


| Basic Information | |
|---|---|
| Family ID | F013935 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 267 |
| Average Sequence Length | 48 residues |
| Representative Sequence | RGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA |
| Number of Associated Samples | 238 |
| Number of Associated Scaffolds | 267 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.75 % |
| % of genes near scaffold ends (potentially truncated) | 98.50 % |
| % of genes from short scaffolds (< 2000 bps) | 94.01 % |
| Associated GOLD sequencing projects | 225 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.382 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.487 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.330 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.322 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 267 Family Scaffolds |
|---|---|---|
| PF00905 | Transpeptidase | 34.08 |
| PF17092 | PCB_OB | 6.37 |
| PF03462 | PCRF | 1.12 |
| PF13417 | GST_N_3 | 0.75 |
| PF01520 | Amidase_3 | 0.75 |
| PF12680 | SnoaL_2 | 0.75 |
| PF00005 | ABC_tran | 0.75 |
| PF00912 | Transgly | 0.37 |
| PF11953 | DUF3470 | 0.37 |
| PF08546 | ApbA_C | 0.37 |
| PF03466 | LysR_substrate | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 267 Family Scaffolds |
|---|---|---|---|
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 1.12 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 1.12 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.37 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.51 % |
| Unclassified | root | N/A | 4.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10772052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300002568|C688J35102_120007083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 844 | Open in IMG/M |
| 3300003215|JGI25153J46596_10071279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 898 | Open in IMG/M |
| 3300003771|Ga0055526_1069076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
| 3300005163|Ga0066823_10152203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300005334|Ga0068869_101374219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300005334|Ga0068869_102003833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300005339|Ga0070660_101250526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300005341|Ga0070691_11085168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300005345|Ga0070692_10486989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300005353|Ga0070669_100678657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 869 | Open in IMG/M |
| 3300005355|Ga0070671_100575280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
| 3300005355|Ga0070671_100666248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 901 | Open in IMG/M |
| 3300005440|Ga0070705_101875029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300005451|Ga0066681_10913711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300005455|Ga0070663_100308782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1268 | Open in IMG/M |
| 3300005456|Ga0070678_100069982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2621 | Open in IMG/M |
| 3300005513|Ga0077120_1078841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1563 | Open in IMG/M |
| 3300005539|Ga0068853_101080234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
| 3300005539|Ga0068853_102054817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300005541|Ga0070733_10431200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 879 | Open in IMG/M |
| 3300005543|Ga0070672_100760677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 851 | Open in IMG/M |
| 3300005546|Ga0070696_101559231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300005548|Ga0070665_100481074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1252 | Open in IMG/M |
| 3300005548|Ga0070665_101456775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 693 | Open in IMG/M |
| 3300005548|Ga0070665_101976449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300005555|Ga0066692_11032827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300005560|Ga0066670_10704586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300005576|Ga0066708_10618507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300005586|Ga0066691_10813554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300005587|Ga0066654_10468334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300005598|Ga0066706_10455485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1019 | Open in IMG/M |
| 3300005614|Ga0068856_100827093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 945 | Open in IMG/M |
| 3300005614|Ga0068856_101552480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 675 | Open in IMG/M |
| 3300005764|Ga0066903_106751357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300005841|Ga0068863_101638502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300005843|Ga0068860_102460003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 540 | Open in IMG/M |
| 3300005844|Ga0068862_100171379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1943 | Open in IMG/M |
| 3300005844|Ga0068862_102749935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300005937|Ga0081455_10842937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 573 | Open in IMG/M |
| 3300005952|Ga0080026_10273995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300005983|Ga0081540_1048590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2124 | Open in IMG/M |
| 3300005983|Ga0081540_1134688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1002 | Open in IMG/M |
| 3300005985|Ga0081539_10356589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300005994|Ga0066789_10172591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 915 | Open in IMG/M |
| 3300006034|Ga0066656_10487711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 804 | Open in IMG/M |
| 3300006038|Ga0075365_10096421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2021 | Open in IMG/M |
| 3300006038|Ga0075365_10131204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1734 | Open in IMG/M |
| 3300006038|Ga0075365_10711436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 709 | Open in IMG/M |
| 3300006051|Ga0075364_10092527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2007 | Open in IMG/M |
| 3300006102|Ga0075015_100098187 | Not Available | 1467 | Open in IMG/M |
| 3300006172|Ga0075018_10721516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300006174|Ga0075014_100668641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 601 | Open in IMG/M |
| 3300006183|Ga0097677_1090378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 579 | Open in IMG/M |
| 3300006186|Ga0075369_10392649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300006354|Ga0075021_10203898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1208 | Open in IMG/M |
| 3300006354|Ga0075021_10353554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 917 | Open in IMG/M |
| 3300006755|Ga0079222_10856341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300006852|Ga0075433_11064740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300006944|Ga0099823_1060982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1957 | Open in IMG/M |
| 3300006953|Ga0074063_10040429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300006953|Ga0074063_10109298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300007076|Ga0075435_100104113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2354 | Open in IMG/M |
| 3300009088|Ga0099830_10445708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1051 | Open in IMG/M |
| 3300009089|Ga0099828_10599945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 991 | Open in IMG/M |
| 3300009092|Ga0105250_10308335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 686 | Open in IMG/M |
| 3300009100|Ga0075418_10832085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
| 3300009101|Ga0105247_10099704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1855 | Open in IMG/M |
| 3300009101|Ga0105247_10242243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1229 | Open in IMG/M |
| 3300009137|Ga0066709_103722501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 553 | Open in IMG/M |
| 3300009148|Ga0105243_11414595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 716 | Open in IMG/M |
| 3300009156|Ga0111538_12083200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 713 | Open in IMG/M |
| 3300009174|Ga0105241_10316643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1344 | Open in IMG/M |
| 3300009176|Ga0105242_10947630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 865 | Open in IMG/M |
| 3300009176|Ga0105242_11820374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 648 | Open in IMG/M |
| 3300009545|Ga0105237_11219777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 759 | Open in IMG/M |
| 3300009545|Ga0105237_12161853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 566 | Open in IMG/M |
| 3300009551|Ga0105238_10159292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2233 | Open in IMG/M |
| 3300009551|Ga0105238_11024331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 847 | Open in IMG/M |
| 3300009551|Ga0105238_11333749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 744 | Open in IMG/M |
| 3300009553|Ga0105249_10199905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1955 | Open in IMG/M |
| 3300009792|Ga0126374_10331014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 1036 | Open in IMG/M |
| 3300009803|Ga0105065_1011956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 924 | Open in IMG/M |
| 3300009840|Ga0126313_10353650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1158 | Open in IMG/M |
| 3300010041|Ga0126312_11305886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 537 | Open in IMG/M |
| 3300010043|Ga0126380_10538729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 905 | Open in IMG/M |
| 3300010166|Ga0126306_10442084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1022 | Open in IMG/M |
| 3300010366|Ga0126379_12890472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 575 | Open in IMG/M |
| 3300010371|Ga0134125_10447867 | Not Available | 1432 | Open in IMG/M |
| 3300010373|Ga0134128_10431355 | Not Available | 1471 | Open in IMG/M |
| 3300010375|Ga0105239_10880706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1027 | Open in IMG/M |
| 3300010397|Ga0134124_11022872 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 839 | Open in IMG/M |
| 3300010400|Ga0134122_10588192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1026 | Open in IMG/M |
| 3300010403|Ga0134123_10368793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1304 | Open in IMG/M |
| 3300010854|Ga0126360_1030603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300010858|Ga0126345_1064404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300011120|Ga0150983_12230747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 810 | Open in IMG/M |
| 3300011422|Ga0137425_1165167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 552 | Open in IMG/M |
| 3300011438|Ga0137451_1269283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 536 | Open in IMG/M |
| 3300012189|Ga0137388_11920874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 522 | Open in IMG/M |
| 3300012206|Ga0137380_10084426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2904 | Open in IMG/M |
| 3300012207|Ga0137381_11022486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 712 | Open in IMG/M |
| 3300012209|Ga0137379_10417058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1252 | Open in IMG/M |
| 3300012211|Ga0137377_11238360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 676 | Open in IMG/M |
| 3300012212|Ga0150985_113188182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 843 | Open in IMG/M |
| 3300012356|Ga0137371_10962719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 648 | Open in IMG/M |
| 3300012469|Ga0150984_114835772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 664 | Open in IMG/M |
| 3300012493|Ga0157355_1027309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 569 | Open in IMG/M |
| 3300012502|Ga0157347_1054922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300012917|Ga0137395_10549057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 834 | Open in IMG/M |
| 3300012922|Ga0137394_10869598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 753 | Open in IMG/M |
| 3300012923|Ga0137359_11175240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 655 | Open in IMG/M |
| 3300012924|Ga0137413_10854319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300012924|Ga0137413_11794960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 506 | Open in IMG/M |
| 3300012929|Ga0137404_11626452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 599 | Open in IMG/M |
| 3300012941|Ga0162652_100018987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300012951|Ga0164300_11214326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 501 | Open in IMG/M |
| 3300012957|Ga0164303_10114764 | Not Available | 1362 | Open in IMG/M |
| 3300012957|Ga0164303_11421258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 520 | Open in IMG/M |
| 3300012976|Ga0134076_10606808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 511 | Open in IMG/M |
| 3300012986|Ga0164304_10807505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 724 | Open in IMG/M |
| 3300012986|Ga0164304_11838644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
| 3300012987|Ga0164307_10495338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 922 | Open in IMG/M |
| 3300012988|Ga0164306_11437598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 588 | Open in IMG/M |
| 3300012989|Ga0164305_10953176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 725 | Open in IMG/M |
| 3300012989|Ga0164305_12058625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 522 | Open in IMG/M |
| 3300013297|Ga0157378_10317892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1512 | Open in IMG/M |
| 3300013754|Ga0120183_1022085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 547 | Open in IMG/M |
| 3300014166|Ga0134079_10249292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 767 | Open in IMG/M |
| 3300014326|Ga0157380_13163077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300014658|Ga0181519_10455998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 788 | Open in IMG/M |
| 3300014658|Ga0181519_10745378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 605 | Open in IMG/M |
| 3300014745|Ga0157377_10747824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 715 | Open in IMG/M |
| 3300014968|Ga0157379_12209381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 547 | Open in IMG/M |
| 3300014969|Ga0157376_12459952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 560 | Open in IMG/M |
| 3300015089|Ga0167643_1032322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 811 | Open in IMG/M |
| 3300015160|Ga0167642_1068500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 511 | Open in IMG/M |
| 3300015241|Ga0137418_10363884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1190 | Open in IMG/M |
| 3300015371|Ga0132258_12209580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1381 | Open in IMG/M |
| 3300015372|Ga0132256_101562729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 770 | Open in IMG/M |
| 3300016270|Ga0182036_11697703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 533 | Open in IMG/M |
| 3300016357|Ga0182032_10569075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 939 | Open in IMG/M |
| 3300016371|Ga0182034_12041019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 506 | Open in IMG/M |
| 3300017544|Ga0182735_1211384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 511 | Open in IMG/M |
| 3300017652|Ga0182746_1152133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 782 | Open in IMG/M |
| 3300017966|Ga0187776_10627990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 752 | Open in IMG/M |
| 3300018061|Ga0184619_10454760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 571 | Open in IMG/M |
| 3300018075|Ga0184632_10132840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1096 | Open in IMG/M |
| 3300018088|Ga0187771_11261180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 627 | Open in IMG/M |
| 3300018431|Ga0066655_10725831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 673 | Open in IMG/M |
| 3300018468|Ga0066662_10999252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 828 | Open in IMG/M |
| 3300019377|Ga0190264_10587241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 790 | Open in IMG/M |
| 3300020034|Ga0193753_10256012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 775 | Open in IMG/M |
| 3300020579|Ga0210407_10771109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 743 | Open in IMG/M |
| 3300020582|Ga0210395_10898751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 658 | Open in IMG/M |
| 3300021088|Ga0210404_10097597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1476 | Open in IMG/M |
| 3300021171|Ga0210405_10223269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1492 | Open in IMG/M |
| 3300021361|Ga0213872_10423283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 538 | Open in IMG/M |
| 3300021377|Ga0213874_10116394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 904 | Open in IMG/M |
| 3300021404|Ga0210389_10353578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1154 | Open in IMG/M |
| 3300021405|Ga0210387_10736931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 872 | Open in IMG/M |
| 3300021405|Ga0210387_11003137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 731 | Open in IMG/M |
| 3300021420|Ga0210394_10017034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 6847 | Open in IMG/M |
| 3300021432|Ga0210384_11100768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 698 | Open in IMG/M |
| 3300021474|Ga0210390_10688633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 852 | Open in IMG/M |
| 3300021477|Ga0210398_10409416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1106 | Open in IMG/M |
| 3300021559|Ga0210409_10392366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1243 | Open in IMG/M |
| 3300021559|Ga0210409_11218147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 628 | Open in IMG/M |
| 3300021560|Ga0126371_13534841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 527 | Open in IMG/M |
| 3300022225|Ga0187833_10563902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300022715|Ga0242678_1032998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 690 | Open in IMG/M |
| 3300022722|Ga0242657_1064783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300022726|Ga0242654_10221283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 667 | Open in IMG/M |
| 3300022726|Ga0242654_10403196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300022756|Ga0222622_10191752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1350 | Open in IMG/M |
| 3300022896|Ga0247781_1018892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2181 | Open in IMG/M |
| 3300022897|Ga0247764_1179811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 643 | Open in IMG/M |
| 3300022911|Ga0247783_1132470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 694 | Open in IMG/M |
| 3300023068|Ga0224554_1089717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 722 | Open in IMG/M |
| 3300023079|Ga0247758_1069298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 964 | Open in IMG/M |
| 3300023100|Ga0247738_10197288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 652 | Open in IMG/M |
| 3300023169|Ga0247762_1076870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 926 | Open in IMG/M |
| 3300024288|Ga0179589_10061540 | Not Available | 1446 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10536002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 588 | Open in IMG/M |
| 3300025261|Ga0209233_1050875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 843 | Open in IMG/M |
| 3300025273|Ga0209673_1078720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 761 | Open in IMG/M |
| 3300025304|Ga0209257_1095344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 735 | Open in IMG/M |
| 3300025711|Ga0207696_1163457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae | 592 | Open in IMG/M |
| 3300025905|Ga0207685_10084885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1319 | Open in IMG/M |
| 3300025907|Ga0207645_10294063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1080 | Open in IMG/M |
| 3300025908|Ga0207643_10849053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 592 | Open in IMG/M |
| 3300025908|Ga0207643_11126484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 506 | Open in IMG/M |
| 3300025915|Ga0207693_10832824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 710 | Open in IMG/M |
| 3300025919|Ga0207657_10256229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1393 | Open in IMG/M |
| 3300025919|Ga0207657_10418374 | Not Available | 1053 | Open in IMG/M |
| 3300025923|Ga0207681_10117213 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300025929|Ga0207664_11988918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 504 | Open in IMG/M |
| 3300025931|Ga0207644_11616123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 544 | Open in IMG/M |
| 3300025942|Ga0207689_10101297 | Not Available | 2366 | Open in IMG/M |
| 3300025945|Ga0207679_11204599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 695 | Open in IMG/M |
| 3300025986|Ga0207658_10741895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 889 | Open in IMG/M |
| 3300026023|Ga0207677_10903152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 796 | Open in IMG/M |
| 3300026023|Ga0207677_11426071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 638 | Open in IMG/M |
| 3300026067|Ga0207678_10730870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 872 | Open in IMG/M |
| 3300026078|Ga0207702_11257985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 734 | Open in IMG/M |
| 3300026121|Ga0207683_10548165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1069 | Open in IMG/M |
| 3300026121|Ga0207683_11343363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 661 | Open in IMG/M |
| 3300026142|Ga0207698_11509777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 687 | Open in IMG/M |
| 3300026323|Ga0209472_1300036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 514 | Open in IMG/M |
| 3300026343|Ga0209159_1194062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 669 | Open in IMG/M |
| 3300026542|Ga0209805_1107244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1329 | Open in IMG/M |
| 3300026551|Ga0209648_10018176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6140 | Open in IMG/M |
| 3300027603|Ga0209331_1165514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 519 | Open in IMG/M |
| 3300027736|Ga0209190_1301774 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 611 | Open in IMG/M |
| 3300027862|Ga0209701_10511228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 651 | Open in IMG/M |
| 3300027866|Ga0209813_10496679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 506 | Open in IMG/M |
| 3300027869|Ga0209579_10498532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 661 | Open in IMG/M |
| 3300028379|Ga0268266_10313021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1467 | Open in IMG/M |
| 3300028536|Ga0137415_10930841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 679 | Open in IMG/M |
| 3300028558|Ga0265326_10186158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. | 595 | Open in IMG/M |
| 3300028590|Ga0247823_10840962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 689 | Open in IMG/M |
| 3300028652|Ga0302166_10114717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 609 | Open in IMG/M |
| 3300028762|Ga0302202_10453227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 586 | Open in IMG/M |
| 3300028784|Ga0307282_10128570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1190 | Open in IMG/M |
| 3300028811|Ga0307292_10137051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 982 | Open in IMG/M |
| 3300028813|Ga0302157_10510475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300029911|Ga0311361_11333939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 558 | Open in IMG/M |
| 3300029956|Ga0302150_10103246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1095 | Open in IMG/M |
| 3300029986|Ga0302188_10303047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 660 | Open in IMG/M |
| 3300030051|Ga0302195_10043275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2583 | Open in IMG/M |
| 3300030620|Ga0302046_10404388 | Not Available | 1121 | Open in IMG/M |
| 3300031184|Ga0307499_10224877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 588 | Open in IMG/M |
| 3300031198|Ga0307500_10202498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 593 | Open in IMG/M |
| 3300031366|Ga0307506_10056044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1166 | Open in IMG/M |
| 3300031446|Ga0170820_15937084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 502 | Open in IMG/M |
| 3300031455|Ga0307505_10362572 | Not Available | 686 | Open in IMG/M |
| 3300031456|Ga0307513_10609702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 800 | Open in IMG/M |
| 3300031573|Ga0310915_11124561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 545 | Open in IMG/M |
| 3300031708|Ga0310686_113379984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 505 | Open in IMG/M |
| 3300031715|Ga0307476_10121313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1861 | Open in IMG/M |
| 3300031718|Ga0307474_11526053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300031770|Ga0318521_10540152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 702 | Open in IMG/M |
| 3300031798|Ga0318523_10588576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 548 | Open in IMG/M |
| 3300031805|Ga0318497_10533222 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 658 | Open in IMG/M |
| 3300031823|Ga0307478_10255448 | Not Available | 1425 | Open in IMG/M |
| 3300031824|Ga0307413_10685554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 849 | Open in IMG/M |
| 3300031831|Ga0318564_10015703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3082 | Open in IMG/M |
| 3300031833|Ga0310917_10026277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3401 | Open in IMG/M |
| 3300031879|Ga0306919_10101221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2027 | Open in IMG/M |
| 3300031890|Ga0306925_11087050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 809 | Open in IMG/M |
| 3300031901|Ga0307406_10826868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 783 | Open in IMG/M |
| 3300031912|Ga0306921_11512462 | Not Available | 733 | Open in IMG/M |
| 3300031942|Ga0310916_10814125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 786 | Open in IMG/M |
| 3300031947|Ga0310909_11512902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 534 | Open in IMG/M |
| 3300031954|Ga0306926_11384481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 817 | Open in IMG/M |
| 3300031995|Ga0307409_101567728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 686 | Open in IMG/M |
| 3300032005|Ga0307411_10719605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 871 | Open in IMG/M |
| 3300032009|Ga0318563_10434781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 710 | Open in IMG/M |
| 3300032059|Ga0318533_11258270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 541 | Open in IMG/M |
| 3300032074|Ga0308173_10519706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1068 | Open in IMG/M |
| 3300032076|Ga0306924_11082123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
| 3300032094|Ga0318540_10389662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 673 | Open in IMG/M |
| 3300032205|Ga0307472_100997081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 784 | Open in IMG/M |
| 3300032770|Ga0335085_11151833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 827 | Open in IMG/M |
| 3300032892|Ga0335081_12748467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 501 | Open in IMG/M |
| 3300032893|Ga0335069_11120845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 866 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.25% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.25% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.25% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.50% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.12% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.75% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.37% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.37% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.37% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.37% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.37% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.37% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.37% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.37% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.37% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.37% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.37% |
| Root Nodules | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules | 0.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.37% |
| Wastewater Bioreactor | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Host-Associated | Open in IMG/M |
| 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Host-Associated | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005513 | Combined assembly of arab plate scrape CL_Cvi (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006183 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_500_biof - 1398105537950 (version 2) | Engineered | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010854 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013754 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015160 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017544 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C Kraft MG (version 2) | Environmental | Open in IMG/M |
| 3300017652 | Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C BE-Lig OP (version 2) | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022896 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L184-509B-5 | Environmental | Open in IMG/M |
| 3300022897 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L051-202B-4 | Environmental | Open in IMG/M |
| 3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300023079 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L156-409C-4 | Environmental | Open in IMG/M |
| 3300023100 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L013-104B-2 | Environmental | Open in IMG/M |
| 3300023169 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_107720521 | 3300001593 | Forest Soil | RILQRGAFLHQLLRFLWIVPEIGVFGELVQLRQACGGFFDVKDASSAARLTA* |
| C688J35102_1200070832 | 3300002568 | Soil | ILQRGAFLHQLLRLLGVVPEIGIFRELVQLGEPRRGLIDVKDASSAARLTA* |
| JGI25153J46596_100712792 | 3300003215 | Arabidopsis Rhizosphere | LGLLGIVPEIGIFGELVQLGEASRGLFDVKDASSAARLTA* |
| Ga0055526_10690761 | 3300003771 | Arabidopsis Root | LDLADARQRVLKRGSLLHQLLGLLGIVPEVGIFCELVQLGEACRRFLDVKDASSAARLTA |
| Ga0066823_101522032 | 3300005163 | Soil | LQRGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA* |
| Ga0068869_1013742192 | 3300005334 | Miscanthus Rhizosphere | RILQRGALLHQLLGLLGIVPEIGIFGELVQLGEPCRGLFNVKDASSAARQTA* |
| Ga0068869_1020038331 | 3300005334 | Miscanthus Rhizosphere | HQRGALLHQLLGLLGIVPEIGIFGELIQLGKASRGCLDVKDASSAARLTA* |
| Ga0070660_1012505261 | 3300005339 | Corn Rhizosphere | ELACDFADAAERILQRGPLLHELLRLLRIVPEVGVFCELVQLRKAGRGFLDVKDASSAARLTA* |
| Ga0070691_110851681 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | RILQRGALLHQLLGLLGIVPEVGVFGELVQLREACRRFLDVKDASSAARQTA* |
| Ga0070692_104869892 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | ALLHQLLGLLGIVPEIGIFGELVQLGEPSRGFLDVKDASSAARLTA* |
| Ga0070669_1006786571 | 3300005353 | Switchgrass Rhizosphere | ALLHQLLGLLGIVPEIGIFGELVQLGKASRGCLDVKDASSAARLTA* |
| Ga0070671_1005752802 | 3300005355 | Switchgrass Rhizosphere | RGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA* |
| Ga0070671_1006662481 | 3300005355 | Switchgrass Rhizosphere | ALDLADALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA* |
| Ga0070705_1018750292 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVHQRGALLHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA* |
| Ga0066681_109137111 | 3300005451 | Soil | RVLQRGALLHQLLRFLRIVPEIGIFRELVQLGEPRRRFLDVKDASSAARPTA* |
| Ga0070663_1003087822 | 3300005455 | Corn Rhizosphere | DLADALQRIHQRGALLHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSAARLTA* |
| Ga0070678_1000699822 | 3300005456 | Miscanthus Rhizosphere | LADALQRIHQRGALLHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSAARLTA* |
| Ga0077120_10788413 | 3300005513 | Arabidopsis Rhizosphere | LADARERILQRGALLHQLLGLLGVVPEIGIFCELVQLSEARRRCLDVKDASSAARLTA* |
| Ga0068853_1010802341 | 3300005539 | Corn Rhizosphere | DALQRILQRGALLHQLLGLLGIVPEIGIFGELVQLGKPCRGFLDVKDASSAARLTA* |
| Ga0068853_1020548171 | 3300005539 | Corn Rhizosphere | PLLHQLLGFLRIVPEIGMFGERVQFGETRRCSIDVKDASSAVRQTA* |
| Ga0070733_104312001 | 3300005541 | Surface Soil | RGSLLHQLLRLLGIVPEIGVFGKLVQLRQARGGFFDVKDASSAARPTA* |
| Ga0070672_1007606771 | 3300005543 | Miscanthus Rhizosphere | IVPEIGIFGELVQLGKASRGCLDVKDASSAARLTA* |
| Ga0070696_1015592311 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LLHQLLGLLGIVPEIGIFGELVQLGEASRGLLDVKDASSAARLTA* |
| Ga0070665_1004810742 | 3300005548 | Switchgrass Rhizosphere | QLLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA* |
| Ga0070665_1014567752 | 3300005548 | Switchgrass Rhizosphere | QLLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA* |
| Ga0070665_1019764491 | 3300005548 | Switchgrass Rhizosphere | ALDLADALQRIHQRGALLHQLLGLLGIVPEIGIFSELVQLGEACRGLFDVKDASSAARLTA* |
| Ga0066692_110328272 | 3300005555 | Soil | GLLGIVPEIGVFGELVQLGQTSRGLLDVKDASSAARLTA* |
| Ga0066670_107045862 | 3300005560 | Soil | RILQRGALLHQLLRLLRIVPEIGIFRELVQLRQTRRGFFNVKDASSAARLTA* |
| Ga0066708_106185071 | 3300005576 | Soil | KRILERGPLLHQLLRLLGIVPEIGVFGELVQLRKTCRGFFDVKDASSAARLTA* |
| Ga0066691_108135541 | 3300005586 | Soil | KRVLQRGALLHQLLRFLRIVPEIGIFRELVQLGEPRRRFLDVKDASSAARPTA* |
| Ga0066654_104683342 | 3300005587 | Soil | RIVPEIGIFRELVQLGEPRRRFLDVKDASSAARPTA* |
| Ga0066706_104554851 | 3300005598 | Soil | IVPEIGIFRELVQLGEPRRRFLDVKDASSAARPTA* |
| Ga0068856_1008270931 | 3300005614 | Corn Rhizosphere | LLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA* |
| Ga0068856_1015524801 | 3300005614 | Corn Rhizosphere | LGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA* |
| Ga0066903_1067513572 | 3300005764 | Tropical Forest Soil | QLLGLLGIVPEIGVFGELVQLGEACRRFLDVKDASSAARLTA* |
| Ga0068863_1016385022 | 3300005841 | Switchgrass Rhizosphere | RGALLHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA* |
| Ga0068860_1024600031 | 3300005843 | Switchgrass Rhizosphere | LLGLLGIVPEIGIFGELVQLGEASRGLFDVKDASSAARLTA* |
| Ga0068862_1001713792 | 3300005844 | Switchgrass Rhizosphere | LGIVPEIGIFGELVQLGEASRGFLDVKDASSAARLTA* |
| Ga0068862_1027499352 | 3300005844 | Switchgrass Rhizosphere | RGALLHQLLGLLGIVPEIGIFCELVQLGEACRRFLDVKDASSAARLTA* |
| Ga0081455_108429372 | 3300005937 | Tabebuia Heterophylla Rhizosphere | IVPEIGVFGELVQLGKACRRFLDVKDASSAARLTA* |
| Ga0080026_102739951 | 3300005952 | Permafrost Soil | LQRGSLLHQLLRLLGIVPEIGIFGELVQFGQTRRGCINVKDASSAARLTA* |
| Ga0081540_10485902 | 3300005983 | Tabebuia Heterophylla Rhizosphere | LGIVPEIGVFGELVQLGKACRRFLDVKDASSAARLTA* |
| Ga0081540_11346881 | 3300005983 | Tabebuia Heterophylla Rhizosphere | HQFLGLLGIVPEIGIFGETVQLGEPGRGFLDVKDASSAARLTA* |
| Ga0081539_103565891 | 3300005985 | Tabebuia Heterophylla Rhizosphere | LGIVPEIGIFGELVQLGQPCRRFLDVKDASSAARLTA* |
| Ga0066789_101725911 | 3300005994 | Soil | ERILQRGALLHQLLRLLRIVPEIGGLGELVQLRQTRGGFLDVKDASSAARPTA* |
| Ga0066656_104877112 | 3300006034 | Soil | DAAKRILKRGPLLHQLLRLLGIVPEIGVFGELVQLRKTCRGFFDVKDASSAARLTA* |
| Ga0075365_100964211 | 3300006038 | Populus Endosphere | QLLGLLGIVPEIGIFGEFVQLGEASRGFLDVKDASSAARLTA* |
| Ga0075365_101312042 | 3300006038 | Populus Endosphere | LGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA* |
| Ga0075365_107114362 | 3300006038 | Populus Endosphere | LRVVPEIGIFSELVQLREARRGCIDVKDASSAARQTA* |
| Ga0075364_100925271 | 3300006051 | Populus Endosphere | DLADALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA* |
| Ga0075015_1000981872 | 3300006102 | Watersheds | RILQRGPLLHQLLRLLGIVPEVGVFGELVQLRQTRGGFFDVKDASSAARLTA* |
| Ga0075018_107215162 | 3300006172 | Watersheds | RGALLHQLLGLLGVVPEIGIFGELVQLSQPRRRLLDVKDASSAARPTA* |
| Ga0075014_1006686411 | 3300006174 | Watersheds | LQRGSLLHQLLRLLGIVPEIRGFGELVQFRQTRGGLFDVKDASSAARLTA* |
| Ga0097677_10903781 | 3300006183 | Wastewater Bioreactor | LLHQLLRLLGIVPEIWIFGEFVQFRQSRGRCFDIKDASSAARPTA* |
| Ga0075369_103926491 | 3300006186 | Populus Endosphere | QRILQRGALLHQLLGLLGIVPEIGIFGELVQLGEPGRGLFDVKDASSAARLTA* |
| Ga0075021_102038982 | 3300006354 | Watersheds | ILQRGSLLHQLLRLLGIVPEIRGFGELVQFRQTRGGLFDVKDASSAARLTA* |
| Ga0075021_103535541 | 3300006354 | Watersheds | LQRGSLLHQLLRLLGIVPEIGVFCELVQLGKTRRGCIDVKDASSAARPTA* |
| Ga0079222_108563412 | 3300006755 | Agricultural Soil | LDLADACERILQRGPLLHQLLCLLRIVPEIGVFGELVQLSQTRGGFFDVKDASSAARPTA |
| Ga0075433_110647402 | 3300006852 | Populus Rhizosphere | QRGALLHQLLGLLGIVPEIGVFGELVQLGEACRRFLDVKDASSAARLTA* |
| Ga0099823_10609822 | 3300006944 | Root Nodules | QRGALLHQFLGFLGIVPEIGIFCELVQLSEARRRFLDVKDASSAARLTA* |
| Ga0074063_100404292 | 3300006953 | Soil | QRGALLHQLLGLLGIVPEIGVFGELVQLGQPCRRFLDVKDASSAARLTA* |
| Ga0074063_101092982 | 3300006953 | Soil | GALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA* |
| Ga0075435_1001041131 | 3300007076 | Populus Rhizosphere | IHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA* |
| Ga0099830_104457082 | 3300009088 | Vadose Zone Soil | LDIVAEFALNLADALKPILQRGALLHQFLGLLGIVPEIGIFRELVQLGEARRRFFDVKDASSAARLTA* |
| Ga0099828_105999451 | 3300009089 | Vadose Zone Soil | RGALLHQLLRLLGIVPEIGSFRELVQLGETRRGLFDVKDASSAARLTA* |
| Ga0105250_103083351 | 3300009092 | Switchgrass Rhizosphere | DALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA* |
| Ga0075418_108320851 | 3300009100 | Populus Rhizosphere | LHQFLGFLGIVPEIGVFRELVQLSESCRRLVDVKDASSAARATA* |
| Ga0105247_100997042 | 3300009101 | Switchgrass Rhizosphere | IVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA* |
| Ga0105247_102422431 | 3300009101 | Switchgrass Rhizosphere | RILQRGALLHQLLGLLGVVPEIGVFGELVQLGKPGRRLFDVKDASSAARLTA* |
| Ga0066709_1037225012 | 3300009137 | Grasslands Soil | LGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA* |
| Ga0105243_114145951 | 3300009148 | Miscanthus Rhizosphere | LHQLLGLLRIVPEIGIFGELVQLGEPCRGFLDVKDASSAARLTA* |
| Ga0111538_120832002 | 3300009156 | Populus Rhizosphere | ALLHQLLGLLGIVPEIGIFGEVVQLGETSRGFLDVKDASSAARLTA* |
| Ga0105241_103166432 | 3300009174 | Corn Rhizosphere | HQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSAARLTA* |
| Ga0105242_109476301 | 3300009176 | Miscanthus Rhizosphere | ERILQRGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA* |
| Ga0105242_118203741 | 3300009176 | Miscanthus Rhizosphere | DALQRIHQRGALLHQLLGLLGIVPEIGIFSELVQLGEARRGLFDVKDASSAARLTA* |
| Ga0105237_112197772 | 3300009545 | Corn Rhizosphere | LGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA* |
| Ga0105237_121618532 | 3300009545 | Corn Rhizosphere | LLHQLLGLLGIVPEIGIFSELVQLSEACRRLFDVKDASSAARLTA* |
| Ga0105238_101592922 | 3300009551 | Corn Rhizosphere | GIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA* |
| Ga0105238_110243311 | 3300009551 | Corn Rhizosphere | IHQRGALLHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSSARLTA* |
| Ga0105238_113337491 | 3300009551 | Corn Rhizosphere | RGALLHQLLGFLGIVPEVGIFCELVQLSEARRRFIDVKDASSAARLTA* |
| Ga0105249_101999052 | 3300009553 | Switchgrass Rhizosphere | IHQRGALLHQLLGLLGIVPEIGIFGELIQLGKASRGCLDVKDASSAARLTA* |
| Ga0126374_103310142 | 3300009792 | Tropical Forest Soil | ALLHQLLRLLRIVPELGIFGELAQLGEARRRCLDVKDASSAVRPTA* |
| Ga0105065_10119562 | 3300009803 | Groundwater Sand | LDIVFELTLDLADAVERIHQRGALLHQLLGLLGIVPEIGIFGELVQLGEASCRFLDVKDGSSAARLTA* |
| Ga0126313_103536502 | 3300009840 | Serpentine Soil | LGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA* |
| Ga0126312_113058862 | 3300010041 | Serpentine Soil | LGIVPEIAVFRELVQLGQTRRGCFDVKDASSAARLTA* |
| Ga0126380_105387291 | 3300010043 | Tropical Forest Soil | LLGLLGIVPEIGIFGELVQLGQPCRRFLDVKDASSAARLTA* |
| Ga0126306_104420841 | 3300010166 | Serpentine Soil | ALERVHQRGALLHQLLGLLGIVPEIGIFGELVQLGESSRGFLDVKDASSAARLTA* |
| Ga0126379_128904721 | 3300010366 | Tropical Forest Soil | MIGKLALDPADAGQRILQRGALLHQLLCFLGVVPEIGVFGEPVQLGQSRRRFLDVKDASSAARLTA* |
| Ga0134125_104478671 | 3300010371 | Terrestrial Soil | RIHQRGALLHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSAARLTA* |
| Ga0134128_104313551 | 3300010373 | Terrestrial Soil | ALHLADAVERILKRGALLHHLLRLLGIIPEIGVFVEIVQLGQSRRRFLDVKDASSAARPTA* |
| Ga0105239_108807061 | 3300010375 | Corn Rhizosphere | IHQRGALLHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSAARLTA* |
| Ga0134124_110228721 | 3300010397 | Terrestrial Soil | LRLLGVVPEIGVFGELVQFGKTRRGFFDVKDASSAAR |
| Ga0134122_105881921 | 3300010400 | Terrestrial Soil | VPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA* |
| Ga0134123_103687931 | 3300010403 | Terrestrial Soil | ALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA* |
| Ga0126360_10306032 | 3300010854 | Boreal Forest Soil | GIVPEIGIFGELVQFGQTRRGCIDVKDASSAARPTA* |
| Ga0126345_10644042 | 3300010858 | Boreal Forest Soil | SSSRYLADAGQRILQRGPLLHQLLGLLGIVPEVGIFRELVQLGETRRGGIDVKDASSAARPTA* |
| Ga0150983_122307471 | 3300011120 | Forest Soil | RILQRGAFLHQLLRFLWIVPEIGVFGELVQLGEPCRRLIDVKDASSAARLTA* |
| Ga0137425_11651671 | 3300011422 | Soil | IVPEIGIFGELVQLGEASCRFLDVKDASSAARLTA* |
| Ga0137451_12692832 | 3300011438 | Soil | LLGIVPEIGVFGELVQFGEPRRGLFDVKDASSAARLTA* |
| Ga0137388_119208742 | 3300012189 | Vadose Zone Soil | ALDLADAIERILQRGALLHQLLRLLGIVPEIGSFRELVQLGETRRGLFDVKDASSAARLTA* |
| Ga0137380_100844265 | 3300012206 | Vadose Zone Soil | HHALGAGGIIPKVGVFRELVQLGEAGRRFVDVKDASSAARATA* |
| Ga0137381_110224861 | 3300012207 | Vadose Zone Soil | RILKRGALLHQLLGLLRIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA* |
| Ga0137379_104170581 | 3300012209 | Vadose Zone Soil | LADALQRVLQRGTLLHQLLGLLGIVPEIWIFGELVQLGEPRRGLFDVKDASSAARQTA* |
| Ga0137377_112383602 | 3300012211 | Vadose Zone Soil | ERILQRGALLHQLLRLLGIVPEIGIFRELVQLRQTRRGFFDVKDASSAARLTA* |
| Ga0150985_1131881821 | 3300012212 | Avena Fatua Rhizosphere | QLLRLLGIVPEVGVFCELVQLSEARRGFLDVKDASSAARLTA* |
| Ga0137371_109627192 | 3300012356 | Vadose Zone Soil | LRLLRIVPEIGIFRELVQLRQTRRGFFDVKDASSAARLTA* |
| Ga0150984_1148357721 | 3300012469 | Avena Fatua Rhizosphere | LHQLLRLLGIVPEVGVLGELVQLREARGGLFDVKDASSAARLTA* |
| Ga0157355_10273091 | 3300012493 | Unplanted Soil | LADAGQRILQRGALLHQPLGLLGIVPEIGVFGELVQLGEACRRFLDVKDASSAARLTA* |
| Ga0157347_10549221 | 3300012502 | Arabidopsis Rhizosphere | VPEVRIFCELVQLSEARRRFLDVKDASSAARPTA* |
| Ga0137395_105490572 | 3300012917 | Vadose Zone Soil | ALLHQFLRLLGVVREVGIFRELVQLGETRRGFLDVKDASSAARLTA* |
| Ga0137394_108695982 | 3300012922 | Vadose Zone Soil | ALDLADALERIHQRGALLHQLLGLLGIVPEIGIFGELVQLGKASRGVLDVKDASSAARLTA* |
| Ga0137359_111752402 | 3300012923 | Vadose Zone Soil | LLHQLLRLLRIVPEIGIFRELVQLRQTRRGFFNVKDASSAARLTA* |
| Ga0137413_108543192 | 3300012924 | Vadose Zone Soil | LGFLRIVPEIGVFGELVQLGEARGGFLDVKDASSAARLTA* |
| Ga0137413_117949601 | 3300012924 | Vadose Zone Soil | RGALLHQLLGLLGIVPEIGIFRELVQLREARRGCIDVKDASSAARLTA* |
| Ga0137404_116264522 | 3300012929 | Vadose Zone Soil | IERILQRGSLLHQLLRLLGIVPEIGGFGELVQFGQTGRGLFDVKDASSAARPTA* |
| Ga0162652_1000189872 | 3300012941 | Soil | IVPEIGIFGELVQFREAGRGCIDVKDASSAARQTA* |
| Ga0164300_112143262 | 3300012951 | Soil | LLHQLLGLLGIVPEIGVFGELVQLGKAGSRCLDVKDASSAAPLTA* |
| Ga0164303_101147641 | 3300012957 | Soil | LLGIVPEIGSFRELVQLGQTCRGFLDVKDASSAARLTA* |
| Ga0164303_114212582 | 3300012957 | Soil | QRGPLLHQLLRLLGIVPEIGVLSQLVQLGKTRRGCLDVKDASSAARLTA* |
| Ga0134076_106068082 | 3300012976 | Grasslands Soil | LGIVPEIGIFRELVQLGQTRRGFFDVKDASSAARLTA* |
| Ga0164304_108075051 | 3300012986 | Soil | ALLHQFLRLLGIVPEIGIFRELVQLGQTRRGFLDVKDASSAARLTA* |
| Ga0164304_118386441 | 3300012986 | Soil | ERILKRGSLLHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA* |
| Ga0164307_104953381 | 3300012987 | Soil | LDLADAIERVLQRGPLLHQLLCLLGIVPEVGVFGELVQLREACSGLFDVKDASSAARLTA |
| Ga0164306_114375981 | 3300012988 | Soil | HQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA* |
| Ga0164305_109531761 | 3300012989 | Soil | LADARERILKRGALLHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA* |
| Ga0164305_120586251 | 3300012989 | Soil | DLADTGQRILQRGALLHQLLSLLGIVPEIGILGELVPLSQPRRRFLDVKDASSAARPTA* |
| Ga0157378_103178922 | 3300013297 | Miscanthus Rhizosphere | ADSLQRILQRGALLHQLLGLLGVVPELGAFGELVQLGKPGRRLFDVKDASSAARLTA* |
| Ga0120183_10220851 | 3300013754 | Terrestrial | MARIRAPLLAEVLGFLGIVPEIGIFGELVQLCQPCRRFLDVKDASSAARPTA* |
| Ga0134079_102492922 | 3300014166 | Grasslands Soil | IIPEIGVFGELVQLRKARRGFFDVKDASSAARLTA* |
| Ga0157380_131630772 | 3300014326 | Switchgrass Rhizosphere | LDLADALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA |
| Ga0181519_104559982 | 3300014658 | Bog | FLGLLGIVPEIGIFGELVQLGQTRRGLIDVKDASSAARPTA* |
| Ga0181519_107453781 | 3300014658 | Bog | QFLGLLGIVPEIGIFGELVQLGQTRRGLIDVKDASSAARQTA* |
| Ga0157377_107478241 | 3300014745 | Miscanthus Rhizosphere | RILQRGALLHQLLGLLGIVPEIGVFGELVQFGEPRRGLFDVKDASSAARLTA* |
| Ga0157379_122093812 | 3300014968 | Switchgrass Rhizosphere | QRGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA* |
| Ga0157376_124599522 | 3300014969 | Miscanthus Rhizosphere | LLHQLLGLLGIVPEIWIFSELVQLLEACRRLIDVKDASSAARQTA* |
| Ga0167643_10323221 | 3300015089 | Glacier Forefield Soil | QFLCLLGIVPEVGIFGELVQFGETRRGCIDVKDASSAARPTA* |
| Ga0167642_10685001 | 3300015160 | Glacier Forefield Soil | RDLADALKRILQRGSLLHQLLGLLGIVPEIGIFGELVQFGQTRRGCIDVKDASSAARLTA |
| Ga0137418_103638841 | 3300015241 | Vadose Zone Soil | IVPEIGVFGELVQFGETCRGCIDVKDASSAARQTA* |
| Ga0132258_122095801 | 3300015371 | Arabidopsis Rhizosphere | ERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA* |
| Ga0132256_1015627292 | 3300015372 | Arabidopsis Rhizosphere | LLHQLLGLLGIVPEIGVFGELVQLGQPCRRFLDVKDASSAARLTA* |
| Ga0182036_116977032 | 3300016270 | Soil | SLLHQLLRLLGIVPEPGILGELVQFRQARGGFLDVKDASSAARLTA |
| Ga0182032_105690751 | 3300016357 | Soil | GQRILQRGALLHQLLGLLRIVPEIGVFRELVQLGKPRRRCLDVKDASSAARPTA |
| Ga0182034_120410191 | 3300016371 | Soil | GQRILQRGALLHQLLGLLRIVPEIGIFSELVQLGKPRRRCLDVKDASSAARPTA |
| Ga0182735_12113842 | 3300017544 | Compost | DAAKLVFERGPLLHQLLGFLRVVPEIGVFGEVIQFGETCSCGIDVKDASSAARLTA |
| Ga0182746_11521332 | 3300017652 | Compost | LLHQLLGFLRIVPEIGVFGEVVQFGETCGCSIDVKDASSAARLTA |
| Ga0187776_106279902 | 3300017966 | Tropical Peatland | LLHQFLGLLGIVPEIGVFGELVQLGKTRGGFFDVKDASSAARPTA |
| Ga0184619_104547602 | 3300018061 | Groundwater Sediment | LKLALDLADAIERILQRGSLLHQLLRLLGIVPEIGILCELVQLRETRRGFFDVKDASSAARLTA |
| Ga0184632_101328402 | 3300018075 | Groundwater Sediment | VELTLDLADALERIHQRGALLHQLLGLLGIVPEIGIFGELIQLGEPSRGFLDVKDASSAARLTA |
| Ga0187771_112611801 | 3300018088 | Tropical Peatland | LCLLWVVPEIGVFGELVQFRQPRGGVFDVKDASSAARLTA |
| Ga0066655_107258312 | 3300018431 | Grasslands Soil | ALLHQLLRFLRIVPEIGIFRELVQLGEPRRRFLDVKDASSAARPTA |
| Ga0066662_109992521 | 3300018468 | Grasslands Soil | LHQLLGLLGIGSEIGILGELVQLGEASRGFLDVKDASSAARLTA |
| Ga0190264_105872412 | 3300019377 | Soil | HQLLRLLGIVPEIWIFGELVQLGKARRGLFDVKDASSAARQTA |
| Ga0193753_102560122 | 3300020034 | Soil | GLLGIVPEIGIFGELVQLGEPGRGLFDVKDASSAARLTA |
| Ga0210407_107711091 | 3300020579 | Soil | LHQLLGLLGIVPEIGIFGELVQLGEPCRRLIDVKDASSAARLTA |
| Ga0210395_108987512 | 3300020582 | Soil | GIVPEIGVFGKLVQLRQARGGFFDVKDASSAARPTA |
| Ga0210404_100975971 | 3300021088 | Soil | GIVPEIGVFGELVELGQTRGGRIDVKDASSAARPTA |
| Ga0210405_102232691 | 3300021171 | Soil | LHQLLRFLWIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA |
| Ga0213872_104232832 | 3300021361 | Rhizosphere | RILQRGAFLHQLLGLLRIVPEIGVFGELVQLSEARRRLLDVKDASSAARLTA |
| Ga0213874_101163941 | 3300021377 | Plant Roots | LHQLLRLLRIVPEVRVFGELVQLGKPRGRCLDVKDASSAVRPTA |
| Ga0210389_103535782 | 3300021404 | Soil | ADAIERILQRGPLLHQFLRFLGIVPEVGILRELVQFGKPCRGCIDVKDASSAARLTA |
| Ga0210387_107369312 | 3300021405 | Soil | RGAFLHQLLRFLWIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA |
| Ga0210387_110031372 | 3300021405 | Soil | ARQRVLQRGALLHQLLGLLGIVPEIGIFGELVQLGEPCRRLIDVKDASSAARLTA |
| Ga0210394_100170344 | 3300021420 | Soil | LRFLRIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA |
| Ga0210384_111007682 | 3300021432 | Soil | RGALLHQLLGLLRIVPEIGVFGELVQLGEPCRRLIDVKDASSAARLTA |
| Ga0210390_106886331 | 3300021474 | Soil | QLLRFLWNVPEIGVFGELVQLCQACSGFFDVKDASSAARLTA |
| Ga0210398_104094162 | 3300021477 | Soil | KRIVQRGSLLHQLLRLLGIIPELGIFGELVQFRQARGGFLDVKDASSAARLTA |
| Ga0210409_103923661 | 3300021559 | Soil | RGAFLHQLLRFLRIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA |
| Ga0210409_112181471 | 3300021559 | Soil | DAAQRILQRGSLLHQPLRLLGVVPEIGIFGELVQLRQTRGGLFDVKDASSAARPTA |
| Ga0126371_135348411 | 3300021560 | Tropical Forest Soil | LADAGQRVLKRGALLHQLLRFLGIVPEMGVFGELVQLSQPRRRFLDVKGASSAARPTA |
| Ga0187833_105639022 | 3300022225 | Seawater | LCVAGIVPQLGIFGEGIQFVELANRGVIVKDASSAARQTA |
| Ga0242678_10329982 | 3300022715 | Soil | DAGQRILQRGAFLHQLLRFLWIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA |
| Ga0242657_10647831 | 3300022722 | Soil | LHQLLRFLWIVPQSGFFGELVQLRQARGGFFDVKDASSAARLTA |
| Ga0242654_102212831 | 3300022726 | Soil | QLLGLLGIVPEIGIFGELVQLGEPCRRLIDVKDASSAARLTA |
| Ga0242654_104031961 | 3300022726 | Soil | AGQRILQRGALLHQLLCFLGIVPEIGIFGQLVQLGQPCRRLFDVKDASSAARQTA |
| Ga0222622_101917522 | 3300022756 | Groundwater Sediment | ILQRRALLHQPLGLLGIVPKIGIFGELVQLGKTSGGLLDVKDASSAARLTA |
| Ga0247781_10188922 | 3300022896 | Plant Litter | LHQLLGLLGIVPEIGIFGELVQLGKSRRGLFNVKDASSAARQTA |
| Ga0247764_11798111 | 3300022897 | Plant Litter | DAGQRILERGTLLHQFLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0247783_11324701 | 3300022911 | Plant Litter | FLRVVPEIGIFSELVQLREARRGCIDVKDASSAARLTA |
| Ga0224554_10897171 | 3300023068 | Soil | LALDLADAGELPLKRGALLHQLLGFLRIVPEIGVFCESVQFGEARRGSIDVKDASSAARLTA |
| Ga0247758_10692982 | 3300023079 | Plant Litter | LQRIHQRGALLHQLLGLLGIVPEIGIFSELVQLGKARRGLIDVKDASSAARQTA |
| Ga0247738_101972882 | 3300023100 | Plant Litter | IVPEIGIFSELVQLGKARRGLIDVKDASSAARQTA |
| Ga0247762_10768702 | 3300023169 | Plant Litter | DALQRIHQRGALLHQLLGLLGIVPEIGIFSELVQLGKARRGLIDVKDASSAARQTA |
| Ga0179589_100615401 | 3300024288 | Vadose Zone Soil | GIVPEIGVFRELVQFRQACGGCIDVKDASSAARLTA |
| (restricted) Ga0255047_105360022 | 3300024520 | Seawater | RGALLHQLLRFLGIIPEIGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0209233_10508751 | 3300025261 | Arabidopsis Rhizosphere | LDLADARERILQRGALLHQLLGLLGVVPEIGIFCELVQLSEACRRFLDVKDASSAARLTA |
| Ga0209673_10787201 | 3300025273 | Arabidopsis Root | LGIVPEVGIFCELVQLGEACRRFLDVKDASSAARLTA |
| Ga0209257_10953441 | 3300025304 | Arabidopsis Root | IVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0207696_11634572 | 3300025711 | Switchgrass Rhizosphere | ALDLADALERIHQRGALLHQLLGLLGIVPEIGIFGELVQLGEASRGFLDVKDASSAARLT |
| Ga0207685_100848851 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AAERILQRGSLLHQLLRLVGIVPEIGVFCELVQLSKPRRGFFDVKDASSAARPTA |
| Ga0207645_102940631 | 3300025907 | Miscanthus Rhizosphere | DSLQRILQRGALLHQLLGLLGVVPEIGVFGELVQLGKPGRRLFDVKDASSAARLTA |
| Ga0207643_108490531 | 3300025908 | Miscanthus Rhizosphere | ILQRGALLHQLLGLLRIVPEIGIFSELVQLSEARRRFLDVKDASSAARLTA |
| Ga0207643_111264842 | 3300025908 | Miscanthus Rhizosphere | LQRGALLHQLLGLLGVVPEIGVFGELVQLGKPGRRLFDVKDASSAARLTA |
| Ga0207693_108328242 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KRGPLLHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0207657_102562291 | 3300025919 | Corn Rhizosphere | LGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0207657_104183741 | 3300025919 | Corn Rhizosphere | AFGSSNAAKLVFERGPLLHQLLGFLRIVPEIGVFGEVVQFGETRGCGIDVKDASSAARLT |
| Ga0207649_115831842 | 3300025920 | Corn Rhizosphere | LRIVPEIGMFGERVQFGETRRCSIDVKDASSAVRQTA |
| Ga0207681_101172132 | 3300025923 | Switchgrass Rhizosphere | GVLLYQLLGFLGIVPEIGIFGELVQLGEASRGFLDVKDASSAARLTA |
| Ga0207664_119889181 | 3300025929 | Agricultural Soil | ELTLERGPLLHQLLGFLRIVPEIGIFGEIVQFGEACRRGVDVKDASSAARLTA |
| Ga0207644_116161231 | 3300025931 | Switchgrass Rhizosphere | LLGLLGIVPEIGMFGELVQLGQSCRGFLDVKDASSAARPTA |
| Ga0207689_101012971 | 3300025942 | Miscanthus Rhizosphere | GIVPEIGIFGELVQLGEASRGLLDVKDASSAARLTA |
| Ga0207679_112045991 | 3300025945 | Corn Rhizosphere | IQRVLQRGSLLHQFLRLLGVVPEIGVLSELVQLRKTGGGFFDVKDASSAARPTA |
| Ga0207658_107418951 | 3300025986 | Switchgrass Rhizosphere | LLHQLLGLLRIVPEIGIFGELVQLGEPCRGFLDVKDASSAARLTA |
| Ga0207677_109031522 | 3300026023 | Miscanthus Rhizosphere | LALDLADALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA |
| Ga0207677_114260711 | 3300026023 | Miscanthus Rhizosphere | GERILERGALLHQLLGLLGVVPEIGIFCELVQLGEACRRFLDVKDASSAARLTA |
| Ga0207678_107308701 | 3300026067 | Corn Rhizosphere | GLLGVVPEIGVFGELVQLGKPGRRLFDVKDASSAARLTA |
| Ga0207702_112579851 | 3300026078 | Corn Rhizosphere | ADARERILKRGPLLHQLLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0207683_105481652 | 3300026121 | Miscanthus Rhizosphere | GALLHQLLGLLGIVPEIGIFGELVQLGKASRGCLDVKDASSAARLTA |
| Ga0207683_113433631 | 3300026121 | Miscanthus Rhizosphere | DLADAFERILQRGALLHQLLGLLGIVPEIGVFGELVQFGEPRRGLFDVKDASSAARLTA |
| Ga0207698_115097771 | 3300026142 | Corn Rhizosphere | DARERILKRGSLLHQLLGFLGIVPEVGIFCELVQLSEACRRFIDVKDASSAARLTA |
| Ga0209472_13000362 | 3300026323 | Soil | RGALLHQLLRLLRIVPEIGIFRELVQLRQTRRGFFNVKDASSAARLTA |
| Ga0209159_11940622 | 3300026343 | Soil | LGIVPEIGVFGELVQLGQTSRGLLDVKDASSAARLTA |
| Ga0209805_11072441 | 3300026542 | Soil | GIVPEIGVFGELVQLRKTRRGFFDVKDASSAARLTA |
| Ga0209648_100181766 | 3300026551 | Grasslands Soil | LQRGALLHQFLRFLGVVPEIGIFGELVQLGKPRGGLFDVKDASSAARPTA |
| Ga0209331_11655141 | 3300027603 | Forest Soil | LHQLLGLLGVVPEIGIFGELVQLGQTRRGCIDVKDASSAARLTA |
| Ga0209190_13017742 | 3300027736 | Freshwater Lake | MRPLAHQLLRFGGFIPEIGVFGLPVQLGKAGARFIDVKDASSAALRTA |
| Ga0209701_105112282 | 3300027862 | Vadose Zone Soil | LHQLLGFLGIVPEIGVFRELVQLRKARRGCIDVKDASSAARLTA |
| Ga0209813_104966792 | 3300027866 | Populus Endosphere | HQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA |
| Ga0209579_104985322 | 3300027869 | Surface Soil | RFLWVVPEIGVFGELVQLRQPRGGFFDVKDASSAARLTA |
| Ga0268266_103130211 | 3300028379 | Switchgrass Rhizosphere | IVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA |
| Ga0137415_109308412 | 3300028536 | Vadose Zone Soil | LLRLLGIVPEIGVFRELVQLGKTRRGCFDVKDASSAALLTA |
| Ga0265326_101861581 | 3300028558 | Rhizosphere | ALEALDGVQAFFQIGPLAHQLLRAFGVVPEIGFFGFGVQFGEAASRRFDVKDASSAARLT |
| Ga0247823_108409622 | 3300028590 | Soil | RVLQRGALLHQLLGLLGIVPEIGIFGELIQLREASRGLFDVKDASSAARLTA |
| Ga0302166_101147171 | 3300028652 | Fen | LGLLGIVPEIGIFGEFVQFGETRRGCIDVKDASSAARQTA |
| Ga0302202_104532271 | 3300028762 | Bog | GALLHQFLGLLGIVPEIGIFGELVQLGQTRRGLIDVKDASSAARQTA |
| Ga0307282_101285701 | 3300028784 | Soil | IVPEIGIFRELVQLREARRGCIDVKDASSAARLTA |
| Ga0307292_101370512 | 3300028811 | Soil | IVPEIGIFRELVQLGETRRGFFDVKDASSAARLTA |
| Ga0302157_105104751 | 3300028813 | Bog | LHQLLCLLGIVPEIGIFGELVQLGQPRRGCIDVKDASSAARLTA |
| Ga0311361_113339391 | 3300029911 | Bog | LLHQFLGLLGIVPEIGIFGELVQLGQTRRGLIDVKDASSAARQTA |
| Ga0302150_101032461 | 3300029956 | Bog | HQLLSLLGIVPEVGVFRELVQLSKACRGCIDVKDASSAARLTA |
| Ga0302188_103030471 | 3300029986 | Bog | VERILQRGPLLHQFLGLLGIVPEIGIFGELVQLRQTRRGLIDVKDASSAARQTA |
| Ga0302195_100432751 | 3300030051 | Bog | RGALLHQFLGLLGIVPEIGIFGELVQLGQTRRGLIDVKDASSAARQTA |
| Ga0302046_104043882 | 3300030620 | Soil | ALLHKLRSLLRVVPDFGVFGELVQLREAPFGFLKVKETSSAARQTA |
| Ga0307499_102248772 | 3300031184 | Soil | LHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA |
| Ga0307500_102024982 | 3300031198 | Soil | LDLADAIERILQRGSLLHQLLRLLGIVPEVGVLCELVQLGKSRRGCTDVKDASSAARLTA |
| Ga0307506_100560441 | 3300031366 | Soil | LLHQLLGLLGIVPEIGIFGELVQLGQPCRGLFDVKDASSAARLTA |
| Ga0170820_159370841 | 3300031446 | Forest Soil | QRGSLLHQLLRLLGIIPELGIFGELVQFRQARGGFLDVKDASSAARLTA |
| Ga0307505_103625721 | 3300031455 | Soil | GLLRIVPELGVFGELVQLREAALGFLEVKETSSAARATA |
| Ga0307513_106097021 | 3300031456 | Ectomycorrhiza | LHQLLGLLRIVPEIGIFGELVQLREACRGLFDVKDASSAARLTA |
| Ga0310915_111245611 | 3300031573 | Soil | FLGIVPEIGIFGELVQLSQPRRRFLDVKDASSAARLTA |
| Ga0310686_1133799841 | 3300031708 | Soil | GFLGIVPEIGIFGELVQFGQTRRGCIDVKDASSAARPTA |
| Ga0307476_101213132 | 3300031715 | Hardwood Forest Soil | KLAFDLADAGQRILQRGAFLHQLLRFLWIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA |
| Ga0307474_115260532 | 3300031718 | Hardwood Forest Soil | ALLHQLLRFLGIVPEIGIFGELVQLSQPCRRLFDVKDASSAARQTA |
| Ga0318521_105401521 | 3300031770 | Soil | TLLHQLLSFLRIVPEIGIFCELVQLSEARRRFLDVKDASSAARPTA |
| Ga0318523_105885761 | 3300031798 | Soil | ALLHQPLRLLRIVPEIGIFGELVQLSQPRRRCLDVKDASSAARLTA |
| Ga0318497_105332221 | 3300031805 | Soil | LHQLLGLLRIVPEIGVFGELVQLRQSRRRLLDVKDASSAA |
| Ga0307478_102554482 | 3300031823 | Hardwood Forest Soil | PLLHQLLRLLWIVPEIGVFGELVQLRQPRSGFFDVKDASSAARLTA |
| Ga0307413_106855542 | 3300031824 | Rhizosphere | HQLLGLLGIVPEIGIFGELVQLGKASRGLFDVKDASSAARLTA |
| Ga0318564_100157031 | 3300031831 | Soil | AFLHQLLGFLRIVPEIGVFSELVQLGKPRRRFLDVKDASSAVRPTA |
| Ga0310917_100262771 | 3300031833 | Soil | QLLRLLGIVPELGIFGELVQFRQTRGGFSDVKDASSAARPTA |
| Ga0306919_101012211 | 3300031879 | Soil | VQRGSLLHQLLRLLGIVPEPGILGELVQFRQARGGFLDVKDASSAARLTA |
| Ga0306925_110870502 | 3300031890 | Soil | LGIVPEIGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0307406_108268682 | 3300031901 | Rhizosphere | FDLADAFQRIHQRGALLHQLLGLLGIVPEIGIFGELVQLGKASRGLFDVKDASSAARLTA |
| Ga0306921_115124621 | 3300031912 | Soil | LRIVPEIGVFGELVQLSQPRRRLLDVKDASSAARPTA |
| Ga0310916_108141252 | 3300031942 | Soil | LQRGALLHQLLRFLGIVPEIGIFGELVQLSQPRRRFLDVKDASSAARLTA |
| Ga0310909_115129022 | 3300031947 | Soil | VQRGSLLHQLLRLLGIVPELGIFSELVQFRQARGGFFDVKDASSAARPTA |
| Ga0306926_113844812 | 3300031954 | Soil | ALDLADAGQRILQRGALLHQLLGLLGIVPEIGIFRELVQLSQPRRRLLDVKDASSAARPT |
| Ga0307409_1015677282 | 3300031995 | Rhizosphere | LQRIHQRGALLHQLLGLLGIVPEIGIFGELIQLGEARRGLFDVKDASSAARLTA |
| Ga0307411_107196052 | 3300032005 | Rhizosphere | HQRGALLHQLLGLLGIVPEIGIFGELVQLGKASCGLFDVKDASSAARLTA |
| Ga0318563_104347811 | 3300032009 | Soil | ANAGQRILQRGALLHQLLRFLGIVPEIGIFGELVQLSQPRRRFLDVKDASSAARLTA |
| Ga0318533_112582701 | 3300032059 | Soil | IVPEIGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0308173_105197061 | 3300032074 | Soil | LERGPLLHQLLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0306924_110821231 | 3300032076 | Soil | LLGIVPELGIFGELVQFRQTRGGFFDVKDASSAARPTA |
| Ga0318540_103896621 | 3300032094 | Soil | RILQRGALLHQLLGLLRIVPEIGVFGELVQLRQSRRRLLDVKDASSAARLTA |
| Ga0307472_1009970811 | 3300032205 | Hardwood Forest Soil | ERILQRGALLHQLLSFLRIVPEIGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0335085_111518332 | 3300032770 | Soil | QLLGLLRIVPEIGVFGELVQLSQARRRLLDVKDASSAARLTA |
| Ga0335081_127484671 | 3300032892 | Soil | NTGQRILQRGALLHQFLGFLRIVPEVGVFGELVQLGKPCRRFLDVKDASSAARPTA |
| Ga0335069_111208451 | 3300032893 | Soil | DLADAGQRILQRRALLHQLLGLLGIVPEIGIFCELVQLSKAGRRFLDVKDASSAARLTA |
| ⦗Top⦘ |