga0136636_10451149 | Not Available | 544 | Open in IMG/M |
| 3300013097|Ga0136639_10337135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus | 590 | Open in IMG/M |
| 3300013286|Ga0136641_1107568 | Not Available | 772 | Open in IMG/M |
| 3300013286|Ga0136641_1134082 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300015360|Ga0163144_10109570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4318 | Open in IMG/M |
| 3300015360|Ga0163144_10320250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1948 | Open in IMG/M |
| 3300015360|Ga0163144_10467007 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300015360|Ga0163144_10512152 | Not Available | 1351 | Open in IMG/M |
| 3300015360|Ga0163144_10524449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 1326 | Open in IMG/M |
| 3300015360|Ga0163144_10591293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
| 3300015360|Ga0163144_10642297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1130 | Open in IMG/M |
| 3300015360|Ga0163144_11222387 | Not Available | 688 | Open in IMG/M |
| 3300015360|Ga0163144_11462408 | Not Available | 603 | Open in IMG/M |
| 3300015360|Ga0163144_11685559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas paludis | 544 | Open in IMG/M |
| 3300020180|Ga0163155_10328155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 704 | Open in IMG/M |
| 3300020180|Ga0163155_10493606 | Not Available | 519 | Open in IMG/M |
| 3300020192|Ga0163147_10453477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae | 621 | Open in IMG/M |
| 3300020201|Ga0163154_10162573 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300020201|Ga0163154_10164438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium AAP51 | 1219 | Open in IMG/M |
| 3300020203|Ga0163148_10285586 | Not Available | 859 | Open in IMG/M |
| 3300020203|Ga0163148_10306558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300020219|Ga0163146_10183291 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300020596|Ga0163149_10430592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 686 | Open in IMG/M |
| 3300022561|Ga0212090_10338813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1134 | Open in IMG/M |
| 3300025147|Ga0209511_1111578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1112 | Open in IMG/M |
| 3300027823|Ga0209490_10381518 | Not Available | 824 | Open in IMG/M |
| 3300027823|Ga0209490_10489698 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300027823|Ga0209490_10506913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia | 661 | Open in IMG/M |
| 3300027850|Ga0209591_10490458 | Not Available | 811 | Open in IMG/M |
| 3300027850|Ga0209591_10585575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. RAC08 | 704 | Open in IMG/M |
| 3300027850|Ga0209591_10692894 | Not Available | 613 | Open in IMG/M |
| 3300027850|Ga0209591_10697775 | Not Available | 610 | Open in IMG/M |
| 3300027850|Ga0209591_10836574 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027878|Ga0209181_10133353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2352 | Open in IMG/M |
| 3300027878|Ga0209181_10210684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → unclassified Janthinobacterium → Janthinobacterium sp. TND4EL3 | 1737 | Open in IMG/M |
| 3300027878|Ga0209181_10222265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Rugamonas → Rugamonas rubra | 1675 | Open in IMG/M |
| 3300027878|Ga0209181_10253810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1529 | Open in IMG/M |
| 3300027878|Ga0209181_10260199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1503 | Open in IMG/M |
| 3300027878|Ga0209181_10265534 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira kmetyi | 1482 | Open in IMG/M |
| 3300027878|Ga0209181_10278567 | Not Available | 1433 | Open in IMG/M |
| 3300027878|Ga0209181_10333495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Pseudoduganella → Pseudoduganella rivuli | 1262 | Open in IMG/M |
| 3300027878|Ga0209181_10398049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax terrae | 1110 | Open in IMG/M |
| 3300027878|Ga0209181_10531972 | Not Available | 895 | Open in IMG/M |
| 3300027878|Ga0209181_10540563 | Not Available | 884 | Open in IMG/M |
| 3300027878|Ga0209181_10678575 | Not Available | 741 | Open in IMG/M |
| 3300027878|Ga0209181_10735282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300032420|Ga0335397_10106925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas thiooxydans | 2867 | Open in IMG/M |
| 3300032420|Ga0335397_10149249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB4 | 2309 | Open in IMG/M |
| 3300032420|Ga0335397_10289254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1465 | Open in IMG/M |
| 3300032420|Ga0335397_10309636 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300032420|Ga0335397_10343961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Paraglaciecola → Paraglaciecola hydrolytica | 1292 | Open in IMG/M |
| 3300032420|Ga0335397_10379483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1202 | Open in IMG/M |
| 3300032420|Ga0335397_10392289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. | 1172 | Open in IMG/M |
| 3300032420|Ga0335397_10438695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
| 3300032420|Ga0335397_10549952 | Not Available | 905 | Open in IMG/M |
| 3300032420|Ga0335397_10629648 | Not Available | 813 | Open in IMG/M |
| 3300032420|Ga0335397_10677922 | Not Available | 766 | Open in IMG/M |
| 3300032420|Ga0335397_10833655 | Not Available | 648 | Open in IMG/M |
| 3300032420|Ga0335397_10852767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 636 | Open in IMG/M |
| 3300032420|Ga0335397_10941660 | Not Available | 586 | Open in IMG/M |
| 3300032431|Ga0335395_10087180 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300032431|Ga0335395_10135424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → unclassified Comamonas → Comamonas sp. B-9 | 1764 | Open in IMG/M |
| 3300032431|Ga0335395_10217355 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300032431|Ga0335395_10251152 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300032431|Ga0335395_10330931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. CG_9.11 | 1042 | Open in IMG/M |
| 3300032431|Ga0335395_10350813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300032431|Ga0335395_10635675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300032431|Ga0335395_10712337 | Not Available | 602 | Open in IMG/M |
| 3300032431|Ga0335395_10893029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300032456|Ga0335394_10249727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1651 | Open in IMG/M |
| 3300032456|Ga0335394_10335967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1338 | Open in IMG/M |
| 3300032456|Ga0335394_10337320 | Not Available | 1334 | Open in IMG/M |
| 3300032456|Ga0335394_10470045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1041 | Open in IMG/M |
| 3300032456|Ga0335394_10471058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. TS-CS-82 | 1040 | Open in IMG/M |
| 3300032456|Ga0335394_10483249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1019 | Open in IMG/M |
| 3300032456|Ga0335394_10618173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 838 | Open in IMG/M |
| 3300032456|Ga0335394_10720328 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300032456|Ga0335394_10872858 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 84.53% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 7.17% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.13% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 1.13% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.38% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005487 | Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichment | Environmental | Open in IMG/M |
| 3300005639 | Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Combined assembly reannotation Gp0050987, Gp0050988, Gp0050989, Gp0050990, Gp0050991 | Environmental | Open in IMG/M |
| 3300005982 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA | Engineered | Open in IMG/M |
| 3300007517 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009084 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009686 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300012044 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ852 (21.06) | Environmental | Open in IMG/M |
| 3300013097 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ859 (21.06) | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300020180 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1 | Environmental | Open in IMG/M |
| 3300020192 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1 | Environmental | Open in IMG/M |
| 3300020201 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1 | Environmental | Open in IMG/M |
| 3300020203 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2 | Environmental | Open in IMG/M |
| 3300020219 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1 | Environmental | Open in IMG/M |
| 3300020596 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1 | Environmental | Open in IMG/M |
| 3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
| 3300025147 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027823 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027878 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes) | Environmental | Open in IMG/M |
| 3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
| 3300032431 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1004511102 | 3300002835 | Freshwater | VLPNPSLKLSANGMSRWPSSAWPAAHFALAVQRAMPLSPA* |
| Ga0074211_1016701 | 3300005487 | Sediment | MPNPSFKPSPNSVARQPSSAGPAAHFALAVQRATLSVPAYLER |
| Ga0077110_10154222 | 3300005639 | Sediment | MPNPSFKLSPNSVARQSSSAGASPHFALAAQRATPLVPA* |
| Ga0075156_102667981 | 3300005982 | Wastewater Effluent | VLPNPSLKLSPNGVAHWPSSARASPHFALAVQRATPLV |
| Ga0105045_100852323 | 3300007517 | Freshwater | SLKRSANGMSRRPASAGPAAHFALAVQRAMPSSPA* |
| Ga0105045_101138761 | 3300007517 | Freshwater | PSLKRSANGMSRWPSSAGPAAHFALAVQRAKPSSPA* |
| Ga0105045_101246481 | 3300007517 | Freshwater | ALPNPSLKLSTNGVAHWPPGAGASPHFAPAVQRAKPLAPA* |
| Ga0105045_101843631 | 3300007517 | Freshwater | VTPNPSLKRSANGMSHWPSSAGPSAHFALSVQRAM |
| Ga0105045_102978103 | 3300007517 | Freshwater | PRAVTPNPSLKRSTNGVARWPSSAGPSAHFALAVQHATPLAPA* |
| Ga0105045_103467101 | 3300007517 | Freshwater | FKPSPNSVARRPSSAGPAAHFALAVRRTTLSVPA* |
| Ga0105045_103528552 | 3300007517 | Freshwater | SLKRSANGMARWPSSAGASPHFALDGQRAMPSSPA* |
| Ga0105045_103536751 | 3300007517 | Freshwater | VTPNPSLKRSANGMSRWPSSAGPPAHFALAVQRAMPS |
| Ga0105045_103564162 | 3300007517 | Freshwater | MRMKPNPALTRSANGMSRLPSSAGPAADFALAAQRAMPPSPAYLER* |
| Ga0105045_103837881 | 3300007517 | Freshwater | LAGFSGALTPNPSLKRSANGMSRWPSSAGPAAHFTLAVQRVLPLSPA* |
| Ga0105045_103914371 | 3300007517 | Freshwater | LKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0105045_104154371 | 3300007517 | Freshwater | MSTRTVTPNPSLKRSANGMARWPSSAGPAAHFALAVQRAMPLSPA |
| Ga0105045_104206941 | 3300007517 | Freshwater | SLKRSANGMARWPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0105045_104276122 | 3300007517 | Freshwater | SLKLSPNGVARWPSSAGPSAHSALAVQRATPSVPA* |
| Ga0105045_104386101 | 3300007517 | Freshwater | SLKRSPNGVAHWPSSAGPAAHFALAVQRATPSVPA* |
| Ga0105045_104426021 | 3300007517 | Freshwater | MPNPSLKRSANGMSRWSSSAGPAAHFALAVQRAMPS |
| Ga0105045_104843591 | 3300007517 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0105045_105019811 | 3300007517 | Freshwater | LKRRANGMSRWPSSAGPLAHFALAVQRATPSVPA* |
| Ga0105045_105178752 | 3300007517 | Freshwater | SLKRSANGMARWPSSAGPAAHFALAVQRAMPWSPA* |
| Ga0105045_105191332 | 3300007517 | Freshwater | SLKRSPNGMAHWPSSAEPSAHFALAVQRATPSVPA* |
| Ga0105045_105445171 | 3300007517 | Freshwater | VLPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATP |
| Ga0105045_105507781 | 3300007517 | Freshwater | MVTAEVTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA |
| Ga0105045_105841981 | 3300007517 | Freshwater | LRAVKPNPSLKRSANGMARWPSSAGPAGHFALAAQRAMPLAPA* |
| Ga0105045_105984781 | 3300007517 | Freshwater | MPNPSLKRSANGMSRWPSSAGPAAHFALSAQRAMP |
| Ga0105045_106328432 | 3300007517 | Freshwater | LKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA* |
| Ga0105045_106785631 | 3300007517 | Freshwater | VMPNPSLKRSTNGVAHWPSSAGPSAHFALAVQHATPLVPA* |
| Ga0105045_107217411 | 3300007517 | Freshwater | MYAETAATPNPSLKRSANGMSRWPSSAGPTAHFALAVQRAMPSSPA |
| Ga0105045_107298322 | 3300007517 | Freshwater | MLLLLQATPNHSLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA |
| Ga0105045_107653292 | 3300007517 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAVQRATPLSPA* |
| Ga0105045_108112691 | 3300007517 | Freshwater | ARNMAAKEVTPKPSFKRSANGMAHWPSSAGPAAHFALAVQRAMPLAPA* |
| Ga0105045_108134672 | 3300007517 | Freshwater | PNPSLKRSANGMARWPSSAGPAAHFALAVQRATPSSPA* |
| Ga0105045_108488921 | 3300007517 | Freshwater | MRPNPSLKRSANGMSRWPSSAGPSAHFALAVQRAMPSSPA |
| Ga0105045_108974141 | 3300007517 | Freshwater | SLKRSANGMAHWPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0105045_109046212 | 3300007517 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAVQRAMPSVPA* |
| Ga0105045_109920491 | 3300007517 | Freshwater | MATPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMP |
| Ga0105044_101859951 | 3300007521 | Freshwater | LKRSDNGMAHWPSSAGPSAHFALAVQRAMPSPPA* |
| Ga0105044_102318841 | 3300007521 | Freshwater | MAAKEVTPNPSFKRSDNGMAHWPLSAGPAAHFALAVQRATPLSPA* |
| Ga0105044_102426402 | 3300007521 | Freshwater | SLKRSDNGMSRWPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0105044_104142541 | 3300007521 | Freshwater | MLCSSAGTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAT |
| Ga0105044_105986701 | 3300007521 | Freshwater | MTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA |
| Ga0105044_106443911 | 3300007521 | Freshwater | MPNPSLKLSANGMAHWPSGAGPAAHFAPAVQRATP |
| Ga0105044_106747751 | 3300007521 | Freshwater | MPNPSLKRSANGMSRWSSSAGPSAHFALAVQRATPLSP |
| Ga0105044_106842432 | 3300007521 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA* |
| Ga0105044_106874062 | 3300007521 | Freshwater | AVGSAMPNTSLKLSANGVAHWPSGAGPAVQCTTPLSPA* |
| Ga0105044_107332772 | 3300007521 | Freshwater | MPNPSLKRSDNGMSRWPSSAGPSAHFALAVQRDMPLS |
| Ga0105044_107341931 | 3300007521 | Freshwater | MRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRDMP |
| Ga0105044_109205211 | 3300007521 | Freshwater | MPNPSLKRSANGMSHWPSSAGPSAHFALAVQRAMP |
| Ga0105044_109872321 | 3300007521 | Freshwater | LKRSANGMARWPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0105044_112723841 | 3300007521 | Freshwater | PNPSLKRSANGMARWPSSAGPAAHFALAVQRAMP* |
| Ga0105049_101728551 | 3300007799 | Freshwater | PSLKRSANGMSRWPSSAGPLAHFALAVQRATLLSPA* |
| Ga0105049_101754681 | 3300007799 | Freshwater | PSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0105049_103001481 | 3300007799 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAVQRALPLSPA* |
| Ga0105049_103088601 | 3300007799 | Freshwater | ARNMAAKEVTPNPSFKRSANGMAHWPSSAGPAAHFALAVQRPTPSSPA* |
| Ga0105049_104899681 | 3300007799 | Freshwater | VTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATPS |
| Ga0105049_106340451 | 3300007799 | Freshwater | MKPNPALTRSANGMSRLPSSAGPAADFALAAQRAMPPSPAYLER* |
| Ga0105049_107759241 | 3300007799 | Freshwater | SLKRSANGMARWPSSAGPAAHFALAVQRAMPSSPA* |
| Ga0105049_108808502 | 3300007799 | Freshwater | MHNVVLPNPSLKRSANGMSRWPSSAGPAAHFALAVQRA |
| Ga0105049_109725841 | 3300007799 | Freshwater | QECAPKVLPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATPLSPA* |
| Ga0105049_110055131 | 3300007799 | Freshwater | LKRSANGMSRWPSSAGPAAHFALAVQRVLPLSPA* |
| Ga0105049_110111832 | 3300007799 | Freshwater | MPNPSLKRSANGMALRPSSAGPAAHFALAAQRAMP |
| Ga0105048_101499371 | 3300009032 | Freshwater | SFKRSANGMAHWPSSAGPSAHFALAVQRATPSSTA* |
| Ga0105048_101605395 | 3300009032 | Freshwater | MMPNPSLKRSANGMSRWPSSAGPAAHFALAGQRAMPLS |
| Ga0105048_101661783 | 3300009032 | Freshwater | FKRSANGMAHWPSSAGPSAHFALAVQRATPSSTA* |
| Ga0105048_102205564 | 3300009032 | Freshwater | SLKRSANGMSRWPSSAGPAAHFAPAVQRAMPLSPA* |
| Ga0105048_102413541 | 3300009032 | Freshwater | VSKNEFASLLSPATPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA |
| Ga0105048_102730381 | 3300009032 | Freshwater | FKRSANGMAHWPSSAGPAAHFALAVQRATPSSPA* |
| Ga0105048_102941271 | 3300009032 | Freshwater | PSLKRSANGRPRWPSSAGPAAHFALAVQRALPLSPA* |
| Ga0105048_103650991 | 3300009032 | Freshwater | MMPNPSLKRGADGMSRWPSSAGPAAHFALAGQRAMPLSPA* |
| Ga0105048_103895171 | 3300009032 | Freshwater | MTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA |
| Ga0105048_103902413 | 3300009032 | Freshwater | LKLSTNGVSRWPSGAGPAAHFAPAVQRATPLAPA* |
| Ga0105048_103972603 | 3300009032 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA* |
| Ga0105048_104465132 | 3300009032 | Freshwater | MCSNGNRRALTPNPALKWGANGMSRWPSSAGPAAHFALAAQRAMP |
| Ga0105048_104502161 | 3300009032 | Freshwater | LKRSANGMSHWPSSAGPAAHFALAGQRDMPSSPA* |
| Ga0105048_104930784 | 3300009032 | Freshwater | SLKRSANGMARWPSSAGPAAHFALAVQRATPSSPA* |
| Ga0105048_105085062 | 3300009032 | Freshwater | SLKRSANGMSRWPSSAGASPHFALAAQRATPSSPA* |
| Ga0105048_105464412 | 3300009032 | Freshwater | SLKRSANGMPRWPSSAGPAAHFALAVQRAMPSSPA* |
| Ga0105048_105694511 | 3300009032 | Freshwater | EWCPVGPNPSLKRSANGMSRWPSSAGPSAHFALAVQRATPLVPA* |
| Ga0105048_106544761 | 3300009032 | Freshwater | VRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPS |
| Ga0105048_106642261 | 3300009032 | Freshwater | SLKRSANGMSRWPSSAGPVAHFALAVQRAMPSSPA* |
| Ga0105048_106656951 | 3300009032 | Freshwater | LKLSANGMAHWPSGAGPAAHFAPAVQRATPLAPA* |
| Ga0105048_106722232 | 3300009032 | Freshwater | WQVLPNPSLKRSANGMAHWPASAGPAAHFALAVQRAMPSSPA* |
| Ga0105048_106848932 | 3300009032 | Freshwater | LKRSANGMSHWPSSAGPSAHFALAVQRAMPPSPA* |
| Ga0105048_107361121 | 3300009032 | Freshwater | AAVRPNTSLKLSANGVSRWPSSAGPSAHFALAVQRDTPLAPA* |
| Ga0105048_107404651 | 3300009032 | Freshwater | LKRSANGMARWPSSAGPAAHFALAVQRAMPLAPA* |
| Ga0105048_107681741 | 3300009032 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAVQRATPLAPA* |
| Ga0105048_107690802 | 3300009032 | Freshwater | MITTSPATPNRSLKRSANGMAHRPSSAGPAADFALAAQRAMPPSPAYLER* |
| Ga0105048_108078961 | 3300009032 | Freshwater | VTPNPSLKRSANGMSRWPSSAGPSAHFALAAQRAMP |
| Ga0105048_108202582 | 3300009032 | Freshwater | SFKPSPNGVPRWPASAGPAAHFALAVQRGTPSVPA* |
| Ga0105048_108372741 | 3300009032 | Freshwater | VTPNTSLKRSANGMSRWPSSAGPAAHFALAVQRAMP |
| Ga0105048_109164102 | 3300009032 | Freshwater | PNTSLKLSANGMSRWPSGAGPAAHFAPAVQRATPLAPA* |
| Ga0105048_110649262 | 3300009032 | Freshwater | MVTPEVTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA |
| Ga0105048_110749071 | 3300009032 | Freshwater | GFGAAMPNTSLKLSANGVAHWPSGAGPAAHFAPAVQCATPSSPA* |
| Ga0105048_110753302 | 3300009032 | Freshwater | RQERSHFGLPPAPPNPSPKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0105048_110903641 | 3300009032 | Freshwater | MPNPSLKRSANGMSRWSSSAGPAAHFALAVQRAMPLSPA |
| Ga0105048_111077592 | 3300009032 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAAQRATPLSPA* |
| Ga0105048_113347321 | 3300009032 | Freshwater | MPNPSLKRRANGMSRWPSSAGPAAHFALAVQRAMPSS |
| Ga0105048_113513261 | 3300009032 | Freshwater | MVSFIQVRAVRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPS |
| Ga0105048_114763572 | 3300009032 | Freshwater | SLKRSANGMARWPSNAGASPHFALAVQRAMPLSHA* |
| Ga0105048_114771901 | 3300009032 | Freshwater | MRAAPPNPSLKRSANGMAHWPSSAGPAAHFALAVQCAMP |
| Ga0105047_100309818 | 3300009083 | Freshwater | LFSSDIAAPPAQPNPSLKRSANGMSRWPSSAGPAAHFALAVQRDMPSSP |
| Ga0105047_101177201 | 3300009083 | Freshwater | MPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0105047_101420121 | 3300009083 | Freshwater | LKRSANGMSHWPSSAGPAAHFALAVQRAMPSSPA* |
| Ga0105047_101493251 | 3300009083 | Freshwater | FKRSANGVAHWPSSAGPAAHFALAVQRATPSPPA* |
| Ga0105047_101787641 | 3300009083 | Freshwater | MPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA |
| Ga0105047_101978571 | 3300009083 | Freshwater | MITIQVATPNPSLKRSANGMSRWPSSAGPSAHFALAVQRAMPSSPA* |
| Ga0105047_102151663 | 3300009083 | Freshwater | SLKLSANGVSRWPSSAGPSAHFALAVQRATPLAPA* |
| Ga0105047_102211623 | 3300009083 | Freshwater | LKRSDNGMARWAVSAGPSAHFALTAQRAMPLSPA* |
| Ga0105047_102515973 | 3300009083 | Freshwater | SLKRSANGMAHWPSSAGPAAHFALAVQRAMPSSPA* |
| Ga0105047_102853121 | 3300009083 | Freshwater | SLKRSANGMSHWPSSAGPAAHFALAVQRAMPSSPA* |
| Ga0105047_102932891 | 3300009083 | Freshwater | SLKRSANGMSRWPSSAGPSAHFALAVQRATPLVPA* |
| Ga0105047_103219344 | 3300009083 | Freshwater | LGAQRPNPSLKRSANGVARWPSSAGPAAHFALAVQRATPSSPA* |
| Ga0105047_103345953 | 3300009083 | Freshwater | LKRSANGMARWPSSAGPAAHFALAVQRATPSSPA* |
| Ga0105047_103356234 | 3300009083 | Freshwater | EAMPNTSLKLSANGMAHWPSGAGPAAHFAPAVQRAPPPSPA* |
| Ga0105047_103364301 | 3300009083 | Freshwater | SLKRSTNGVPHWPSSAGPAAHFALAVQRATPLVPA* |
| Ga0105047_103693782 | 3300009083 | Freshwater | MPNPSLKRSANGMSRWPSSAGPAAHFALVVQRAMPS |
| Ga0105047_104092241 | 3300009083 | Freshwater | MTPNPSLKRSDNGMSRWPSSAGPAAHFALAVQRAMPLS |
| Ga0105047_104176713 | 3300009083 | Freshwater | FKPSPNSVARRPSSAGPAAYFALAVRRATLSVPA* |
| Ga0105047_104309772 | 3300009083 | Freshwater | MQKIGKAGTRTLMPNPSLKRSANGMARWPSSAGASPHFALDGQRAMPSSPA* |
| Ga0105047_104443061 | 3300009083 | Freshwater | MSQPTALTPNPSLKRSDNGMSRWPPSARPAAHFALAVQRAMPLSPA* |
| Ga0105047_104770393 | 3300009083 | Freshwater | MSLSAVTPNPSLKRSANGMSRWPSSAGPSAHFALAVQRAMPLAPA |
| Ga0105047_104927443 | 3300009083 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALDGQRAMPSSPA* |
| Ga0105047_105457152 | 3300009083 | Freshwater | SLKRSANGMSRWPSSAGPSAHFALAVQRATPLAPA* |
| Ga0105047_105457441 | 3300009083 | Freshwater | SNNAVLPNPSLKRSANGMSRWPSSAGPAAHFALAVHRAVPSPPA* |
| Ga0105047_105965781 | 3300009083 | Freshwater | MTPNPSLKRSANGMSRWPSSAGPSAHFALAAQRAMPL |
| Ga0105047_106792461 | 3300009083 | Freshwater | MPNPSLKRSANGMARWPSSAGPAAHFALAVQRAMPLAPA |
| Ga0105047_106941982 | 3300009083 | Freshwater | AARRAAVGSAMPNTSLKLSANGVAHWPSGAGPAAHFAPAVQRATPLAPA* |
| Ga0105047_107026222 | 3300009083 | Freshwater | NPSFKPSPNSVAPRPSSAGPAAHFALAVQRATLSVPA* |
| Ga0105047_107081891 | 3300009083 | Freshwater | SLKRSANGMALWPSSAGPAAHFALAVQRAMLLSPA* |
| Ga0105047_107097502 | 3300009083 | Freshwater | AGFSGALTPNPSLKRSANGMSRWPSSAGPSAHYALAVQRALPSPPA* |
| Ga0105047_107315042 | 3300009083 | Freshwater | SLKLSANGVAHWPSGAGPAAHFAPAVQRATPLAPA* |
| Ga0105047_107909001 | 3300009083 | Freshwater | LKRSANGMSRWPSSAGPSAHFALAVQRATPLSPA* |
| Ga0105047_108002401 | 3300009083 | Freshwater | VKPNPSLKRSANGMSRWPSSAGPAAHFAPAVQRAMP |
| Ga0105047_108608051 | 3300009083 | Freshwater | MPNPSFKRSANGMAHWPSSAGPAAHFALAVQRAMPSSPA |
| Ga0105047_108895723 | 3300009083 | Freshwater | FSAARRAAVGHAMPNTSLKLSTNGMSRWPSSAGPAAHFALAVRRATLSVPA* |
| Ga0105047_108900872 | 3300009083 | Freshwater | MQPNPSLKRSANGRPRRPSSAGPAAHFALAVQRVL |
| Ga0105047_109068921 | 3300009083 | Freshwater | AVGEAMPNTSLKLSANGMAHWPSGAGPAAHFAPAVQRATPSSPA* |
| Ga0105047_112074872 | 3300009083 | Freshwater | SLKLSTNGVSRWPSGAGPAAHFAPAVQRATPLAPA* |
| Ga0105047_113164442 | 3300009083 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAVQHAMPLAPA* |
| Ga0105047_113826642 | 3300009083 | Freshwater | LKRSANGMSRWPSSAGPAAHFALAVQRAMPLAPA* |
| Ga0105047_113863711 | 3300009083 | Freshwater | SIDVPQVKPNPSLKRSANGMSRWPSSAGPAPHFALAVQRGKPSSPA* |
| Ga0105047_114617242 | 3300009083 | Freshwater | MASALPQVRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPS |
| Ga0105047_115048072 | 3300009083 | Freshwater | SLKLSTNGMSRWPSSAGPSAHCALAVQRATPLAPA* |
| Ga0105046_102078034 | 3300009084 | Freshwater | SLKLSANGMAHWPSGAGPAAHFAPAVQCATPLAPA* |
| Ga0105046_103004231 | 3300009084 | Freshwater | SLKRSANGMSHRPSSAGPAAHFALAVQRAMPLAPA* |
| Ga0105046_103082392 | 3300009084 | Freshwater | EAVMPNPSLKRSTNGVAHWPSSAGPSAHFALAVQRSLPLSPA* |
| Ga0105046_103196991 | 3300009084 | Freshwater | MPNPSLKRSANGMSRWSSSAGPAAHFALAVQRAMPSS |
| Ga0105046_103284801 | 3300009084 | Freshwater | MAVTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA |
| Ga0105046_103324671 | 3300009084 | Freshwater | MPNPSLKRSANGMSRRPASAGPAAHFALAVQRAMP |
| Ga0105046_103427611 | 3300009084 | Freshwater | LTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPL |
| Ga0105046_104578911 | 3300009084 | Freshwater | PNPSLKRSANGMSRWPSSAGPAAHFALDGQRAMPSSPA* |
| Ga0105046_105032261 | 3300009084 | Freshwater | RHGELMPNPSLKRSANGMSHWPSSAGPSAHFALAVQRAMP* |
| Ga0105046_105122533 | 3300009084 | Freshwater | AAMPNTSLKLRANGVAHWPSGAGPAAHFAPAVQCTTPLSPA* |
| Ga0105046_105504342 | 3300009084 | Freshwater | LVSAVKPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPAYLER* |
| Ga0105046_106417432 | 3300009084 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAAQRAMPSAPA* |
| Ga0105046_106619491 | 3300009084 | Freshwater | MNVAALLPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAIP |
| Ga0105046_106781011 | 3300009084 | Freshwater | MATPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPL |
| Ga0105046_107884581 | 3300009084 | Freshwater | LKRSDNGMAHWPSSAGPAAHFALAVQRAMPSSPA* |
| Ga0105046_107921081 | 3300009084 | Freshwater | QTAAFCIAVTPNPSLKRRANGMSRWPSSAGPAAHFALAVQRATPLVPA* |
| Ga0105046_108519161 | 3300009084 | Freshwater | LKRSANGMSRWPSNAGPAAHFALAVQRALPLSPA* |
| Ga0105046_108589351 | 3300009084 | Freshwater | MITTSPATPNRSLKRSANGMAHRPSSAGPAADYALAAQRAMPPSPAYLER* |
| Ga0105046_109355471 | 3300009084 | Freshwater | VEEGPRAMVTAEVTPNPSLKRSANGMSRWPSSAGPAAHFAHAVHRAKPSVPA* |
| Ga0105046_109390301 | 3300009084 | Freshwater | MMPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPL |
| Ga0105046_109562691 | 3300009084 | Freshwater | MRPNTSLKLSANGVSRWPSSAGPSAHFALAVQRATPLA |
| Ga0105046_109785481 | 3300009084 | Freshwater | MATAVTATPNPSLKRSTNGMPRWPSSAGPAAHFALVVQ |
| Ga0105046_110166861 | 3300009084 | Freshwater | NPSLKRSANGMARWPSSAGPAAHFALAVQRATPS* |
| Ga0105046_110226803 | 3300009084 | Freshwater | NPSLKRSANGMSRRPSSAGPAAHFALAVQRATPSVPA* |
| Ga0105046_110411591 | 3300009084 | Freshwater | MPNPSLKRSDDGMSRWPSSAGPAAHFALAVQRAMP |
| Ga0105046_110739192 | 3300009084 | Freshwater | NPSLKRSANGMSRWPSSAGPAAHFALAVQRAKPSPPA* |
| Ga0105046_111798351 | 3300009084 | Freshwater | EAMPNTSLKLSANGMAHWPSGAGPAAHFAPAVQCATPLAPA* |
| Ga0105046_115049041 | 3300009084 | Freshwater | MTPNPSLKRSANGMSRWPSSAGPSAHFALAVQRAMPSS |
| Ga0114974_101843091 | 3300009183 | Freshwater Lake | NPSLKLSANGVPRWPSSAGPAAYFALAVQRVTPLAPT* |
| Ga0123338_101022431 | 3300009686 | Glacier Valley | VSKALPNPSFKPSPNGVARWSSSAGPAAHVALAAQHATPSVPA* |
| Ga0114960_104093201 | 3300010158 | Freshwater Lake | KLTPNPSLKLSANGASRWSSGAGPAAHFAPATQRATPLAPA* |
| Ga0136636_100620844 | 3300012044 | Polar Desert Sand | PPPPVKPNPSLKRSANGMSRWPSSAGPAAHIALAVQRAMPSSPA* |
| Ga0136636_100753281 | 3300012044 | Polar Desert Sand | SLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPD* |
| Ga0136636_101380601 | 3300012044 | Polar Desert Sand | VTPNPSLKRSANGMSRWPSSAGPAAHFALAAQRAMP |
| Ga0136636_101726411 | 3300012044 | Polar Desert Sand | MRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAM |
| Ga0136636_101945001 | 3300012044 | Polar Desert Sand | MRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMP |
| Ga0136636_102453171 | 3300012044 | Polar Desert Sand | PNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0136636_103470801 | 3300012044 | Polar Desert Sand | MASALPKARPNPSLKRSANGMSRWPSSAGPAAHFALAVQR |
| Ga0136636_104311481 | 3300012044 | Polar Desert Sand | MYAETAATPNPSLKRSANGMSRWPSSAGPTAHFAL |
| Ga0136636_104511491 | 3300012044 | Polar Desert Sand | MIRKLMPNPSLKRSANGMSRWPSSAGPAAHFALAVQRALP |
| Ga0136639_103371351 | 3300013097 | Polar Desert Sand | SLKRSDDGMSRQPSSAGPAAHFALAVQRAMPLSPA* |
| Ga0136641_11075683 | 3300013286 | Freshwater | SLKLSTNGVSRWSLGAGPAAHFAPSAQRATPLAPA* |
| Ga0136641_11340822 | 3300013286 | Freshwater | MSISREMPPNPSLKLSTNGVSRWSLGAGPAAHFAPSAQRATPLAPA* |
| Ga0163144_101095706 | 3300015360 | Freshwater Microbial Mat | RAVLPNPSLKRSANGMARWPSSAGPAAHFALAVQSAMPSSPA* |
| Ga0163144_103202504 | 3300015360 | Freshwater Microbial Mat | SLKRSANGMSHWPSSAGPSAHFALAVQRAMPPSPA* |
| Ga0163144_104670074 | 3300015360 | Freshwater Microbial Mat | SFKRSANGMAHWPSSAGPAAHFALAVQRATPSPPA* |
| Ga0163144_105121521 | 3300015360 | Freshwater Microbial Mat | LKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA* |
| Ga0163144_105244492 | 3300015360 | Freshwater Microbial Mat | SLKRSANGMSRWPSSAGPAAHFALSVQRATPSSPA* |
| Ga0163144_105912931 | 3300015360 | Freshwater Microbial Mat | SLKLSPNGVAHWSSSAGASPHFALAAQRATPLGPA* |
| Ga0163144_106422971 | 3300015360 | Freshwater Microbial Mat | MTPNPSLKRSANGMSRWPSSAGPAAHFALVVQRAMPSSP |
| Ga0163144_112223871 | 3300015360 | Freshwater Microbial Mat | LNKNSSVSAALTPNPSLKLSANGVSRRPSSAGPAAHFALAVQRATP |
| Ga0163144_114624081 | 3300015360 | Freshwater Microbial Mat | LPNPSLKRSANGMARWPSSAGPAAHFALDGQRAMPLSPA* |
| Ga0163144_116855591 | 3300015360 | Freshwater Microbial Mat | SLKRSANGMAHWPSSAGPSAHFALAVQRATPSSPA* |
| Ga0187843_104362341 | 3300019093 | Freshwater | RRNWKASHICGQQVTPNPSLKLSPNGAAHWPSSAGPAAHFALAVQRATPFVPA |
| Ga0163155_103281552 | 3300020180 | Freshwater Microbial Mat | MRPNPSLKRSANGMSRWPSSAGPSAHFALAVQRAMPLALRL |
| Ga0163155_104936061 | 3300020180 | Freshwater Microbial Mat | MPNPSLKRSTNGVAHWPSSAGPSAHLALAVQHATPLVLRLSEGLGIT |
| Ga0163147_104534771 | 3300020192 | Freshwater Microbial Mat | MATPNPSLKLSDNGMSRWSCGAGASPHFAPPAQRATPLSPA |
| Ga0163154_101625731 | 3300020201 | Freshwater Microbial Mat | AVSPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA |
| Ga0163154_101644381 | 3300020201 | Freshwater Microbial Mat | MAAKEVTPNPSFKRSANGMAHWPSSAGPAAHFALAVQRATPSSPA |
| Ga0163148_102855861 | 3300020203 | Freshwater Microbial Mat | VKPNPSLKRSANGMAHWPSSAGPAAHFALAVQRAMPSSPA |
| Ga0163148_103065582 | 3300020203 | Freshwater Microbial Mat | MAAKEVTPNPSFKRSDNGMAHWPLSAGPAAHFALAVQRATPLSPA |
| Ga0163146_101832911 | 3300020219 | Freshwater Microbial Mat | VTPNPSLKRSANGMSRWPSSAGPAAHFALAVQHATP |
| Ga0163149_104305922 | 3300020596 | Freshwater Microbial Mat | MPNRSLKRSADGMAHRPSSAGPAAHFALAFQRAMPSALR |
| Ga0212090_103388131 | 3300022561 | Glacier Valley | KALPNPSFKPSPNGVARWSSSAGPAAHVALAAQHATPSVPA |
| Ga0209511_11115782 | 3300025147 | Glacier Valley | GVSKALPNPSFKPSPNGVARWSSSAGPAAHVALAAQHATPSVPA |
| Ga0209490_103815181 | 3300027823 | Freshwater | PSFKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA |
| Ga0209490_104896981 | 3300027823 | Freshwater | MVTAEVTPNPSLKRSANGMSRWPSSAGPTAHFALTVQRAMP |
| Ga0209490_105069131 | 3300027823 | Freshwater | PAPPNPSLKPSANGMSRWPSSAGPAADFALAVQRATPLSPA |
| Ga0209591_104904581 | 3300027850 | Freshwater | VTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMP |
| Ga0209591_105855752 | 3300027850 | Freshwater | MTYWTGFAKTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSP |
| Ga0209591_106928941 | 3300027850 | Freshwater | MPNPSLKRSTNGVAHWPSSAGPAAHFALAVQRATPSVPA |
| Ga0209591_106977751 | 3300027850 | Freshwater | MPNPSLKRSANGMSRWPSSAGPSAHFGLSVQRATP |
| Ga0209591_108365741 | 3300027850 | Freshwater | MVTAEVTPNPSLKRSANGMSRWPSSAGPTAHFALTVQRAKWA |
| Ga0209181_101333534 | 3300027878 | Freshwater | TSLKLSTNGMSRWPSSAGPSAHFALAVQRATPLAPA |
| Ga0209181_102106841 | 3300027878 | Freshwater | MPNPSLKRSADGMSRWPSSAGPAAHFALAVQRAMP |
| Ga0209181_102222651 | 3300027878 | Freshwater | NPSLKLSPNGVARWPSSAGPAAHFALAVQRATPSVPA |
| Ga0209181_102538101 | 3300027878 | Freshwater | MKPNPSLKRSANGMARWPSSAGPAAHFALAVQRAMP |
| Ga0209181_102601993 | 3300027878 | Freshwater | SFKPSPNSVARRPSSAGPAAHFALAVQRATLSVPA |
| Ga0209181_102655341 | 3300027878 | Freshwater | PSLKRSANGMAHWPSSAGPAAHFALAVQRAMPSSPA |
| Ga0209181_102785671 | 3300027878 | Freshwater | MPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLS |
| Ga0209181_103334954 | 3300027878 | Freshwater | PSLKRSANGMARWPSSAGPAAHFALAVQRATPSSPA |
| Ga0209181_103980491 | 3300027878 | Freshwater | MRPNPSLKRSANGMSRWPSSAGPAAHFALAAQRAMPS |
| Ga0209181_105319722 | 3300027878 | Freshwater | MIRKLMPNPSLKRSANGMSRWPSSAGPAAHFALAVQRALPSPP |
| Ga0209181_105405631 | 3300027878 | Freshwater | MSSVPMRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSTA |
| Ga0209181_106785751 | 3300027878 | Freshwater | MITTSPATPNRSLKRSANGMAHRPSSAGPAADFALAAQRAMPPSPAYLER |
| Ga0209181_107352821 | 3300027878 | Freshwater | MTAAAERPNPSLKRSANGMSRWPSSAGPAAHFALAAQRAM |
| Ga0335397_101069253 | 3300032420 | Freshwater | SLKRSDNGMSRWPSSAGPAAHFALAVQRAMPLSPA |
| Ga0335397_101492491 | 3300032420 | Freshwater | VTPNPSLKRSANGMSRWPSSAGPLAHFALAVQRAMPSS |
| Ga0335397_102892541 | 3300032420 | Freshwater | MIISNALTPNPSLKRSANGMSRWPSSAGPAAHFALAVQ |
| Ga0335397_103096363 | 3300032420 | Freshwater | MPNPSLKRSANGMAHWPSSAGPAAHFALAVRCAMPL |
| Ga0335397_103439611 | 3300032420 | Freshwater | PSLKRSANGMAHWPTSAGPVAHFALAVQRAKPLSPA |
| Ga0335397_103794831 | 3300032420 | Freshwater | SLKRSTNGMSHWPSGAGPAAHFAPAVQRATPLMPA |
| Ga0335397_103922893 | 3300032420 | Freshwater | PSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA |
| Ga0335397_104386951 | 3300032420 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA |
| Ga0335397_105499521 | 3300032420 | Freshwater | MQDAVELPAVPPNPSLKRSANGTSRWPSSAGPAAHFALAVQRA |
| Ga0335397_106296481 | 3300032420 | Freshwater | MHAVRVLKPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSS |
| Ga0335397_106779221 | 3300032420 | Freshwater | SLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA |
| Ga0335397_108336551 | 3300032420 | Freshwater | FTQFAAQLRPNPSLKRSANGMSRWPSSAGPAAYFALAVQRAMPLSPA |
| Ga0335397_108527671 | 3300032420 | Freshwater | MLLLLQATPNHSLKRSANGMSRWPSSAGPAAHFALAVQRATP |
| Ga0335397_108623201 | 3300032420 | Freshwater | SAARRAAVGSAMPNTSLKLSANGVAHWPSGAGPAAHFAPAVQRATPLAPA |
| Ga0335397_109416601 | 3300032420 | Freshwater | MPNPSLKRSTNGVAHWPSSAGPSAHFALAVQHAPP |
| Ga0335395_100871801 | 3300032431 | Freshwater | VRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATP |
| Ga0335395_101354241 | 3300032431 | Freshwater | MQKIGKAGTRTLMPNPSLKRSANGMARWPSSAGASPHFALDGQRAMPSSP |
| Ga0335395_102173552 | 3300032431 | Freshwater | MRMKPNPALTRSANGMSRLPSSAGPAADFALAAQRAMPPSPAYLER |
| Ga0335395_102511521 | 3300032431 | Freshwater | MPNPSLKRSANGMAHWPSSAGPAAHFALAVQCAMPL |
| Ga0335395_103309311 | 3300032431 | Freshwater | MVSNQAIRLRAVKPNPSLKRSANGMARWPSSAGPAAHFALAVQRA |
| Ga0335395_103508133 | 3300032431 | Freshwater | LSLSPKVTPNPSLKRSANGMSHWPSSAGPAAHFALAAQRATPSSPA |
| Ga0335395_106356751 | 3300032431 | Freshwater | MPNPSLKRSANGRPRWPSSAGASPHFALAVQRVLP |
| Ga0335395_107123371 | 3300032431 | Freshwater | MTPNPSLKRSANGMSHWPSSAGPAAHFALAVQRAL |
| Ga0335395_108930292 | 3300032431 | Freshwater | MTAAAERPNPSLKRSANGIAHWPSSAGPAAHFALAVQRAMP |
| Ga0335394_102497273 | 3300032456 | Freshwater | NPSLKRSANGMSRWPSSAGPAAHFALAVQRALPLSPA |
| Ga0335394_103359672 | 3300032456 | Freshwater | MQKIGKAGTRTLMPNPSLKRSANGMARWPSSAGASPHFALDGQRAMPSSPA |
| Ga0335394_103373202 | 3300032456 | Freshwater | MIRKLMPNPSLKRSANGMSRWPSSAGPAAHFALAVQRALPSPPA |
| Ga0335394_104700451 | 3300032456 | Freshwater | RAVGPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA |
| Ga0335394_104710581 | 3300032456 | Freshwater | MPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPL |
| Ga0335394_104832491 | 3300032456 | Freshwater | MSCTSSAALRPNPSLKRSANGRPRRSSSAGPSAHFALAVQRVLPS |
| Ga0335394_106181731 | 3300032456 | Freshwater | NPSLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA |
| Ga0335394_107203283 | 3300032456 | Freshwater | MVTAEVTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMP |
| Ga0335394_108728581 | 3300032456 | Freshwater | MKPNHSLKRSRNGLAHWPSSAGPAAHFALAVQRATPSV |
| ⦗Top⦘ |