


| Basic Information | |
|---|---|
| Family ID | F013917 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 267 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LIAQLADPSTEVKVEGINYFADTLLFAGAILALASATPRTD |
| Number of Associated Samples | 207 |
| Number of Associated Scaffolds | 267 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.75 % |
| % of genes near scaffold ends (potentially truncated) | 96.63 % |
| % of genes from short scaffolds (< 2000 bps) | 88.01 % |
| Associated GOLD sequencing projects | 192 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.382 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.730 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.341 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.064 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 267 Family Scaffolds |
|---|---|---|
| PF11412 | DsbC | 6.74 |
| PF01979 | Amidohydro_1 | 3.00 |
| PF01207 | Dus | 2.62 |
| PF00578 | AhpC-TSA | 2.25 |
| PF13620 | CarboxypepD_reg | 1.87 |
| PF02635 | DrsE | 1.50 |
| PF01850 | PIN | 1.12 |
| PF13442 | Cytochrome_CBB3 | 1.12 |
| PF13186 | SPASM | 0.75 |
| PF02604 | PhdYeFM_antitox | 0.75 |
| PF13376 | OmdA | 0.75 |
| PF00990 | GGDEF | 0.75 |
| PF00873 | ACR_tran | 0.75 |
| PF00480 | ROK | 0.75 |
| PF11752 | DUF3309 | 0.37 |
| PF13472 | Lipase_GDSL_2 | 0.37 |
| PF16036 | Chalcone_3 | 0.37 |
| PF00586 | AIRS | 0.37 |
| PF02492 | cobW | 0.37 |
| PF00145 | DNA_methylase | 0.37 |
| PF13565 | HTH_32 | 0.37 |
| PF01406 | tRNA-synt_1e | 0.37 |
| PF14279 | HNH_5 | 0.37 |
| PF05988 | DUF899 | 0.37 |
| PF00004 | AAA | 0.37 |
| PF03764 | EFG_IV | 0.37 |
| PF13650 | Asp_protease_2 | 0.37 |
| PF10385 | RNA_pol_Rpb2_45 | 0.37 |
| PF12681 | Glyoxalase_2 | 0.37 |
| PF02518 | HATPase_c | 0.37 |
| PF13147 | Obsolete Pfam Family | 0.37 |
| PF07927 | HicA_toxin | 0.37 |
| PF02873 | MurB_C | 0.37 |
| PF06114 | Peptidase_M78 | 0.37 |
| PF00561 | Abhydrolase_1 | 0.37 |
| PF13470 | PIN_3 | 0.37 |
| PF01557 | FAA_hydrolase | 0.37 |
| PF04055 | Radical_SAM | 0.37 |
| PF03576 | Peptidase_S58 | 0.37 |
| PF00805 | Pentapeptide | 0.37 |
| PF00027 | cNMP_binding | 0.37 |
| PF07238 | PilZ | 0.37 |
| PF02073 | Peptidase_M29 | 0.37 |
| PF08388 | GIIM | 0.37 |
| PF02366 | PMT | 0.37 |
| PF02806 | Alpha-amylase_C | 0.37 |
| PF09972 | DUF2207 | 0.37 |
| PF01618 | MotA_ExbB | 0.37 |
| PF00413 | Peptidase_M10 | 0.37 |
| PF12840 | HTH_20 | 0.37 |
| PF00083 | Sugar_tr | 0.37 |
| PF12867 | DinB_2 | 0.37 |
| PF09285 | Elong-fact-P_C | 0.37 |
| PF04011 | LemA | 0.37 |
| PF01541 | GIY-YIG | 0.37 |
| PF13519 | VWA_2 | 0.37 |
| PF00365 | PFK | 0.37 |
| PF00903 | Glyoxalase | 0.37 |
| PF05768 | Glrx-like | 0.37 |
| PF01546 | Peptidase_M20 | 0.37 |
| PF12146 | Hydrolase_4 | 0.37 |
| PF01408 | GFO_IDH_MocA | 0.37 |
| PF02683 | DsbD | 0.37 |
| PF13649 | Methyltransf_25 | 0.37 |
| PF02687 | FtsX | 0.37 |
| PF12850 | Metallophos_2 | 0.37 |
| PF13480 | Acetyltransf_6 | 0.37 |
| PF13676 | TIR_2 | 0.37 |
| PF08240 | ADH_N | 0.37 |
| PF07690 | MFS_1 | 0.37 |
| PF10431 | ClpB_D2-small | 0.37 |
| PF14236 | DUF4338 | 0.37 |
| PF04185 | Phosphoesterase | 0.37 |
| PF12833 | HTH_18 | 0.37 |
| PF15902 | Sortilin-Vps10 | 0.37 |
| PF01144 | CoA_trans | 0.37 |
| PF00795 | CN_hydrolase | 0.37 |
| PF01042 | Ribonuc_L-PSP | 0.37 |
| PF08207 | EFP_N | 0.37 |
| PF04229 | GrpB | 0.37 |
| PF08818 | DUF1801 | 0.37 |
| PF04978 | DUF664 | 0.37 |
| PF13744 | HTH_37 | 0.37 |
| PF13414 | TPR_11 | 0.37 |
| PF02517 | Rce1-like | 0.37 |
| PF01066 | CDP-OH_P_transf | 0.37 |
| PF00882 | Zn_dep_PLPC | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 267 Family Scaffolds |
|---|---|---|---|
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 2.62 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.50 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.75 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 0.75 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.75 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.37 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0231 | Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.37 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.37 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.37 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.37 |
| COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.37 |
| COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.37 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.37 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.37 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.37 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.37 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.37 |
| COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 0.37 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.37 |
| COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.37 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.37 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.37 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.37 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.37 |
| COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.38 % |
| Unclassified | root | N/A | 5.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573003|GZIR7W402J143L | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300001159|JGI12650J13346_1006250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 570 | Open in IMG/M |
| 3300001356|JGI12269J14319_10076204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1815 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100097653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2748 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100437617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101294228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 620 | Open in IMG/M |
| 3300002886|JGI25612J43240_1055328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 595 | Open in IMG/M |
| 3300004080|Ga0062385_10537943 | Not Available | 728 | Open in IMG/M |
| 3300004082|Ga0062384_101262077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300004091|Ga0062387_100150828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1338 | Open in IMG/M |
| 3300004092|Ga0062389_102278913 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300004157|Ga0062590_102335046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300004479|Ga0062595_101086760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300004631|Ga0058899_11799775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 664 | Open in IMG/M |
| 3300004633|Ga0066395_10524945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 685 | Open in IMG/M |
| 3300005328|Ga0070676_11519567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 516 | Open in IMG/M |
| 3300005435|Ga0070714_102189482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300005436|Ga0070713_101459527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300005445|Ga0070708_100655154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. AP50 | 989 | Open in IMG/M |
| 3300005518|Ga0070699_101650709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 587 | Open in IMG/M |
| 3300005542|Ga0070732_10661088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300005576|Ga0066708_10031319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2841 | Open in IMG/M |
| 3300005602|Ga0070762_10020120 | All Organisms → cellular organisms → Bacteria | 3475 | Open in IMG/M |
| 3300005602|Ga0070762_10050609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2288 | Open in IMG/M |
| 3300005602|Ga0070762_10174736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1300 | Open in IMG/M |
| 3300005602|Ga0070762_10712770 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005610|Ga0070763_10658145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300005615|Ga0070702_101105507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300005712|Ga0070764_10075297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1768 | Open in IMG/M |
| 3300005712|Ga0070764_10218882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300005719|Ga0068861_100073312 | All Organisms → cellular organisms → Bacteria | 2659 | Open in IMG/M |
| 3300005719|Ga0068861_101595761 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005921|Ga0070766_10158885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1390 | Open in IMG/M |
| 3300005921|Ga0070766_10592168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300005921|Ga0070766_11276331 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005921|Ga0070766_11302442 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006028|Ga0070717_12087632 | Not Available | 510 | Open in IMG/M |
| 3300006046|Ga0066652_101605274 | Not Available | 598 | Open in IMG/M |
| 3300006051|Ga0075364_10446374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300006052|Ga0075029_100342772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300006052|Ga0075029_101092167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 554 | Open in IMG/M |
| 3300006059|Ga0075017_101143947 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006102|Ga0075015_100112709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1379 | Open in IMG/M |
| 3300006102|Ga0075015_100295553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300006102|Ga0075015_100684401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300006162|Ga0075030_100650031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 835 | Open in IMG/M |
| 3300006175|Ga0070712_101358755 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300006176|Ga0070765_100063890 | All Organisms → cellular organisms → Bacteria | 3060 | Open in IMG/M |
| 3300006176|Ga0070765_100822839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 878 | Open in IMG/M |
| 3300006176|Ga0070765_102144410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 522 | Open in IMG/M |
| 3300006797|Ga0066659_11170546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300006893|Ga0073928_11191826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 513 | Open in IMG/M |
| 3300006904|Ga0075424_102755057 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009089|Ga0099828_10751279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300009089|Ga0099828_11427011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300009174|Ga0105241_12301126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → unclassified Holophagaceae → Holophagaceae bacterium | 536 | Open in IMG/M |
| 3300009518|Ga0116128_1206648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300009525|Ga0116220_10538769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300009525|Ga0116220_10610021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300009628|Ga0116125_1153992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300009637|Ga0116118_1267286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300009644|Ga0116121_1259596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300009698|Ga0116216_10109557 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300009759|Ga0116101_1026961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| 3300009839|Ga0116223_10153672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1427 | Open in IMG/M |
| 3300010048|Ga0126373_10400007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1398 | Open in IMG/M |
| 3300010048|Ga0126373_12021945 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300010048|Ga0126373_12383432 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 589 | Open in IMG/M |
| 3300010159|Ga0099796_10405740 | Not Available | 598 | Open in IMG/M |
| 3300010339|Ga0074046_10478233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300010359|Ga0126376_12599704 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010362|Ga0126377_10312444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 1554 | Open in IMG/M |
| 3300010362|Ga0126377_13623214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300011120|Ga0150983_11415826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300011269|Ga0137392_10120010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2096 | Open in IMG/M |
| 3300011270|Ga0137391_10710766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 834 | Open in IMG/M |
| 3300012199|Ga0137383_10645603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300012206|Ga0137380_10221577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1710 | Open in IMG/M |
| 3300012212|Ga0150985_110404692 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1232 | Open in IMG/M |
| 3300012362|Ga0137361_11300058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 652 | Open in IMG/M |
| 3300012363|Ga0137390_10952562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300012683|Ga0137398_10624731 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012685|Ga0137397_10992300 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012917|Ga0137395_11205176 | Not Available | 529 | Open in IMG/M |
| 3300012923|Ga0137359_10326940 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300012923|Ga0137359_10349110 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300012924|Ga0137413_11788454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 507 | Open in IMG/M |
| 3300012925|Ga0137419_10413184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 1056 | Open in IMG/M |
| 3300012927|Ga0137416_10238390 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300012929|Ga0137404_10246463 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300012957|Ga0164303_10111755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1376 | Open in IMG/M |
| 3300012958|Ga0164299_11021920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300012961|Ga0164302_10609130 | Not Available | 793 | Open in IMG/M |
| 3300012985|Ga0164308_10488469 | Not Available | 1027 | Open in IMG/M |
| 3300013306|Ga0163162_11860758 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300013308|Ga0157375_10118409 | All Organisms → cellular organisms → Bacteria | 2755 | Open in IMG/M |
| 3300014164|Ga0181532_10785199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300014166|Ga0134079_10080012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300014167|Ga0181528_10165276 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300014489|Ga0182018_10009163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7298 | Open in IMG/M |
| 3300014654|Ga0181525_10115629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1478 | Open in IMG/M |
| 3300014658|Ga0181519_10098292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1895 | Open in IMG/M |
| 3300015054|Ga0137420_1055781 | Not Available | 1145 | Open in IMG/M |
| 3300015054|Ga0137420_1145296 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300015264|Ga0137403_10684612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300015372|Ga0132256_102412000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 628 | Open in IMG/M |
| 3300015374|Ga0132255_104777190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300017822|Ga0187802_10277897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300017930|Ga0187825_10386878 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300017932|Ga0187814_10091018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300017933|Ga0187801_10436470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300017947|Ga0187785_10021265 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 2296 | Open in IMG/M |
| 3300017955|Ga0187817_10149218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1486 | Open in IMG/M |
| 3300017972|Ga0187781_10394633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300017975|Ga0187782_10268631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1284 | Open in IMG/M |
| 3300017988|Ga0181520_11069514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300017995|Ga0187816_10270665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 743 | Open in IMG/M |
| 3300018001|Ga0187815_10158405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 958 | Open in IMG/M |
| 3300018005|Ga0187878_1090463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1269 | Open in IMG/M |
| 3300018006|Ga0187804_10007306 | All Organisms → cellular organisms → Bacteria | 3657 | Open in IMG/M |
| 3300018006|Ga0187804_10150687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300018007|Ga0187805_10501923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 569 | Open in IMG/M |
| 3300018012|Ga0187810_10426623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 560 | Open in IMG/M |
| 3300018012|Ga0187810_10446237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300018013|Ga0187873_1108270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1093 | Open in IMG/M |
| 3300018035|Ga0187875_10759661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300018038|Ga0187855_10118027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1594 | Open in IMG/M |
| 3300018038|Ga0187855_10277753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300018043|Ga0187887_10121180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1571 | Open in IMG/M |
| 3300018058|Ga0187766_10463902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300019881|Ga0193707_1143628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300020140|Ga0179590_1093612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300020579|Ga0210407_10830257 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300020579|Ga0210407_11088090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300020580|Ga0210403_10920295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300020581|Ga0210399_10043746 | All Organisms → cellular organisms → Bacteria | 3590 | Open in IMG/M |
| 3300020583|Ga0210401_10691623 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300020583|Ga0210401_11116423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300021168|Ga0210406_11045316 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300021170|Ga0210400_10093575 | Not Available | 2374 | Open in IMG/M |
| 3300021171|Ga0210405_10347114 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300021180|Ga0210396_10023300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 5732 | Open in IMG/M |
| 3300021180|Ga0210396_11580098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300021181|Ga0210388_11085448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300021181|Ga0210388_11422519 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300021401|Ga0210393_10727599 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300021401|Ga0210393_10801903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300021401|Ga0210393_11457142 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300021402|Ga0210385_10008756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6132 | Open in IMG/M |
| 3300021402|Ga0210385_10935032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300021403|Ga0210397_10632766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300021405|Ga0210387_10479533 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300021405|Ga0210387_10955581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300021405|Ga0210387_11001052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300021405|Ga0210387_11312151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 625 | Open in IMG/M |
| 3300021406|Ga0210386_10246849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1522 | Open in IMG/M |
| 3300021407|Ga0210383_10335827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1301 | Open in IMG/M |
| 3300021407|Ga0210383_10431625 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300021420|Ga0210394_11129397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300021432|Ga0210384_11099298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300021433|Ga0210391_10459606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300021433|Ga0210391_10982747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300021474|Ga0210390_10289664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300021474|Ga0210390_10805788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300021474|Ga0210390_11332977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300021475|Ga0210392_10562810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300021477|Ga0210398_10859222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 728 | Open in IMG/M |
| 3300021477|Ga0210398_11248800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300021478|Ga0210402_11405557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300021478|Ga0210402_12026701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300021559|Ga0210409_11207530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300021560|Ga0126371_11440426 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 819 | Open in IMG/M |
| 3300022515|Ga0224546_1001312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
| 3300022557|Ga0212123_10083646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2681 | Open in IMG/M |
| 3300022557|Ga0212123_10167193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1674 | Open in IMG/M |
| 3300022557|Ga0212123_10207835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1444 | Open in IMG/M |
| 3300022722|Ga0242657_1223605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300024288|Ga0179589_10467065 | Not Available | 583 | Open in IMG/M |
| 3300025315|Ga0207697_10077874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1394 | Open in IMG/M |
| 3300025412|Ga0208194_1001827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4298 | Open in IMG/M |
| 3300025414|Ga0208935_1036138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300025434|Ga0208690_1046555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300025612|Ga0208691_1076004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300025898|Ga0207692_10310761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
| 3300025906|Ga0207699_10663972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 762 | Open in IMG/M |
| 3300025915|Ga0207693_11183261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300025928|Ga0207700_11144902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300025961|Ga0207712_10505348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. AP50 | 1034 | Open in IMG/M |
| 3300025986|Ga0207658_11389909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300026551|Ga0209648_10117990 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
| 3300026551|Ga0209648_10789019 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026557|Ga0179587_10120139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1611 | Open in IMG/M |
| 3300026557|Ga0179587_10165221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1386 | Open in IMG/M |
| 3300027003|Ga0207722_1004866 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300027575|Ga0209525_1067661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300027629|Ga0209422_1005578 | All Organisms → cellular organisms → Bacteria | 3088 | Open in IMG/M |
| 3300027641|Ga0208827_1042800 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300027648|Ga0209420_1146161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300027676|Ga0209333_1186168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300027729|Ga0209248_10226196 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027768|Ga0209772_10270025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300027787|Ga0209074_10136782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300027812|Ga0209656_10338631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300027853|Ga0209274_10486132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300027855|Ga0209693_10056276 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300027862|Ga0209701_10029049 | All Organisms → cellular organisms → Bacteria | 3596 | Open in IMG/M |
| 3300027862|Ga0209701_10353026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300027867|Ga0209167_10063279 | Not Available | 1838 | Open in IMG/M |
| 3300027867|Ga0209167_10533401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300027867|Ga0209167_10569293 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300027869|Ga0209579_10181771 | Not Available | 1125 | Open in IMG/M |
| 3300027874|Ga0209465_10369893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300027884|Ga0209275_10579487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300027889|Ga0209380_10863026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300027895|Ga0209624_11119521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300027903|Ga0209488_10695151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6 | 729 | Open in IMG/M |
| 3300028773|Ga0302234_10466336 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300028781|Ga0302223_10234840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300028801|Ga0302226_10488352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 514 | Open in IMG/M |
| 3300028871|Ga0302230_10123346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1025 | Open in IMG/M |
| 3300028906|Ga0308309_10046901 | All Organisms → cellular organisms → Bacteria | 3087 | Open in IMG/M |
| 3300028906|Ga0308309_11207041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300029903|Ga0247271_129662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 564 | Open in IMG/M |
| 3300029939|Ga0311328_11082408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 518 | Open in IMG/M |
| 3300029945|Ga0311330_11031892 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300029951|Ga0311371_10089566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4951 | Open in IMG/M |
| 3300030051|Ga0302195_10083601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1644 | Open in IMG/M |
| 3300030503|Ga0311370_12209332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300030520|Ga0311372_12082541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300030706|Ga0310039_10325295 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300030940|Ga0265740_1047722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300031057|Ga0170834_108952043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300031057|Ga0170834_110561471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 705 | Open in IMG/M |
| 3300031090|Ga0265760_10257533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300031090|Ga0265760_10353737 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031231|Ga0170824_120681968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031236|Ga0302324_103062568 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031446|Ga0170820_15783365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300031708|Ga0310686_100645376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300031708|Ga0310686_110914814 | Not Available | 980 | Open in IMG/M |
| 3300031715|Ga0307476_10050927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2822 | Open in IMG/M |
| 3300031715|Ga0307476_11338152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300031718|Ga0307474_11141712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300031753|Ga0307477_10669895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300031794|Ga0318503_10310854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300031820|Ga0307473_11160946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 572 | Open in IMG/M |
| 3300031823|Ga0307478_10312281 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300031823|Ga0307478_10380592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300031823|Ga0307478_11244384 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300031823|Ga0307478_11388174 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031941|Ga0310912_11352207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300032160|Ga0311301_10181457 | All Organisms → cellular organisms → Bacteria | 3677 | Open in IMG/M |
| 3300032180|Ga0307471_102423707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300032205|Ga0307472_100479652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1066 | Open in IMG/M |
| 3300032783|Ga0335079_11248794 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 745 | Open in IMG/M |
| 3300032783|Ga0335079_11804427 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 595 | Open in IMG/M |
| 3300032805|Ga0335078_10106381 | All Organisms → cellular organisms → Bacteria | 4041 | Open in IMG/M |
| 3300032805|Ga0335078_10212875 | All Organisms → cellular organisms → Bacteria | 2671 | Open in IMG/M |
| 3300032805|Ga0335078_10576671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 1425 | Open in IMG/M |
| 3300032829|Ga0335070_10000272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 60200 | Open in IMG/M |
| 3300032892|Ga0335081_10260723 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
| 3300032892|Ga0335081_10850645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
| 3300032893|Ga0335069_10113776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3400 | Open in IMG/M |
| 3300032955|Ga0335076_10140028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2338 | Open in IMG/M |
| 3300033158|Ga0335077_10913605 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.37% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.62% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.25% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.12% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.37% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.37% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.37% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.37% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE2_03855550 | 2189573003 | Grass Soil | SDPSTLAQIEGINYFFDTLLFGGVVLALANAKQLPLRPNS |
| JGI12650J13346_10062502 | 3300001159 | Forest Soil | GPILIASLLDPSTAAKVEGINYFADTLLFAGAILALASAPPRPA* |
| JGI12269J14319_100762041 | 3300001356 | Peatlands Soil | SFLDPSTDVKVEGINYFFDTMLYAGTILALAQKTQGLS* |
| JGIcombinedJ26739_1000976531 | 3300002245 | Forest Soil | LGTWLVLVVLFVYGRILIAALADPSTGVKIEGINYFFDTMLFAGAILALASATPRTN* |
| JGIcombinedJ26739_1004376171 | 3300002245 | Forest Soil | TYLGGWLVLLVLFIYGPILIAALADPGTDVQVEGINYFFDTLLFAGTILVLASATPRTD* |
| JGIcombinedJ26739_1012942281 | 3300002245 | Forest Soil | ILFSALSNPSTEVKIEGINYFFDTLLFAGVILALASATPPSD* |
| JGI25612J43240_10553281 | 3300002886 | Grasslands Soil | QLSDPSIAVKIEGINYFADTLLFAGAILALASATPRMEPSASTLRIN* |
| Ga0062385_105379433 | 3300004080 | Bog Forest Soil | IAQVSDPSTAAQVEGINYFADTLLFAGAILALASATPSTD* |
| Ga0062384_1012620771 | 3300004082 | Bog Forest Soil | GPILIASARDPSVAVQVEGINYFTDTLLFAGVILGLASATPRSE* |
| Ga0062387_1001508281 | 3300004091 | Bog Forest Soil | PSTAVKVEGLNYFFDTLLFAGTILALASVRREPIKVPAANL* |
| Ga0062389_1022789132 | 3300004092 | Bog Forest Soil | ILVVQMSDPSTAVKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0062590_1023350462 | 3300004157 | Soil | PVMILALFDPNTGVQVEGINYFADTLLFAGVLLALAKAAPG* |
| Ga0062595_1010867601 | 3300004479 | Soil | APVMIAALGAPGLENKVEGINYFADTLLFAGVLLAAARAAPRSD* |
| Ga0058899_117997752 | 3300004631 | Forest Soil | TWIVLLVLFIYGPILIASLANPSTDIKIEGINYFFDTLLFAGAILALASATPRSD* |
| Ga0066395_105249451 | 3300004633 | Tropical Forest Soil | YGPLLIDSTRDPTPAGRVQGLNYFTDTLLYAGAILGLAGATPKSD* |
| Ga0070676_115195671 | 3300005328 | Miscanthus Rhizosphere | PILIESTRDPSTAVKVQGINYFTGTLLFAGAILGLAGATPQSD* |
| Ga0070714_1021894821 | 3300005435 | Agricultural Soil | PIMIVSLADPSTAVKVEGIDYFFDTLLFAGAILALASATPRTRIAD* |
| Ga0070713_1014595271 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VMIGALSDPNIGVQVEGINYFADTLLFTGAILALASAGPGEDAAARR* |
| Ga0070708_1006551543 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | YGPLLIVALTDPDTTAKVVGINYFSDTLMFAGVILALASATPGIFASTH* |
| Ga0070699_1016507092 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LIVQLLDPSTAVKVEGINYFADTLLFAGAILALASATPRTEQPTG* |
| Ga0070732_106610881 | 3300005542 | Surface Soil | PNTGVKVEGINYFADTLLFAGAILALASATPRAD* |
| Ga0066708_100313191 | 3300005576 | Soil | ILIAQMSDPSTAVKVEGINYIADTLLFAGAILALAGATPRID* |
| Ga0070762_100201201 | 3300005602 | Soil | LITQMSDPSTAVKVEGINYFADTLLFAGAILALASATPRTN* |
| Ga0070762_100506094 | 3300005602 | Soil | YLGTWLVLVVLFVYGPILIAALADPSTGVKVEGINYFFDTMLFAGAILAVASAAPRTD* |
| Ga0070762_101747361 | 3300005602 | Soil | WIVLLVVFIYGPILIAALADPSTGVKIEGINYFFDTMLFAGAILALASATPRTD* |
| Ga0070762_107127701 | 3300005602 | Soil | VVFIYGPILISALGNPSTDVKVEGINYFFDTLLFAGAILALASATPRTD* |
| Ga0070763_106581453 | 3300005610 | Soil | ILLAKKTRMAATYLGTWIVLLVLFIYGPILIAQIPDPSIAVKIEGINYFADALLFAGAILVLASASPRTD* |
| Ga0070702_1011055071 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AATYLGTWIVLLVVFIYGPILIASLANPSTAIKVEGIDYFFDTLLFAGAILVLVGATSPSSPSNSRL* |
| Ga0070764_100752971 | 3300005712 | Soil | ILISSLLNPSADVQLEGINYIFDTMLYAGAILAFARAMPRTD* |
| Ga0070764_102188822 | 3300005712 | Soil | PSTAVKVEGINYFADTLLYAGVILVLARAMPRPD* |
| Ga0068861_1000733127 | 3300005719 | Switchgrass Rhizosphere | IYGPLLIVALTDPDTTAKVVGINYFSDTLMFAGVILALASATPGIFASTH* |
| Ga0068861_1015957611 | 3300005719 | Switchgrass Rhizosphere | ILVVAIYGPILIESTRDPSTAVKVQGINYFTGTLLFAGAILGLAGATPQSD* |
| Ga0070766_101588851 | 3300005921 | Soil | YLGTWLVLVVLFVYGPILIAALADPSTGVKIEGINYFFDTMLFAGAILALASATPRTN* |
| Ga0070766_105921682 | 3300005921 | Soil | ISAPSTEVQIEGINYFFDTLLFAGTILALASATPRTD* |
| Ga0070766_112763313 | 3300005921 | Soil | PILIAALANPSTDVKVEGINYFFDTLLFAGAILALASATPRTD* |
| Ga0070766_113024421 | 3300005921 | Soil | PSTAVKIEGINYFFDTLLFAGTILALASATPRTD* |
| Ga0070717_120876321 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ILIVQMSDPSTAVKVEGINYFADTLLFAGAILALAMRTPRTD* |
| Ga0066652_1016052742 | 3300006046 | Soil | QMSDPSTAAKVEGINYFADTLLLAGAILALASGAPRTD* |
| Ga0075364_104463741 | 3300006051 | Populus Endosphere | LSDPNAGVQIEGVNYFADTLLFAGAVLALARASRPASSM* |
| Ga0075029_1003427723 | 3300006052 | Watersheds | WIVLLVLFIYGPILIAQMSDPSTEVKIDGINYFFDTLLFAGAILALASATPRAD* |
| Ga0075029_1010921671 | 3300006052 | Watersheds | QMFDPSTAVKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0075017_1011439471 | 3300006059 | Watersheds | PILIAALMDPSTGVKIEGINYFADTLLFAGAILALASAAPRSD* |
| Ga0075015_1001127093 | 3300006102 | Watersheds | MSDPSTAVKVEGINYFADTQLFAGAILALASATPRTD* |
| Ga0075015_1002955531 | 3300006102 | Watersheds | AQMSDPSTAVKVEGINYFADTLLFAGAILALASATRRTD* |
| Ga0075015_1006844013 | 3300006102 | Watersheds | VFIYGPILIASLADPSTGVKVEGINYFFDTLLFAGVILALASATPRAD* |
| Ga0075030_1006500312 | 3300006162 | Watersheds | LMDPSTDVKVEGLNYFGDTLLFAGTILALAQAIPQED* |
| Ga0070712_1013587552 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ADPSTGVKVEGLNYFADTLLFGGVILSLALIRRG* |
| Ga0070765_1000638901 | 3300006176 | Soil | DPSTGVKIEGINYFFDTMLFAGAILALASATPRTD* |
| Ga0070765_1008228392 | 3300006176 | Soil | YLGTWLVLVVLFVYGPILIAALADPSTGVKVEGINYFFDTMLFAGAILAVASATPRTD* |
| Ga0070765_1021444101 | 3300006176 | Soil | KTRMAATYLGTWIVLLVLFIYGPILIAQIPDPSIAVKIEGINYFADALLFAGAILVLASASPRTD* |
| Ga0066659_111705462 | 3300006797 | Soil | DPSTAVKVEGINYFADTLLFAGAILALASATPCED* |
| Ga0073928_111918261 | 3300006893 | Iron-Sulfur Acid Spring | ILIASLSDPSTAVKGEGINYFADTLLFAGAILALASATPRTD* |
| Ga0075424_1027550571 | 3300006904 | Populus Rhizosphere | VKLEGINYFADTLLFAGAILALASATPRSEARLS* |
| Ga0099828_107512792 | 3300009089 | Vadose Zone Soil | IAQISDPSTAAKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0099828_114270112 | 3300009089 | Vadose Zone Soil | LIAQMSDPSTAVKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0105241_123011262 | 3300009174 | Corn Rhizosphere | VKVEGINYFADTLLFAGVILAVASAAPRSDVRNISA* |
| Ga0116128_12066482 | 3300009518 | Peatland | TWIVLVVVLIYGPILIAALGNPSTDVKIEGINYFFDTLLFAGAILALASATPRTE* |
| Ga0116220_105387692 | 3300009525 | Peatlands Soil | ADPRTDVKVDGINYFADTLLFAGAILALASATPRTD* |
| Ga0116220_106100212 | 3300009525 | Peatlands Soil | LVLLVVFIYGPILIAGLGDPSTDVKIEGINYFFDTLLFAGATLALASATPRTD* |
| Ga0105237_122709532 | 3300009545 | Corn Rhizosphere | SALSTPGTGVQVEAINYFADTLLFAGVILSVATARP* |
| Ga0116125_11539922 | 3300009628 | Peatland | YGPILIAALGNPSTDVKIEGINYFFDTLLFAGAILALASATPRTE* |
| Ga0116118_12672862 | 3300009637 | Peatland | ILIASLLDPSTDVKVDGINYFFDTLLFAGAILALASATPRTE* |
| Ga0116121_12595962 | 3300009644 | Peatland | LFIYGPILIAALADPNTDVKVEGINYFFDTLLFAGAILALASATPRTD* |
| Ga0116216_101095571 | 3300009698 | Peatlands Soil | PSTDVKVEGINYFFDTLLFAGAILALASATPRTD* |
| Ga0116101_10269612 | 3300009759 | Peatland | YGPILIAALADPSTGVKIEGINYFFDTLLFAGVILALASAAPRTD* |
| Ga0116223_101536722 | 3300009839 | Peatlands Soil | DPSTGVKVEGINYFFDTLLFAGAILALASATPRTD* |
| Ga0126373_104000071 | 3300010048 | Tropical Forest Soil | NSPGIGVKVEGINYFFDTLLFAGVILAVASATPKSE* |
| Ga0126373_120219451 | 3300010048 | Tropical Forest Soil | VALSDPSTAVQVEGINYFADTLLFSGAILALASAVPRREAVA* |
| Ga0126373_123834321 | 3300010048 | Tropical Forest Soil | LSDPAIPVKIEGINYFADTLLFAGAILAVASAAPRSNAV* |
| Ga0099796_104057401 | 3300010159 | Vadose Zone Soil | GPSTAVKGEGINYFADTLLFAGAILALASATPRTD* |
| Ga0074046_104782331 | 3300010339 | Bog Forest Soil | SDPSTAVKVEGINYFFDTLLFAGAILALASATPRTD* |
| Ga0126376_125997042 | 3300010359 | Tropical Forest Soil | SEPGIGVQVEGINYFADTLLFGGTILALAGAAPRSD* |
| Ga0126377_103124441 | 3300010362 | Tropical Forest Soil | PVLIVALSEPGVAAKVEGINYFADTLLFAGAILALAKATPRSDVVTQK* |
| Ga0126377_136232141 | 3300010362 | Tropical Forest Soil | PGSAVKVEGINYFADTLLFAGAILALAKATPRPELKGSGAA* |
| Ga0150983_114158261 | 3300011120 | Forest Soil | ILIAQMSDPSTAAQVEGVNYFADTLLFAGAILALASATPPTD* |
| Ga0137392_101200103 | 3300011269 | Vadose Zone Soil | IAQMSDPSTAAKVEGINYFADTLLFAGLILALASATPRTD* |
| Ga0137391_107107661 | 3300011270 | Vadose Zone Soil | ISDPSTAVKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0137383_106456031 | 3300012199 | Vadose Zone Soil | QMFDPSTAAKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0137380_102215773 | 3300012206 | Vadose Zone Soil | AQMFDPSTAAKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0150985_1104046922 | 3300012212 | Avena Fatua Rhizosphere | MMIVALSQPGTAVKLEGINYVADTLLFAGGILALASAQDST* |
| Ga0137361_113000582 | 3300012362 | Vadose Zone Soil | SDPSTAVKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0137390_109525623 | 3300012363 | Vadose Zone Soil | SDPSTAAKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0137398_106247311 | 3300012683 | Vadose Zone Soil | TTAKVVGINYFADTMLFAGVILALASATPRSDAAG* |
| Ga0137397_109923002 | 3300012685 | Vadose Zone Soil | LIAQLSDPSIAVKIEGINYFADTLLFAGAILALASAMPRTDPSASTLRIN* |
| Ga0137395_112051762 | 3300012917 | Vadose Zone Soil | AQMSDPSTAAKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0137359_103269402 | 3300012923 | Vadose Zone Soil | LALSEPDTTAKVVGINYFADTMLFAGVILALASATPRSDAAG* |
| Ga0137359_103491103 | 3300012923 | Vadose Zone Soil | PILIAQMSDPSTAVKVEGINYFADTLLFAGAILALASATPRTD* |
| Ga0137413_117884542 | 3300012924 | Vadose Zone Soil | LLVLFIYGPILIAQISDPSIAVKIEGINYFSDTLLFAGAILALANATPRAD* |
| Ga0137419_104131841 | 3300012925 | Vadose Zone Soil | PSIAVKIEGINYFSDTLLFAGAILALASATPRTD* |
| Ga0137416_102383901 | 3300012927 | Vadose Zone Soil | QMSDPSTAVKVEGINYFADTLLFAGAILALASAAPRRD* |
| Ga0137404_102464631 | 3300012929 | Vadose Zone Soil | DPSTAVKVEGINYFADTLLFAGAILALASAAPRRD* |
| Ga0164303_101117553 | 3300012957 | Soil | FIYGPILIASLANPSTAVKVEGIDYFFDTLLFAGAVLALASASLRTD* |
| Ga0164299_110219202 | 3300012958 | Soil | DPALGVKIEGINYFADTLLFAGVILAAASAAPRSD* |
| Ga0164302_106091302 | 3300012961 | Soil | MIGAVSGPNIGAEVEAIDCFADTFFFAGVILAAASAAPRSDAAG* |
| Ga0164308_104884691 | 3300012985 | Soil | LEVQVEGINYFADTLFFAGVILAAASAAPRSDVAG* |
| Ga0163162_118607581 | 3300013306 | Switchgrass Rhizosphere | PGIGTKVEGINYFADTLLFGGAILSVAKAAPKSD* |
| Ga0157375_101184091 | 3300013308 | Miscanthus Rhizosphere | IYGPLLIVALTDPDTTAKVVGINYFSDTLMFAGVILALASATPRTFAGTP* |
| Ga0181532_107851992 | 3300014164 | Bog | ALGNPSTDVKVEGINYFFDTLLFAGAILALASATPRTE* |
| Ga0134079_100800121 | 3300014166 | Grasslands Soil | ATAVKVEGINYFADTLLFAGAILALASASPRSASKLAG* |
| Ga0181528_101652761 | 3300014167 | Bog | GPILIALMATPNTGVNVEGLNYFGDTLLFAGVILALARAAEREATD* |
| Ga0182018_100091638 | 3300014489 | Palsa | MPDPSTAAQVEGINYFADTLRFAGAILALASAKPRTD* |
| Ga0181525_101156291 | 3300014654 | Bog | ATYLGTWLVLLVLFIYGPILIAALADPNAGVKIEGINYFFDTMLFAGTVLALANAMPCTA |
| Ga0181519_100982921 | 3300014658 | Bog | STYLGTWIVLLVIFIYGPILIAALADPSPDAKMEGINYFFDTLLFAGAILALARATPSAD |
| Ga0137420_10557813 | 3300015054 | Vadose Zone Soil | DPSTAVKVEGINYFADTLLFAGAILALASATPRSE* |
| Ga0137420_11452963 | 3300015054 | Vadose Zone Soil | DPSIAVKIEGINYFSDTLLFAGAILALASATPRTD* |
| Ga0137403_106846122 | 3300015264 | Vadose Zone Soil | DPRIGVQVEGINYFADTLLFAGVVLALASATPRSDG* |
| Ga0132256_1024120001 | 3300015372 | Arabidopsis Rhizosphere | GPILIDSMRDPSAAVKVQGINYFTDTLLFAGAILAVASATTEA* |
| Ga0132255_1047771902 | 3300015374 | Arabidopsis Rhizosphere | NPDIGAKIEGINYFADTLLFAGVILAAGSAAPQSD* |
| Ga0187802_102778972 | 3300017822 | Freshwater Sediment | SLADPSTGVKVEGINYFFDTLLFAGAILALASATQRTD |
| Ga0187825_103868781 | 3300017930 | Freshwater Sediment | IAALSDPSTAVKVEGINYFADTLLFAGAILALANASPDPIPR |
| Ga0187814_100910183 | 3300017932 | Freshwater Sediment | AWIVLLVLFVYGPILIAALGDPSTSVKIEGINYFLDTLLFAGVILALASATPRTD |
| Ga0187801_104364701 | 3300017933 | Freshwater Sediment | YGPILIAALANPSTDVKIEGINYFLDTLLYAGAILALASATPRTD |
| Ga0187785_100212651 | 3300017947 | Tropical Peatland | ATKMEGVNYFADTLLFAGAILALARGTPPSDAEGRSH |
| Ga0187817_101492181 | 3300017955 | Freshwater Sediment | IVSLSDPSTAVKVEGINYFADTLLFAGPILALASATPRTD |
| Ga0187781_103946331 | 3300017972 | Tropical Peatland | TYLGSWIFLMVLAVYGPILISSLLTPSTDVRVEGINYFFDTLLYAGTVLALANASPRSD |
| Ga0187782_102686311 | 3300017975 | Tropical Peatland | TRMAATYLGTWIFLVVLAVYGPILVISLLDPSTTVKVDGINYFFDTLLYAGTILALARATPRSE |
| Ga0181520_110695142 | 3300017988 | Bog | IVLVVVFIYDPILIAALGNASTDVKIEGINYFFDTLLFAGAILALASATPRTE |
| Ga0187816_102706651 | 3300017995 | Freshwater Sediment | WIVLLVLLVYGPILIAALADPSTDVKIEGINYFFDTLLFAGAILALASATPRTD |
| Ga0187815_101584053 | 3300018001 | Freshwater Sediment | IVYGPILIAALANPSTDVKIEGINYFLDTLLYAGAILALASASPRTD |
| Ga0187878_10904631 | 3300018005 | Peatland | PILIAALADPSTGVKIEGINYFFDTLLFAGVILTLACATPRTD |
| Ga0187804_100073061 | 3300018006 | Freshwater Sediment | LIAQLSDPSTAAKVEGINYFADTLLFAGAILALASATPPTD |
| Ga0187804_101506871 | 3300018006 | Freshwater Sediment | NPSTDVKIEGINYFLDTLLYAGAILALASATPRTD |
| Ga0187805_105019231 | 3300018007 | Freshwater Sediment | VFIYGPILIAALANPSTDVKIEGINYFFDTVLFAGAILALASATPRNDYMPPPEDYC |
| Ga0187810_104266231 | 3300018012 | Freshwater Sediment | LLVLFIYGPILIASLADPNTGVKVEGINYFFDTLLFAGAILALASATPRTD |
| Ga0187810_104462371 | 3300018012 | Freshwater Sediment | LSDPSTGVKIEGINYFFDTLLFAGAILALARATPRTD |
| Ga0187873_11082703 | 3300018013 | Peatland | ALANPSTDVKIEGINYFFDTLLFAGAILALASATPRTE |
| Ga0187875_107596612 | 3300018035 | Peatland | LVVFIYGPILIAALADPSADKVEALNYFFDTQLFAGAVLALASASPRTD |
| Ga0187855_101180273 | 3300018038 | Peatland | AALGNPSTDVKIEGINYFFDTLLFAGAILALASATPRTE |
| Ga0187855_102777532 | 3300018038 | Peatland | LFIYGPILIVQMSDPSTAAQVEGINYFADTLLFAGAILALASAKARTD |
| Ga0187887_101211801 | 3300018043 | Peatland | IYGPILIAALADPSADKVEALNYFFDTQLFAGAALALASASPRTD |
| Ga0187766_104639022 | 3300018058 | Tropical Peatland | AGILVGKKRRTAATYLGSWITLLVFTVYLAILIASFLDPSTDVKVEGINYFFDTMLYAGAILALAKQPSDFANG |
| Ga0193707_11436282 | 3300019881 | Soil | VLIDALATPKMAVQMVGINYFADTLLFAGAILALASAMPRSER |
| Ga0179590_10936123 | 3300020140 | Vadose Zone Soil | ILIVQISDPSTGVKVEGINYFADTLLFAGAILALASATPSTD |
| Ga0210407_108302571 | 3300020579 | Soil | VPILIAQLSDPSTAAQVEGINYFADTLLFAGAILALAGATPRTD |
| Ga0210407_110880901 | 3300020579 | Soil | LISALANPSTEIKIEGINYFFDTLLFAGVILALASATPPTD |
| Ga0210403_109202951 | 3300020580 | Soil | SALSNPSTQLKIEGINYFFDTLLFAGVILALASATPPTD |
| Ga0210399_100437461 | 3300020581 | Soil | ILVAQMSDPSTEAQVEGINYFADTLLFAGAILALASATPRTD |
| Ga0210401_106916231 | 3300020583 | Soil | LIAALADPSTDVKIEGINYFFDTMLFAGAILALASATPRTD |
| Ga0210401_111164232 | 3300020583 | Soil | LLAKKTRTAATYLGTWIVLLVVFIYGPILIAALADPGADKVEALNYFFDTQLFAGAILALAKATPRTD |
| Ga0210406_110453161 | 3300021168 | Soil | IASLLDPSTDVKVDGLNYFFDTLLFAGAILALASATPRSD |
| Ga0210400_100935751 | 3300021170 | Soil | IYGPILIAALANLSTDIKVEGINYFFDTLLFAGTILALARATPRTE |
| Ga0210405_103471142 | 3300021171 | Soil | STGVKIEGINYFFDTMLFAGAILGLASATSRTDQNAA |
| Ga0210396_100233006 | 3300021180 | Soil | STGVKVEGINYFFDTMLFAGAILALASATPRTEVYGVS |
| Ga0210396_115800981 | 3300021180 | Soil | SALANPSTEIKIEGINYFFDTLLFAGVILALASATPPTD |
| Ga0210388_110854482 | 3300021181 | Soil | PILISALANPSTQVKIEGINYFFDTLLFAGVILALASATPPTD |
| Ga0210388_114225191 | 3300021181 | Soil | LLDPSTAVKVEGLNYFFDTLLFAGAILALASATPRTD |
| Ga0210393_107275992 | 3300021401 | Soil | DPSTDVKVEGLNYFADTLLFGGVILSLARTSTDIF |
| Ga0210393_108019032 | 3300021401 | Soil | ILIASLLTPGTDVKVEGLNYFFDTLLFTGTILALASASPGSDQNPV |
| Ga0210393_114571422 | 3300021401 | Soil | IAALGNPSTDVKVEGINYFFDTLLFAGAILALASATPRTD |
| Ga0210385_100087568 | 3300021402 | Soil | LLAKKTRAAATYLGTWIVLLVVFIYGPILIAALADPGADKVEALNYFFDTQLFAGAILALAKATPRTD |
| Ga0210385_109350321 | 3300021402 | Soil | ADPSTAVKVEGINYFADTLLFAGAILALASATPRTD |
| Ga0210397_106327662 | 3300021403 | Soil | IAALADPSIGVKIEGINYFFDTMLFAGAILALASATPRTN |
| Ga0210387_104795331 | 3300021405 | Soil | IAQISDPNVAAQIEGINYFADTLLFGGAILALASATPRTD |
| Ga0210387_109555812 | 3300021405 | Soil | QPGTGVEVEGINYFADTLLFAGAILALASASPRISSDM |
| Ga0210387_110010521 | 3300021405 | Soil | IVQLLDPSTAVKVEGINYFADTLLFGGAILALASATPPTD |
| Ga0210387_113121511 | 3300021405 | Soil | LSDPGTAVKVEGINYFADTLLFAGAILAVASATPRTD |
| Ga0210386_102468491 | 3300021406 | Soil | YGPILISALGNPSTDVKVEGINYFFDTLLFAGAILALASATPRTE |
| Ga0210383_103358271 | 3300021407 | Soil | PILIAALMDPSTGAKIEGINYFFDTLLFAGTILAVASATPQTE |
| Ga0210383_104316252 | 3300021407 | Soil | IYGPILISALANPSTQVKIEGINYFFDTLLFAGVILALASATPPTD |
| Ga0210394_111293971 | 3300021420 | Soil | TQMSDPSTAVKVEGINYFADTLLFAGAILALASATPRTD |
| Ga0210384_110992981 | 3300021432 | Soil | QLSDPSTAAKVEGINYFADTLLFAGAILALASATPRTD |
| Ga0210391_104596061 | 3300021433 | Soil | KTRMAATYLGTWIVALVVFIYGPILIGALGNPSTDVKVEGINYFLDTMLFAGVILALASATPRSD |
| Ga0210391_109827472 | 3300021433 | Soil | PILIVQMFDPSAAVKVEGINYFADTLLFAGAILALAKSTP |
| Ga0210390_102896641 | 3300021474 | Soil | VVFIYGPILISALGNPSTDVKVEGINYFFDTLLFAGAILALASATPRTE |
| Ga0210390_108057881 | 3300021474 | Soil | ANPSTEVKIEGINYFFDTLLFAGVILALASATPPTD |
| Ga0210390_113329771 | 3300021474 | Soil | ILISALSNPSTQLKIEGINYFFDTLLFAGVILALASATPPAD |
| Ga0210392_105628101 | 3300021475 | Soil | VPILIAQVSDPSTAVQVEGINYFADTLLFAGAILALASATPSTD |
| Ga0210398_108592222 | 3300021477 | Soil | ILIASLLDPSTAVKVEGLNYFFDTLLFAGAILALASATPRTD |
| Ga0210398_112488001 | 3300021477 | Soil | IAALADPSTDVKIEGINYFFDTMLFGGAILALASATPRTD |
| Ga0210402_114055572 | 3300021478 | Soil | VLIVQISDPSTAVKVEGINYFADTLLFAGAILALARATPRTA |
| Ga0210402_120267011 | 3300021478 | Soil | MLVPALADPSAAVKIEGINYFFDTLLFAGAILALASATPRTD |
| Ga0210409_112075301 | 3300021559 | Soil | NPSTEIKIEGINYFFDTLLFAGVILALASATPPTD |
| Ga0126371_114404262 | 3300021560 | Tropical Forest Soil | LLDPNIGTKIEGLNYFFDTLLYAGTILALADASPRTD |
| Ga0224546_10013123 | 3300022515 | Soil | MPDPSTAAQVEGINYFADTLRFAGAILALASAKPRTD |
| Ga0212123_100836461 | 3300022557 | Iron-Sulfur Acid Spring | ILIAALANPSTDIKVEGINYFFDTLLFAGAILALASATPRTD |
| Ga0212123_101671931 | 3300022557 | Iron-Sulfur Acid Spring | LVLFIYVPILIAQVPDPSTAAQVEGINYFADALLFAGAILALAGATPSTD |
| Ga0212123_102078353 | 3300022557 | Iron-Sulfur Acid Spring | DPSTDVKIEGINYFFDTLLFAGAILALASATPRSN |
| Ga0242657_12236051 | 3300022722 | Soil | ALADPSTDVKIEGINYFFDTMLFAGAILALASATPRTEV |
| Ga0179589_104670652 | 3300024288 | Vadose Zone Soil | MIMALSNPNIGVKIEGINYFADTLLFAGVILAAASTTPQSD |
| Ga0207697_100778741 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | AALDDAKVAVQVEGLNYFFDTLLFAGAILVLARAVPHKVSR |
| Ga0208194_10018275 | 3300025412 | Peatland | VLLVLFIYGPILIAALADPSTGVKIEGINYFFDTLLFAGVILALASAAPRTD |
| Ga0208935_10361381 | 3300025414 | Peatland | PILIASLMDPSAAVQIEGINYFFDTLLFGGTILVLASASPRAD |
| Ga0208690_10465551 | 3300025434 | Peatland | ATYLGTWIVLVVVLIYGPILIAALGNPSTDVKIEGINYFFDTLLFAGAILALASATPRTE |
| Ga0208691_10760042 | 3300025612 | Peatland | GSWIVLLVVFIYGPILIAALADPNTDVKVEGINYFFDTLLFAGAILALARATPRTD |
| Ga0207692_103107613 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LGNPSAGVKIEGLNYFADTLLFGGVILSLASSDKSK |
| Ga0207699_106639721 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | IAQMSDPSTAVKVEGINYFADTLLFAGTILALASATPRTD |
| Ga0207693_111832611 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VMIGALSDPSIGAKVEGINYFADTLFFAGVILAAASAAPRSDAAG |
| Ga0207700_111449021 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SALSNPSTEAKVEGINYFFDTLLFAGVILALASATPPTD |
| Ga0207712_105053481 | 3300025961 | Switchgrass Rhizosphere | SSLLIVALTDPDTTAKVVGINYFSDTLMFAGVILALASATPGIFASTH |
| Ga0207658_113899092 | 3300025986 | Switchgrass Rhizosphere | VKVEGLNYFTDTLLFAGAILGLAGATPRPESPLLR |
| Ga0209648_101179904 | 3300026551 | Grasslands Soil | PILIAQMSDPSTAAKVEGINYFADTLLFAGAILALASATPRTN |
| Ga0209648_107890191 | 3300026551 | Grasslands Soil | VFIYGPILIASLADPSTDVKIEGINYLFDTLLFAGAIVALASATPPTD |
| Ga0179587_101201393 | 3300026557 | Vadose Zone Soil | PDTTAKVVGINYFADTMLFAGVILALASATPRSDAAG |
| Ga0179587_101652213 | 3300026557 | Vadose Zone Soil | SGPSTGVKVEGINYFADTLLFAGAILALASATPSTD |
| Ga0207722_10048662 | 3300027003 | Tropical Forest Soil | PVLLVALSQPGTAVKVEGINYFADTLLFAGVILALASATPRPD |
| Ga0209525_10676612 | 3300027575 | Forest Soil | LFIYGPILVAALGDPSTGVKVEGINYFSDTLLFAGAILALASATPRPD |
| Ga0209422_10055784 | 3300027629 | Forest Soil | PILIAQISDPSTAVKVEGINYFADTLLFAGAILALASVTPRTD |
| Ga0208827_10428003 | 3300027641 | Peatlands Soil | FIYGPILIASLGDPSTGVKIEGINYFFDTLLFAGAILALASATPRTD |
| Ga0209420_11461611 | 3300027648 | Forest Soil | LITSLADPSTDVKVEGLNYFFDTLLFAGTILALANATPRSE |
| Ga0209333_11861681 | 3300027676 | Forest Soil | YLGTWMVLVVVFIYGPILIAALSDPSTDVKVEGINYFFDTLLFAGAILALASATPSAD |
| Ga0209248_102261962 | 3300027729 | Bog Forest Soil | ILIAQVSDPSTAAQVEGINYFADTLLFAGAILALASATPPTD |
| Ga0209772_102700252 | 3300027768 | Bog Forest Soil | GPILIASARDPSVAVQVEGINYFTDTLLFAGVILGLASATPRSE |
| Ga0209074_101367822 | 3300027787 | Agricultural Soil | LSEPAVPLQVEGINYFADTLLFAATILALASASPRSASKPTG |
| Ga0209656_103386312 | 3300027812 | Bog Forest Soil | FQDPSTDVKVEAVNYFTDTMLFAGVILALARATPRTD |
| Ga0209274_104861322 | 3300027853 | Soil | IYGPILIAALSDPSTDVKVEGINYFFDTLLFAGAILALASATPSAD |
| Ga0209693_100562761 | 3300027855 | Soil | LVVFIYGPILIAALADPSTGVKIEGINYFFDTMLFAGAILALASATPRTD |
| Ga0209701_100290491 | 3300027862 | Vadose Zone Soil | MFDPSTAAKVEGINYFADTLLFAGAILALASATPRTD |
| Ga0209701_103530262 | 3300027862 | Vadose Zone Soil | MADPSTAIKVEGINYFADTLLFAGAILALASATPRTD |
| Ga0209167_100632791 | 3300027867 | Surface Soil | GPILIASLANPSNDVKIEGINYFFDTLLFAGVILALASATPKTD |
| Ga0209167_105334011 | 3300027867 | Surface Soil | YGPILIIQLGNPDTGVKVEGINYFADTLLFAGAILGLAKATSRTD |
| Ga0209167_105692931 | 3300027867 | Surface Soil | DPSTDIKVEGLNYFFDTLLFAGTVLALASATPRSD |
| Ga0209579_101817711 | 3300027869 | Surface Soil | ILISALANPSTEIEIEGINYFSDTLLFAGVILALASATPPTD |
| Ga0209465_103698931 | 3300027874 | Tropical Forest Soil | VIYGPLLIDSTRDPTPAGRVQGLNYFTDTLLYAGAILGLAGATPKSD |
| Ga0209275_105794871 | 3300027884 | Soil | YGPILIAQISAPSTEVQIEGINYFFDTLLFAGTILALASATPRKD |
| Ga0209380_108630261 | 3300027889 | Soil | ISAPSTEVQIEGINYFFDTLLFAGTILALASATPRTD |
| Ga0209624_111195211 | 3300027895 | Forest Soil | MDPSTGVKIEGINYFADTLLFAGAILVLASAMPTTD |
| Ga0209488_106951511 | 3300027903 | Vadose Zone Soil | PILIAQMSDPSTAAKVEGINYFADTLLFAGAILALASAAPRTD |
| Ga0302234_104663361 | 3300028773 | Palsa | LLIYGPMMIAALRDPSVGAEIEGINYFADTLLFAGAVLALADAETDADERLA |
| Ga0302223_102348402 | 3300028781 | Palsa | YGPILATSLLDPSTDVQVEGLNYFFDTLLFAGTILAVANAAPRTDS |
| Ga0302226_104883522 | 3300028801 | Palsa | ILFSALSDPGMGVKIEGINYFADTLLFAGAILALAKATPSS |
| Ga0302230_101233463 | 3300028871 | Palsa | SFPDPSTDVKVEAVNYFTDTMLYAGAILALASATPRTD |
| Ga0308309_100469013 | 3300028906 | Soil | LADPSTNVKIEGINYFFDTLLFAGAILALASATPRTD |
| Ga0308309_112070412 | 3300028906 | Soil | LIASLLDPSTNVKIEGINYFFDTMLFAGATLALASATPRTD |
| Ga0247271_1296621 | 3300029903 | Soil | VLLVLFIYGPILIAALADPNTDVKVEGINYFFDTLLFAGAILALARATPRTD |
| Ga0311328_110824082 | 3300029939 | Bog | LRDPSIAAEIEGINYFADTLLFGGAILALAGATERRVAGNS |
| Ga0311330_110318923 | 3300029945 | Bog | AVEIEGINYFADTLLFGGAILALAGATERRVAGNS |
| Ga0311371_100895661 | 3300029951 | Palsa | ILVASLLDPSTDVKVEGLNYFFDTLLYAGTILALANAAPDSG |
| Ga0302195_100836011 | 3300030051 | Bog | AAALRDPSIAAEIEGINYFADTLLFGGTILALAGASRRAD |
| Ga0311370_122093322 | 3300030503 | Palsa | PILIASLLDPSTDVKVDGLNYFFDTLLYAGAILAVAIATPRTD |
| Ga0311372_120825412 | 3300030520 | Palsa | VVFIYGPMLIQSLLNPSPGIQIEGINYFFDTLLFAGAILALASATPSSAAQP |
| Ga0310039_103252951 | 3300030706 | Peatlands Soil | WIVLLVVFIYGPILIASLADPSTGVKVEGINYFFDTLLFAGAILALASATPRTD |
| Ga0265740_10477221 | 3300030940 | Soil | IYGPILIAALADPSTDVKVEGINYFFDTMLFAGAILALASATPRTD |
| Ga0170834_1089520431 | 3300031057 | Forest Soil | ILIVQISDPSTAVKVEGLNYFADTLLFAGAILALASATPGTD |
| Ga0170834_1105614711 | 3300031057 | Forest Soil | IVLLVLFVYGPILIASLADPSTGVKVEGINYFFDTMLFAGAILALASATPRTD |
| Ga0265760_102575331 | 3300031090 | Soil | FDSSTAVKVEGINYFFDTLLFAGAILALANATPRAGTSPPK |
| Ga0265760_103537372 | 3300031090 | Soil | ADPSTNVKIEGINYFFDTLLFAGAILALASATPRTD |
| Ga0170824_1206819682 | 3300031231 | Forest Soil | GPILIAQLSDPSIAAKIEGINYFADTLLFAGAILALASATPRKG |
| Ga0302324_1030625681 | 3300031236 | Palsa | LITSLMDASTGVKIEGINYFADTLLFAGAILAVASAMPRTDLN |
| Ga0170820_157833651 | 3300031446 | Forest Soil | PILIAQLSDPSIAAKIEGINYFADTLLFAGAILALASATPRKG |
| Ga0310686_1006453763 | 3300031708 | Soil | LGTWIVLVVVFIYGPILIAALGNPSTDVKIEGINYFFDTLLFAGAILALASATPRTE |
| Ga0310686_1109148142 | 3300031708 | Soil | GPILIAALSAPGTDVKVEGLNYFFDTLLFAGTILALASATPHTD |
| Ga0307476_100509275 | 3300031715 | Hardwood Forest Soil | MPISDPSTNVKVEAVNYFTDTMLFAGTILALASARPRTDS |
| Ga0307476_113381521 | 3300031715 | Hardwood Forest Soil | LVGRKTRLAATYLGTWLVLEVLFIYGPILIAALGDPSTGVKVEGINYFFDTMLFAGAILAVASATPRTD |
| Ga0307474_111417122 | 3300031718 | Hardwood Forest Soil | TYLGTWIVLLVVFIYGPILIASLLDPTTAIKIEGINYFFDTLLFAGTILALASATPLTD |
| Ga0307477_106698952 | 3300031753 | Hardwood Forest Soil | GPILIAALADPSTGVKVEGINYFFDTMLFAGAILALASATPRTNLTADS |
| Ga0318503_103108542 | 3300031794 | Soil | ALGDPSAGVQVEGVNYFADTLLFGGAILSLAGANPK |
| Ga0307473_111609461 | 3300031820 | Hardwood Forest Soil | ASYLGTWIVLLVVFIYGPILIAALPNPSTDVKIEGINYFFDTLLFAGVILALASATPPTD |
| Ga0307478_103122811 | 3300031823 | Hardwood Forest Soil | LLDPSTAIKIEGINYFFDTLLFAGTILALASATPGTD |
| Ga0307478_103805922 | 3300031823 | Hardwood Forest Soil | YLGTWIVLLVLFIYGPILIAALADPSTNVKIEGINYFFDTLLFAGAILALASATPRAD |
| Ga0307478_112443842 | 3300031823 | Hardwood Forest Soil | ADPGADKVEALNYFFDTQLFAGAVLALAKATPRTD |
| Ga0307478_113881742 | 3300031823 | Hardwood Forest Soil | APGTDVKVEGINYFFDTLLFAGAILALASATPRSD |
| Ga0310912_113522072 | 3300031941 | Soil | DPSPAVQIEGINYFADTLLFAGAILALASATPRPD |
| Ga0311301_101814573 | 3300032160 | Peatlands Soil | PTYLGTWIVLVVVFVYGPILIAALANPSTDVQVEGINYFFDTMLFAGAILALASASPRTD |
| Ga0307471_1024237071 | 3300032180 | Hardwood Forest Soil | LILALSDPGTAGKVEGINYFADTLLFAGAILALAKATPRS |
| Ga0307472_1004796522 | 3300032205 | Hardwood Forest Soil | LIAQLADPSTEVKVEGINYFADTLLFAGAILALASATPRTD |
| Ga0335079_112487941 | 3300032783 | Soil | PVLIMALADPSTSVKVEGINYFFDTLLFAGTVLALASAIPRVE |
| Ga0335079_118044271 | 3300032783 | Soil | YGPILIAALLDPSTDAKIEGINYFFDTLLFAGTILAVASATPRPD |
| Ga0335078_101063811 | 3300032805 | Soil | LADPRTGVQVEGINYFADTLLFGGAILSLAAARCD |
| Ga0335078_102128754 | 3300032805 | Soil | GPILIAALLDPSTDAKIEGINYFFDTLLFAGTILAVASATPRTD |
| Ga0335078_105766711 | 3300032805 | Soil | DPSTDAKIEGINYFFDTLLFAGTILAVASATPRTD |
| Ga0335070_100002721 | 3300032829 | Soil | NPSTAVKVEGLNYFFDTLLFAGEILALASATPQPA |
| Ga0335081_102607234 | 3300032892 | Soil | LMDPSTDAKIEGINYFFDTLLFAGTILAVASATPRTD |
| Ga0335081_108506452 | 3300032892 | Soil | ILLVAGAFMLLNKKTRLAATYLGGWIVLLVVVVYGPILIAALMDPSTDAKIEGINYFFDTLLFAGTIPAIASATPRTD |
| Ga0335069_101137761 | 3300032893 | Soil | IMSLLNPSTAVKVEGLNYFFDTLLFAGEILALASATPQPA |
| Ga0335076_101400284 | 3300032955 | Soil | IASLADPSTAVKVEGLNYFFDTLLFGGAILALASATPRAD |
| Ga0335077_109136051 | 3300033158 | Soil | DPSVAVKIEGINYFADTLLFAGVILALASAMPRTD |
| Ga0310811_113897982 | 3300033475 | Soil | VLVGALQNPGIGVQLEGVNYFADTLLFTGAILIVARTARR |
| ⦗Top⦘ |