


| Basic Information | |
|---|---|
| Family ID | F013902 |
| Family Type | Metagenome |
| Number of Sequences | 267 |
| Average Sequence Length | 41 residues |
| Representative Sequence | TFSNLPDGSTITVGSNTFQANYEGGDGNDLTLTVVP |
| Number of Associated Samples | 180 |
| Number of Associated Scaffolds | 267 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.83 % |
| % of genes near scaffold ends (potentially truncated) | 92.13 % |
| % of genes from short scaffolds (< 2000 bps) | 91.76 % |
| Associated GOLD sequencing projects | 160 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.757 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.858 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.685 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (67.041 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.69% Coil/Unstructured: 70.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 267 Family Scaffolds |
|---|---|---|
| PF12951 | PATR | 4.49 |
| PF09900 | DUF2127 | 2.25 |
| PF13884 | Peptidase_S74 | 2.25 |
| PF13418 | Kelch_4 | 1.87 |
| PF13545 | HTH_Crp_2 | 1.12 |
| PF00106 | adh_short | 0.75 |
| PF01112 | Asparaginase_2 | 0.75 |
| PF12680 | SnoaL_2 | 0.75 |
| PF08818 | DUF1801 | 0.75 |
| PF13415 | Kelch_3 | 0.75 |
| PF13517 | FG-GAP_3 | 0.75 |
| PF13964 | Kelch_6 | 0.75 |
| PF03808 | Glyco_tran_WecG | 0.75 |
| PF12697 | Abhydrolase_6 | 0.75 |
| PF00501 | AMP-binding | 0.37 |
| PF00196 | GerE | 0.37 |
| PF01436 | NHL | 0.37 |
| PF13561 | adh_short_C2 | 0.37 |
| PF02852 | Pyr_redox_dim | 0.37 |
| PF01869 | BcrAD_BadFG | 0.37 |
| PF03710 | GlnE | 0.37 |
| PF00127 | Copper-bind | 0.37 |
| PF16250 | DUF4907 | 0.37 |
| PF02754 | CCG | 0.37 |
| PF12127 | FloA | 0.37 |
| PF09721 | Exosortase_EpsH | 0.37 |
| PF03104 | DNA_pol_B_exo1 | 0.37 |
| PF07992 | Pyr_redox_2 | 0.37 |
| PF02646 | RmuC | 0.37 |
| PF13302 | Acetyltransf_3 | 0.37 |
| PF15780 | ASH | 0.37 |
| PF02954 | HTH_8 | 0.37 |
| PF00211 | Guanylate_cyc | 0.37 |
| PF08308 | PEGA | 0.37 |
| PF12146 | Hydrolase_4 | 0.37 |
| PF01471 | PG_binding_1 | 0.37 |
| PF08031 | BBE | 0.37 |
| PF03446 | NAD_binding_2 | 0.37 |
| PF03372 | Exo_endo_phos | 0.37 |
| PF10825 | DUF2752 | 0.37 |
| PF07332 | Phage_holin_3_6 | 0.37 |
| PF13810 | DUF4185 | 0.37 |
| PF02223 | Thymidylate_kin | 0.37 |
| PF00076 | RRM_1 | 0.37 |
| PF00285 | Citrate_synt | 0.37 |
| PF01012 | ETF | 0.37 |
| PF04679 | DNA_ligase_A_C | 0.37 |
| PF01255 | Prenyltransf | 0.37 |
| PF01176 | eIF-1a | 0.37 |
| PF00413 | Peptidase_M10 | 0.37 |
| PF01344 | Kelch_1 | 0.37 |
| PF02687 | FtsX | 0.37 |
| PF00487 | FA_desaturase | 0.37 |
| PF14026 | DUF4242 | 0.37 |
| PF03647 | Tmemb_14 | 0.37 |
| PF00085 | Thioredoxin | 0.37 |
| PF00466 | Ribosomal_L10 | 0.37 |
| PF01791 | DeoC | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 267 Family Scaffolds |
|---|---|---|---|
| COG1391 | Glutamine synthetase adenylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
| COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 0.75 |
| COG1922 | UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.75 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.75 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.37 |
| COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.37 |
| COG0244 | Ribosomal protein L10 | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.37 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.37 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.37 |
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.37 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.37 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.37 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.37 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.37 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.37 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.37 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.37 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.37 |
| COG5548 | Uncharacterized membrane protein, UPF0136 family | Function unknown [S] | 0.37 |
| COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.76 % |
| Unclassified | root | N/A | 5.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|F0B48LX02FYKB6 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 2170459019|G14TP7Y01CNN4S | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 2189573001|GZR05M101A4O2F | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2269825 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101686538 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300000953|JGI11615J12901_11853821 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300000956|JGI10216J12902_115498124 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300002077|JGI24744J21845_10102403 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300004157|Ga0062590_102482233 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 549 | Open in IMG/M |
| 3300004463|Ga0063356_100637674 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300004479|Ga0062595_100468904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
| 3300004479|Ga0062595_102650700 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300004643|Ga0062591_102333218 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005093|Ga0062594_100198380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1395 | Open in IMG/M |
| 3300005178|Ga0066688_10118362 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1635 | Open in IMG/M |
| 3300005179|Ga0066684_10724936 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 664 | Open in IMG/M |
| 3300005180|Ga0066685_10188632 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300005186|Ga0066676_10768001 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005187|Ga0066675_11271825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300005290|Ga0065712_10317505 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005293|Ga0065715_11058090 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005329|Ga0070683_101974706 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005330|Ga0070690_100146691 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300005331|Ga0070670_101995376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300005332|Ga0066388_106220622 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. SWK7 | 602 | Open in IMG/M |
| 3300005332|Ga0066388_107908676 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 532 | Open in IMG/M |
| 3300005343|Ga0070687_101456627 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005344|Ga0070661_100840341 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005345|Ga0070692_10770323 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005347|Ga0070668_101168142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300005347|Ga0070668_101733522 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005354|Ga0070675_100036023 | All Organisms → cellular organisms → Bacteria | 4025 | Open in IMG/M |
| 3300005354|Ga0070675_101398161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300005355|Ga0070671_101146189 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 683 | Open in IMG/M |
| 3300005355|Ga0070671_101296187 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005355|Ga0070671_101818371 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005356|Ga0070674_101700938 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 570 | Open in IMG/M |
| 3300005365|Ga0070688_100128265 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300005367|Ga0070667_100104718 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300005367|Ga0070667_100106936 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
| 3300005367|Ga0070667_100310023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1422 | Open in IMG/M |
| 3300005367|Ga0070667_100337654 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300005436|Ga0070713_101647603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300005450|Ga0066682_10777724 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 580 | Open in IMG/M |
| 3300005451|Ga0066681_10815011 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005456|Ga0070678_100101448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2231 | Open in IMG/M |
| 3300005459|Ga0068867_100178797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1685 | Open in IMG/M |
| 3300005459|Ga0068867_101737646 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005467|Ga0070706_101403602 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005518|Ga0070699_100406343 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300005536|Ga0070697_101354608 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005543|Ga0070672_100333102 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300005543|Ga0070672_100611739 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005543|Ga0070672_101184898 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005544|Ga0070686_100941163 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula sallentina | 705 | Open in IMG/M |
| 3300005545|Ga0070695_100767415 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005545|Ga0070695_101213358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300005548|Ga0070665_100068991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis | 3543 | Open in IMG/M |
| 3300005548|Ga0070665_101555490 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 669 | Open in IMG/M |
| 3300005552|Ga0066701_10894253 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005560|Ga0066670_10872055 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005566|Ga0066693_10138589 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005718|Ga0068866_11029784 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005764|Ga0066903_103419517 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005764|Ga0066903_106366078 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005841|Ga0068863_101597961 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005841|Ga0068863_102380435 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 539 | Open in IMG/M |
| 3300005843|Ga0068860_100244415 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
| 3300005843|Ga0068860_100359090 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300005843|Ga0068860_100853338 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005843|Ga0068860_101225352 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005993|Ga0080027_10146598 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300005993|Ga0080027_10420295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300006237|Ga0097621_100097203 | All Organisms → cellular organisms → Bacteria | 2472 | Open in IMG/M |
| 3300006237|Ga0097621_102211779 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006755|Ga0079222_12602492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 509 | Open in IMG/M |
| 3300006794|Ga0066658_10865589 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 516 | Open in IMG/M |
| 3300006796|Ga0066665_10134516 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300006797|Ga0066659_11054298 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300006797|Ga0066659_11734106 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006804|Ga0079221_10870467 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006806|Ga0079220_10265722 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300006806|Ga0079220_11360788 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006846|Ga0075430_101812838 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006854|Ga0075425_101056225 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300006854|Ga0075425_102186642 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006871|Ga0075434_100344789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1511 | Open in IMG/M |
| 3300006871|Ga0075434_102308522 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006881|Ga0068865_100008111 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 6481 | Open in IMG/M |
| 3300006954|Ga0079219_10536141 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300006954|Ga0079219_11396395 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300007255|Ga0099791_10244614 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300009038|Ga0099829_10498910 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300009038|Ga0099829_10530518 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300009088|Ga0099830_10323603 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300009089|Ga0099828_10351373 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300009089|Ga0099828_10903837 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300009090|Ga0099827_11970465 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 508 | Open in IMG/M |
| 3300009137|Ga0066709_100284342 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
| 3300009137|Ga0066709_101338695 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300009137|Ga0066709_103757436 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 551 | Open in IMG/M |
| 3300009137|Ga0066709_103804920 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300009174|Ga0105241_12580828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300009177|Ga0105248_11965284 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300009551|Ga0105238_11639691 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010038|Ga0126315_11027981 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010043|Ga0126380_10694486 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 817 | Open in IMG/M |
| 3300010046|Ga0126384_10317188 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1287 | Open in IMG/M |
| 3300010047|Ga0126382_11039564 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010159|Ga0099796_10248666 | Not Available | 738 | Open in IMG/M |
| 3300010303|Ga0134082_10288362 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300010320|Ga0134109_10412538 | Not Available | 542 | Open in IMG/M |
| 3300010326|Ga0134065_10268341 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 643 | Open in IMG/M |
| 3300010366|Ga0126379_12137998 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300010371|Ga0134125_12495239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300010373|Ga0134128_10947930 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 952 | Open in IMG/M |
| 3300010373|Ga0134128_12759042 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 541 | Open in IMG/M |
| 3300010375|Ga0105239_12745622 | Not Available | 575 | Open in IMG/M |
| 3300010401|Ga0134121_12727046 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012189|Ga0137388_10667358 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300012198|Ga0137364_10449716 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300012199|Ga0137383_10781150 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012201|Ga0137365_10032233 | All Organisms → cellular organisms → Bacteria | 4021 | Open in IMG/M |
| 3300012202|Ga0137363_11288550 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 619 | Open in IMG/M |
| 3300012206|Ga0137380_10816595 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 804 | Open in IMG/M |
| 3300012211|Ga0137377_10582667 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300012285|Ga0137370_10735298 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 613 | Open in IMG/M |
| 3300012285|Ga0137370_10982541 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300012350|Ga0137372_10567073 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 836 | Open in IMG/M |
| 3300012354|Ga0137366_10378944 | Not Available | 1032 | Open in IMG/M |
| 3300012356|Ga0137371_10401560 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1063 | Open in IMG/M |
| 3300012357|Ga0137384_11465139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter robiniae | 531 | Open in IMG/M |
| 3300012363|Ga0137390_10892304 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 844 | Open in IMG/M |
| 3300012683|Ga0137398_10057741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2324 | Open in IMG/M |
| 3300012683|Ga0137398_10158369 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1473 | Open in IMG/M |
| 3300012683|Ga0137398_10264579 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1149 | Open in IMG/M |
| 3300012683|Ga0137398_10339434 | Not Available | 1015 | Open in IMG/M |
| 3300012893|Ga0157284_10277871 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012917|Ga0137395_11054019 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 579 | Open in IMG/M |
| 3300012925|Ga0137419_11012078 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012927|Ga0137416_11805655 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 559 | Open in IMG/M |
| 3300012929|Ga0137404_10238162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1557 | Open in IMG/M |
| 3300012930|Ga0137407_11270320 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 699 | Open in IMG/M |
| 3300012930|Ga0137407_12217431 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012958|Ga0164299_10788861 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300012960|Ga0164301_11282549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 593 | Open in IMG/M |
| 3300012984|Ga0164309_10401209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300012985|Ga0164308_10317204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. OV335 | 1245 | Open in IMG/M |
| 3300012985|Ga0164308_10558530 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300013296|Ga0157374_10044650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4096 | Open in IMG/M |
| 3300013296|Ga0157374_10088926 | All Organisms → cellular organisms → Bacteria | 2942 | Open in IMG/M |
| 3300013296|Ga0157374_10223220 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
| 3300013296|Ga0157374_10367179 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1432 | Open in IMG/M |
| 3300013296|Ga0157374_10706892 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1021 | Open in IMG/M |
| 3300013296|Ga0157374_10769964 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300013296|Ga0157374_11637612 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata obscuriglobus | 668 | Open in IMG/M |
| 3300013297|Ga0157378_10116662 | All Organisms → cellular organisms → Bacteria | 2455 | Open in IMG/M |
| 3300013297|Ga0157378_10178005 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300013297|Ga0157378_10283679 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300013297|Ga0157378_10299869 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1555 | Open in IMG/M |
| 3300013306|Ga0163162_10771824 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300013306|Ga0163162_12067536 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 653 | Open in IMG/M |
| 3300013308|Ga0157375_10452976 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1449 | Open in IMG/M |
| 3300013308|Ga0157375_10759194 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1121 | Open in IMG/M |
| 3300013308|Ga0157375_11598373 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 771 | Open in IMG/M |
| 3300013308|Ga0157375_12936373 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300014166|Ga0134079_10626261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
| 3300014325|Ga0163163_10542816 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300014325|Ga0163163_12299688 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300014325|Ga0163163_12340622 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300014326|Ga0157380_10940422 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300014969|Ga0157376_10261282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1622 | Open in IMG/M |
| 3300014969|Ga0157376_10321176 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300014969|Ga0157376_10639394 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300014969|Ga0157376_12097812 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300014969|Ga0157376_12296757 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 579 | Open in IMG/M |
| 3300015053|Ga0137405_1132975 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1540 | Open in IMG/M |
| 3300015241|Ga0137418_10543122 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 922 | Open in IMG/M |
| 3300015264|Ga0137403_10928372 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300015357|Ga0134072_10041166 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300015371|Ga0132258_11114428 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
| 3300015372|Ga0132256_100893945 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1004 | Open in IMG/M |
| 3300015373|Ga0132257_102096899 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300015373|Ga0132257_102214310 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300015373|Ga0132257_102284024 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300015373|Ga0132257_103244255 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300015374|Ga0132255_102064617 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300015374|Ga0132255_103604939 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300015374|Ga0132255_104679177 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300016357|Ga0182032_10356821 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1171 | Open in IMG/M |
| 3300017959|Ga0187779_11243343 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300018071|Ga0184618_10291315 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 694 | Open in IMG/M |
| 3300018431|Ga0066655_10493469 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300018433|Ga0066667_10139034 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300018433|Ga0066667_11079311 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 694 | Open in IMG/M |
| 3300018433|Ga0066667_12002422 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300021475|Ga0210392_10992377 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300025315|Ga0207697_10054608 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300025899|Ga0207642_10777019 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300025899|Ga0207642_10996321 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025903|Ga0207680_10889325 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300025907|Ga0207645_10324675 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300025920|Ga0207649_11374078 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 559 | Open in IMG/M |
| 3300025922|Ga0207646_11515476 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 580 | Open in IMG/M |
| 3300025923|Ga0207681_11559193 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 553 | Open in IMG/M |
| 3300025925|Ga0207650_10298635 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1315 | Open in IMG/M |
| 3300025925|Ga0207650_11073365 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 685 | Open in IMG/M |
| 3300025926|Ga0207659_10449550 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300025926|Ga0207659_10573972 | Not Available | 960 | Open in IMG/M |
| 3300025926|Ga0207659_10683595 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300025926|Ga0207659_11579669 | Not Available | 560 | Open in IMG/M |
| 3300025927|Ga0207687_10933131 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 743 | Open in IMG/M |
| 3300025928|Ga0207700_11809654 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300025930|Ga0207701_10362555 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300025930|Ga0207701_10684497 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300025930|Ga0207701_10688982 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300025930|Ga0207701_11672003 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 510 | Open in IMG/M |
| 3300025931|Ga0207644_10551686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 954 | Open in IMG/M |
| 3300025936|Ga0207670_10202952 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300025936|Ga0207670_11101939 | All Organisms → cellular organisms → Bacteria → PVC group | 670 | Open in IMG/M |
| 3300025936|Ga0207670_11340177 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 607 | Open in IMG/M |
| 3300025937|Ga0207669_10209222 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300025940|Ga0207691_10022078 | All Organisms → cellular organisms → Bacteria | 6004 | Open in IMG/M |
| 3300025942|Ga0207689_11641782 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 534 | Open in IMG/M |
| 3300025944|Ga0207661_10925612 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 803 | Open in IMG/M |
| 3300025960|Ga0207651_10283655 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1370 | Open in IMG/M |
| 3300025960|Ga0207651_10400716 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300025986|Ga0207658_10018706 | All Organisms → cellular organisms → Bacteria | 4789 | Open in IMG/M |
| 3300025986|Ga0207658_10287361 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300025986|Ga0207658_10317076 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300025986|Ga0207658_10966890 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 776 | Open in IMG/M |
| 3300026023|Ga0207677_11262525 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300026067|Ga0207678_10657886 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300026089|Ga0207648_10221896 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300026089|Ga0207648_10226346 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300026089|Ga0207648_10433744 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300026089|Ga0207648_10971356 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300026095|Ga0207676_10637901 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1027 | Open in IMG/M |
| 3300026121|Ga0207683_10873130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300026142|Ga0207698_12509233 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300026221|Ga0209848_1065083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 650 | Open in IMG/M |
| 3300026281|Ga0209863_10164967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300026316|Ga0209155_1131718 | Not Available | 857 | Open in IMG/M |
| 3300026335|Ga0209804_1113889 | All Organisms → cellular organisms → Bacteria → PVC group | 1232 | Open in IMG/M |
| 3300026342|Ga0209057_1025875 | All Organisms → cellular organisms → Bacteria | 3191 | Open in IMG/M |
| 3300026537|Ga0209157_1287133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 610 | Open in IMG/M |
| 3300026550|Ga0209474_10738886 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300027364|Ga0209967_1064488 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300027431|Ga0207437_101453 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 639 | Open in IMG/M |
| 3300027846|Ga0209180_10169743 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1258 | Open in IMG/M |
| 3300028379|Ga0268266_10719704 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 962 | Open in IMG/M |
| 3300028381|Ga0268264_11730882 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 635 | Open in IMG/M |
| 3300028885|Ga0307304_10578193 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031057|Ga0170834_103846104 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 562 | Open in IMG/M |
| 3300031231|Ga0170824_100777468 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula sallentina | 507 | Open in IMG/M |
| 3300031473|Ga0272434_1312187 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 658 | Open in IMG/M |
| 3300031562|Ga0310886_10380105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 828 | Open in IMG/M |
| 3300031938|Ga0308175_100396289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1441 | Open in IMG/M |
| 3300031947|Ga0310909_10691055 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 848 | Open in IMG/M |
| 3300031996|Ga0308176_10750975 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300032076|Ga0306924_10546223 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 9.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 7.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.12% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.37% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.37% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.37% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.37% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.37% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.37% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027431 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A1a-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031473 | Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nord | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_08527890 | 2170459002 | Grass Soil | SDSPIVGNFANLADGSTITIGSNTFQANYEGGDGNDLTLTVISN |
| 4MG_02778470 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VIISNTSVNPIVGTFDNLSDGAIITVNGNNLQASYEGRDGNDLTLTVVP |
| FD2_00871250 | 2189573001 | Grass Soil | IAGTFANLADRSIFTASSNTYQVNYKCSDRNDLTLTVVS |
| ICChiseqgaiiDRAFT_22698252 | 3300000033 | Soil | MAGTFSNLPDXGTFTSNDNTYQVSYERGDGNNLTLIVLP* |
| INPhiseqgaiiFebDRAFT_1016865382 | 3300000364 | Soil | ANLPDGSTFTSGRNTYQVNYQGGDGNDLTLTVVP* |
| JGI11615J12901_118538211 | 3300000953 | Soil | SNLPDGSTITLAGNTFQVNYEGGDGNDLTLTVIP* |
| JGI10216J12902_1154981241 | 3300000956 | Soil | ATFSNLPDGSTFTVNGNTYQANYEGRDGNDLTLMVVP* |
| JGI24744J21845_101024031 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | FANLPDGGTVTIGLNDFQANYEGGDGNDLTLAVVP* |
| Ga0062590_1024822332 | 3300004157 | Soil | PIAGTFINLSDGSTLSVGSNTFRANYRGGDGNDLTLTVVP* |
| Ga0063356_1006376743 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NTAATPIGGRFSNLPDGTIIVVGSNTFQADCEGGDGNDLTLTVVP* |
| Ga0062595_1004689042 | 3300004479 | Soil | SMATSGTFNNLAEGAIVTVNGNNLQATYKGGSGNNDLLLTVVP* |
| Ga0062595_1026507002 | 3300004479 | Soil | PIAGTFANLADGATFTIGSNTFQANYEGGDGNDLTLTVVQ* |
| Ga0062591_1023332182 | 3300004643 | Soil | TSGTFANLPAAGTVTVGSNSFQANYEGGDGNDLTLTVVGN* |
| Ga0062594_1001983801 | 3300005093 | Soil | TVQIGGRFGNLADGATIQIGNNTFQANYEGGDGNDLTLTVVP* |
| Ga0066688_101183624 | 3300005178 | Soil | NPISGTFSNLPDGGIVTINGNNLQANCEGGDGNDLTLTVVP* |
| Ga0066684_107249362 | 3300005179 | Soil | SNSLISGTFLNLRDGQTFTKFGNTYAVSYEGGDGNDLTLIVQ* |
| Ga0066685_101886321 | 3300005180 | Soil | ANRIAGTFANLADRSTFTAGSNTFQANYKGGDHNDLTLTVVP* |
| Ga0066676_107680011 | 3300005186 | Soil | TSGAFSNLPEGGTITIGINTFQADYGGGDGNDLTLTVIP* |
| Ga0066675_112718251 | 3300005187 | Soil | IAGTFANLADGSTFTFGSNTFQASYEGGDGNDLTLTVVP* |
| Ga0065712_103175052 | 3300005290 | Miscanthus Rhizosphere | IAGTFANLPDGSTVVFGSNSYLVSYEGGDGNDLTLTVVP* |
| Ga0065715_110580901 | 3300005293 | Miscanthus Rhizosphere | TNNGLGAIAGRFTNLADGGTITIGSNTFQANYEGGDGNDLTLTVVQ* |
| Ga0070683_1019747061 | 3300005329 | Corn Rhizosphere | TAILGTFANLPDGGTITVGSNTFQANYEGGDGNDLTLTVIP* |
| Ga0070690_1001466913 | 3300005330 | Switchgrass Rhizosphere | ISGIFRNLPDGGTITIGGNTYQANYEGGDGNDLTLTVVS* |
| Ga0070670_1019953761 | 3300005331 | Switchgrass Rhizosphere | VFDNRAATPIAGTFSNIADGGTVTVGSNTFQANYEGGDGNDLTLTVVSN* |
| Ga0066388_1062206221 | 3300005332 | Tropical Forest Soil | VLTLISNTSSDPITGNFADLPDDSIVTINGNNFQASYSGGDGNDLTLSVVP* |
| Ga0066388_1079086761 | 3300005332 | Tropical Forest Soil | FTVIANTSSKPVSGVFANLPDGGTIVVGVNTFQANYEGGDGNDLTLTVVP* |
| Ga0070687_1014566271 | 3300005343 | Switchgrass Rhizosphere | VGTVLTVISMPSANPIRGAFGNLPDGAIVTVNGNNLQAIYSGGDGNDLTLTVVA* |
| Ga0070661_1008403412 | 3300005344 | Corn Rhizosphere | NTAVAPIVGTFHNLANGKIIAVNGNSLQASYSGGDGNDLTLTVVP* |
| Ga0070692_107703231 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | TVINNTAATPISGVFNNLADGATVTVRSNIFKSNYEGGDGNDLTLTVVQ* |
| Ga0070668_1011681422 | 3300005347 | Switchgrass Rhizosphere | NTSRSPINGTFDNLTDGGTITIGNNTFQANYEGGDGNDLTLTVIGN* |
| Ga0070668_1017335222 | 3300005347 | Switchgrass Rhizosphere | VLTVINNTAATPIAGTFANLSDGSKLVIGNNSYQADYEGNDGNDLTLTVVP* |
| Ga0070675_1000360231 | 3300005354 | Miscanthus Rhizosphere | LACPGIHNLANGKIIAVNGNNLQASYKGGDGNDLTLTVVP* |
| Ga0070675_1013981612 | 3300005354 | Miscanthus Rhizosphere | LVIANTSATPISGAFSNLPDGGILNVGGNNLQASYEGGDGDLTLT |
| Ga0070671_1011461891 | 3300005355 | Switchgrass Rhizosphere | NTAETPIAGQFDNLMDGSTYTIGTNTFQANYEGGDGNDLTLTVVP* |
| Ga0070671_1012961871 | 3300005355 | Switchgrass Rhizosphere | GTILTVIRNTSANPINGTFSKLANGAIVNVNGNNLQASCTGREGNDLTLTVVP* |
| Ga0070671_1018183711 | 3300005355 | Switchgrass Rhizosphere | ISGSFANLVDGSTVTVGVNELQVSYSSGDGNDLTLTVVP* |
| Ga0070674_1013771552 | 3300005356 | Miscanthus Rhizosphere | TGTVLTVLNNTAATPISGVFANLADGGILTVGSNTFQANYEGGDGNDLTLTVIP* |
| Ga0070674_1017009381 | 3300005356 | Miscanthus Rhizosphere | TAATPIAGTFTNLADGSTLIVGSNTYKANYEGGSGNDLTLTVQ* |
| Ga0070688_1001282652 | 3300005365 | Switchgrass Rhizosphere | ATPISGVFNNLPDGATVTVRSNIFKSNYKGGDGNDLTLTVVQ* |
| Ga0070667_1001047184 | 3300005367 | Switchgrass Rhizosphere | AVAPIVGTFHNLANGKIIAVNGNSLQASYSGGDGNDLTLTVVP* |
| Ga0070667_1001069364 | 3300005367 | Switchgrass Rhizosphere | ISDTASTPIAGTFANLADGITLAIGSNHLKVSYEGGDGNDLTFTVVP* |
| Ga0070667_1003100231 | 3300005367 | Switchgrass Rhizosphere | ISGVFANLADGATVIVGSNIFQANYEGGDGNDLTLTVVP* |
| Ga0070667_1003376541 | 3300005367 | Switchgrass Rhizosphere | AIAGTFGNLPDGSTLTVGSNTFKANYGGGDGNDLTLTVVP* |
| Ga0070713_1016476032 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ANPIAGSFSNLQDGGIIKAGGNRLQASYEGGDGNDLTLTVVP* |
| Ga0066682_107777242 | 3300005450 | Soil | TGSSPIVGTFMNLPDGGTITADNNTFQADYEGGDGNDLTLTAIN* |
| Ga0066681_108150112 | 3300005451 | Soil | NKSGVPIAGTFANLADGSSFRVNGNTFQASYEGGDGNDLTLTVQ* |
| Ga0070678_1001014482 | 3300005456 | Miscanthus Rhizosphere | VTPISGTFSNLSDGGTILVGNNNTLQANYEGGDGNDLTLTVVP* |
| Ga0068867_1001787972 | 3300005459 | Miscanthus Rhizosphere | AGTFSNIADGGTVTVGSNTFQANYEGGDGNDLTLTVVSN* |
| Ga0068867_1017376462 | 3300005459 | Miscanthus Rhizosphere | ATPISGTFGNLPDGATITAGRNTFQANYEGGDGNDFTLTVVP* |
| Ga0070706_1014036021 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AATPISGTFAKLPDGSTVTVGSNTFQANYEGCDGNDLTLTVVP* |
| Ga0070699_1004063431 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IAGTFANLADGATFTIDNITFQADYQGGDGNDLTLTVVP* |
| Ga0070697_1013546081 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AIPIAGTFANLADGSTFTAGSNVFQANYEGGDGNDLTLTVVE* |
| Ga0070672_1003331022 | 3300005543 | Miscanthus Rhizosphere | AGTFANLTDGATVVVGNNTFQANYEGGDGNDLTLTVQ* |
| Ga0070672_1006117392 | 3300005543 | Miscanthus Rhizosphere | VINNTSGTPINGSFSNLSDGGTVTIGNTTFQANYEGGDGNDLTLTVVNN* |
| Ga0070672_1011848981 | 3300005543 | Miscanthus Rhizosphere | SSQPIVGAFSNLPDGGTIAAGENTLLANYTGGDGNDLTLTVIP* |
| Ga0070686_1009411631 | 3300005544 | Switchgrass Rhizosphere | GPISGTFDNLPDGGTIKIGNNTFQANYEGGDGNDLTLTVVP* |
| Ga0070695_1007674151 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LETHHSSGSFTNLPDGGTITVGRNTFQANYEGGDGNDLTVTVVP* |
| Ga0070695_1012133583 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TSSAPIVGAFSNLSDGSVFTSKGNNFQASYEGGDGNDLMLTVVP* |
| Ga0070665_1000689911 | 3300005548 | Switchgrass Rhizosphere | PINGTFDNLTDGGTITIGNNTFQANYEGGDGNDLTLTVIGN* |
| Ga0070665_1015554902 | 3300005548 | Switchgrass Rhizosphere | FSNLPDGSTITVGNNTFQANYEGGDGNDLTLTVVP* |
| Ga0066701_108942532 | 3300005552 | Soil | HNLAEGAIVTVNGSNLQASYTGGDGNDLTLTVVP* |
| Ga0066670_108720552 | 3300005560 | Soil | FANLPDNSTFTIGRNNYQASYEGCDGNDLTFTVVP* |
| Ga0066693_101385892 | 3300005566 | Soil | NTSANPISGSFSNLPDGAIVTINGNNLQASYEGGDGNDLTTTVVP* |
| Ga0068866_110297842 | 3300005718 | Miscanthus Rhizosphere | SPINGTFANLPDGGTVTIGLNDFQANYEGGDGNDLTLAVVP* |
| Ga0066903_1034195172 | 3300005764 | Tropical Forest Soil | IAGTFANLADRSTFTAGSNTFQVNYKGGNGNDLTLTVVR* |
| Ga0066903_1063660781 | 3300005764 | Tropical Forest Soil | GTFANLHDGSIITIFGNRLRASYEGGDGNDLTLTVVP* |
| Ga0068863_1015979612 | 3300005841 | Switchgrass Rhizosphere | TVINNTAVAPIVGTFHNLANGKIIAVNGNSLQASYSGGDGNDLTLTVVP* |
| Ga0068863_1023804352 | 3300005841 | Switchgrass Rhizosphere | TMFSNTAATPINGEFEEMPDGGTVTIGSNTFQANYEGGDGNDLTLTVVP* |
| Ga0068860_1002444152 | 3300005843 | Switchgrass Rhizosphere | SNLADGAVVNVNGNNFQASYTGGDGNDLTLTVVP* |
| Ga0068860_1003590903 | 3300005843 | Switchgrass Rhizosphere | ATPISGAFSNLPDGGILNVGGNNLQASYEGGDGNDLTLTVVP* |
| Ga0068860_1008533381 | 3300005843 | Switchgrass Rhizosphere | IAGTFHNLRDGQVITVNRSNLQATYTGGDGNDLTLTVVP* |
| Ga0068860_1012253523 | 3300005843 | Switchgrass Rhizosphere | ANLSDGSTFATDGNTFQASYSGGGGNDLTLTMVP* |
| Ga0080027_101465981 | 3300005993 | Prmafrost Soil | PISGTFANLADGSIITAGPNTLQVSYEGGDGNDLTLTVVP* |
| Ga0080027_104202951 | 3300005993 | Prmafrost Soil | SSTPISGTFTNLADGATLKSGNNKFQASYEGGDGNDLTLTVVP* |
| Ga0097621_1000972033 | 3300006237 | Miscanthus Rhizosphere | SNLSDGGTILVGNNNTLQANYEGGDGNDLTLTVVP* |
| Ga0097621_1022117791 | 3300006237 | Miscanthus Rhizosphere | PILGTFGNLADGSIVTVRNNKFQVNYEGGDGNDLVLVSVR* |
| Ga0079222_126024921 | 3300006755 | Agricultural Soil | GVFANLFDGGTITAGSNTFRANYEGGDGNDLTLTVVQ* |
| Ga0066658_108655891 | 3300006794 | Soil | GTFANLADGSTFTIGNNTFQASYEGGDGNDLTLTVVP* |
| Ga0066665_101345164 | 3300006796 | Soil | GTFSNLPDGAIVTVGRNQLKVSYEGGDGNDLTLTVQ* |
| Ga0066659_110542982 | 3300006797 | Soil | VIISNTSVNPIAGTFDNLSDGAIITVNGNNLQASYEGGDGNDLTLTVVP* |
| Ga0066659_117341061 | 3300006797 | Soil | FANLPDDGTTTIGSNTFRANYEGGDGNDLTLTVVP* |
| Ga0079221_108704672 | 3300006804 | Agricultural Soil | LENTAPSKIKGTFGNLPDGATVVIGVNKFVVRYEGGDGNDLTLTVVP* |
| Ga0079220_102657223 | 3300006806 | Agricultural Soil | SNLSDGAILTANGNNFQASYQGGDGNDLTLTVVP* |
| Ga0079220_113607882 | 3300006806 | Agricultural Soil | VFANLADGATITAGSNTYQAHYSGGDGNDLTLTVVQ* |
| Ga0075430_1018128381 | 3300006846 | Populus Rhizosphere | TNLPDGGTITAGANTFQANYEGGDGNDLTLTVVP* |
| Ga0075425_1010562252 | 3300006854 | Populus Rhizosphere | LLQRRGSFSNLPDGGIVTINGNNLQANYEGGDGNDLTLTVVP* |
| Ga0075425_1021866421 | 3300006854 | Populus Rhizosphere | NPIASTFSNLLDDAILTVNGNNFQANYEGGDGNYLTLTVVP* |
| Ga0075434_1003447891 | 3300006871 | Populus Rhizosphere | GDNPISSTFSNLPDGGTITIGSSSFHANYEGRDGNDLTLTVVP* |
| Ga0075434_1023085221 | 3300006871 | Populus Rhizosphere | HNLSDGQMIVVNGSNLQASYTGGDNNDLTLTVVP* |
| Ga0068865_1000081119 | 3300006881 | Miscanthus Rhizosphere | FSNLADGSTVTAGNNTFQADYEGGDGNDLTLTVMP* |
| Ga0079219_105361411 | 3300006954 | Agricultural Soil | SISGTFVNLPDSGAITVGTNTYQANYEGGDGNDLTLTVIP* |
| Ga0079219_106365052 | 3300006954 | Agricultural Soil | PEGTVFTVIDNQSPTPISGNFANLPDGGTITYSVTTFQASYEGGDGNDLTLTVL* |
| Ga0079219_113963951 | 3300006954 | Agricultural Soil | SPFTSAFANLGEGAIVVAGRNKLQASYVGGDGNDLTLTVVR* |
| Ga0099791_102446141 | 3300007255 | Vadose Zone Soil | NPISGTFANLPDGGIVTINGNNLQASYSGGDGNDLTLTVVP* |
| Ga0099829_104989102 | 3300009038 | Vadose Zone Soil | LTVISDTAATPIAGTFTNLPDGAMFMQGRNTYQVSYEGGDGNDLTLTVLP* |
| Ga0099829_105305181 | 3300009038 | Vadose Zone Soil | GTFANLADGSTFTIGSNTLQASYEGGDGNDLTLTVLP* |
| Ga0099830_103236031 | 3300009088 | Vadose Zone Soil | FSNLPDGSTFTSNGNTYQVNYEGGNGNDLTLTVVP* |
| Ga0099828_103513733 | 3300009089 | Vadose Zone Soil | TFSNLADGSTFTNNGNTYKVSYEGGNGNDLTLTVQ* |
| Ga0099828_109038372 | 3300009089 | Vadose Zone Soil | DNTAATAIDGAFRNLPDGSTITRGGNTFQADYEGGDGNDLTLTVVQ* |
| Ga0099827_119704651 | 3300009090 | Vadose Zone Soil | VTKNTATTPISGTFNNLPDGAIVNVNGNNLQASYTGLDGNDLT |
| Ga0066709_1002843421 | 3300009137 | Grasslands Soil | FSNLPDGGIVTINGNNFQASYEGGDGNDLTLTVVP* |
| Ga0066709_1013386952 | 3300009137 | Grasslands Soil | FSNLPDGAIVTVNGNNLQASYEGGDGNDLTLTVVP* |
| Ga0066709_1037574362 | 3300009137 | Grasslands Soil | FSNLPDGSTFSSNGNTYQVSYEGGDGNDLTLTVVP* |
| Ga0066709_1038049202 | 3300009137 | Grasslands Soil | GNRNAGLAGKLADRSTFTAGSNTVQANYRGGDGDDLILTVVP* |
| Ga0105241_125808282 | 3300009174 | Corn Rhizosphere | AGTFANLAGGATVIVGNNTFQANYEGGDGNDLTLTVQ* |
| Ga0105248_119652841 | 3300009177 | Switchgrass Rhizosphere | NISATPILGTFGNLADGSIVTVRNNKFQVNYEGGDGNDLVLVSVR* |
| Ga0105238_116396912 | 3300009551 | Corn Rhizosphere | FSNIADGGTVTVGSNTFQANYEGGDGNDLTLTVVSN* |
| Ga0126315_110279811 | 3300010038 | Serpentine Soil | MGTISGTSANLLDSATITAGSNAFQVNYEGGDGNDL |
| Ga0126380_106944861 | 3300010043 | Tropical Forest Soil | TAATPIARTFANLADDSIVRILGAKLHASYEGGDGNDLTLTVVR* |
| Ga0126384_103171881 | 3300010046 | Tropical Forest Soil | LLSGRFNNLPDGATVTVGSNTYQANYEGGDGNDLTLTVVP* |
| Ga0126382_110395641 | 3300010047 | Tropical Forest Soil | SGTFANLPDGSTFVVGPNNYQVSYEGGDGNDLTLTVVP* |
| Ga0099796_102486661 | 3300010159 | Vadose Zone Soil | KPISGTFSNLPDSGIVNVNGNNLGASYEGGDGNDLTLTVVP* |
| Ga0134082_102883621 | 3300010303 | Grasslands Soil | SANPISGTFSNLPYGAIVTVGRNQLKVSCEGGDGKDLTLTVQ* |
| Ga0134109_104125381 | 3300010320 | Grasslands Soil | DTSAKPISGTSSNLPDSGIVNVNGNNLGASYEGGDWNDLTLTEVP* |
| Ga0134065_102683412 | 3300010326 | Grasslands Soil | FSNLPDGGIVTINGNNFQASYSGGDGNDLTLTVVP* |
| Ga0126379_121379982 | 3300010366 | Tropical Forest Soil | ADPISGTFANLPDGGIVTINGNNLQASYSGGDGNDLTLTVVP* |
| Ga0134125_124952391 | 3300010371 | Terrestrial Soil | TFHNLPEKKILTVNGSNLQASYTGGDGNDLTLTVVP* |
| Ga0134128_109479302 | 3300010373 | Terrestrial Soil | ATAINGNFANLSDGSLITAGSNTFQANYEGGDWNDLTLTVVP* |
| Ga0134128_127590422 | 3300010373 | Terrestrial Soil | NPIAGTFANLPDGAILTVGANIFQASYEGGDGNDLTLTVLP* |
| Ga0105239_127456222 | 3300010375 | Corn Rhizosphere | FGNLPDGATITAGRNTFQANYEGGDGNDFTLTVVP* |
| Ga0134121_127270461 | 3300010401 | Terrestrial Soil | ITGTFGDLADGAIITVRGVNFQANYEGGDGNDLTLTVVL* |
| Ga0137388_106673582 | 3300012189 | Vadose Zone Soil | YCDEQYRGTPTAGTFSNLADGSTFTNNGNTYKVNYEGGTGNDLTLTVQ* |
| Ga0137364_104497161 | 3300012198 | Vadose Zone Soil | IVGTFHNLGDGQIIAVNGSNLQASYTGGDGNDLTLTVIP* |
| Ga0137383_107811502 | 3300012199 | Vadose Zone Soil | SGTFANLLDGAVVTVNGNNFQANYQGGDGNDLTLTVVP* |
| Ga0137365_100322331 | 3300012201 | Vadose Zone Soil | TFTNLPDGSTFTVGRNSYQVSYEGGDGNDLTLTVVP* |
| Ga0137363_112885501 | 3300012202 | Vadose Zone Soil | FSNLPDGGIVNVNGNNLQASYSGGDGNDLTLTVVP* |
| Ga0137380_108165951 | 3300012206 | Vadose Zone Soil | MNLPDGGTITVGNNTFQADYEGGDGNDLTLTVVP* |
| Ga0137377_105826671 | 3300012211 | Vadose Zone Soil | SGTFGNLPDGGIVTIDGNNLQASYSGGDGNDLTLTVVP* |
| Ga0137377_111059621 | 3300012211 | Vadose Zone Soil | GTFHNLADGAIISINGNNLQADYQGGDGNDLTLTVVP* |
| Ga0137370_107352982 | 3300012285 | Vadose Zone Soil | VRFCAGSIFTVNGHNFQASYEGGDGNDLTLTVLP* |
| Ga0137370_109825411 | 3300012285 | Vadose Zone Soil | PISGTFANLADGSTIIAGPNTLQASYEGGDGNDLTLTVVP* |
| Ga0137372_105670732 | 3300012350 | Vadose Zone Soil | FTNLPDGSTFTVGRNSYQVSYEGGDGNDLTLTVVP* |
| Ga0137366_103789441 | 3300012354 | Vadose Zone Soil | STKPISGTFSNLPDSGIVNVNGNNLGASYEGGDGNDLTLTVVP* |
| Ga0137371_104015601 | 3300012356 | Vadose Zone Soil | TFGNLPDGGIVTIDGNNLQASYSGGDGNDLTLTVVP* |
| Ga0137384_114651391 | 3300012357 | Vadose Zone Soil | SNLPDGAIVTVGTNHLQANYAGGDGNDLTLTVVP* |
| Ga0137390_108923041 | 3300012363 | Vadose Zone Soil | ASTIAGTFINLADGEIITTNGGKFQADYEGGDGNDLTLTVVP* |
| Ga0137398_100577414 | 3300012683 | Vadose Zone Soil | RSWKKSGTFANLPDGSIITIHGKNLQASYEGGDGNDLTLTVVP* |
| Ga0137398_101583691 | 3300012683 | Vadose Zone Soil | LTVISNTAATPIAGTFINLADGITLAIGSNHLKVSYEGGDGNDLTLTVVP* |
| Ga0137398_102645793 | 3300012683 | Vadose Zone Soil | GTLANLPDNSTFTVGRNNYQANYEGGDGNDLTLTVVQ* |
| Ga0137398_103394341 | 3300012683 | Vadose Zone Soil | ISGTFSNLPDGGIVTINGNNLQANCEGGDGNDLTLTVVP* |
| Ga0157284_102778712 | 3300012893 | Soil | SFHNLPEGEILIVNGSKLQASYEGGDGNDLTLTVVP* |
| Ga0137395_110540191 | 3300012917 | Vadose Zone Soil | TFSNLADGSTFTNGANTYLASYHGGNGNDLTLTVQ* |
| Ga0137419_110120782 | 3300012925 | Vadose Zone Soil | NPIMGTFANLPDGEILTSGGITVQANYHGGTGNDLTLTVQ* |
| Ga0137416_118056552 | 3300012927 | Vadose Zone Soil | ANLPDGSTFTTHGNSFLANYEGGDGNDLTLTVVP* |
| Ga0137404_102381621 | 3300012929 | Vadose Zone Soil | TFSNLPDGEIVTINGNNFQASYSGGDGNDLTLTVVP* |
| Ga0137407_112703201 | 3300012930 | Vadose Zone Soil | TFSNLPDGAIVNINGNNLQASYSGGDGNDLTLTVVP* |
| Ga0137407_122174311 | 3300012930 | Vadose Zone Soil | TFSNPPDGVIVTINGNNFQASYEGGDGNDLTLTVVP* |
| Ga0164299_107888613 | 3300012958 | Soil | APIAGAFSNLPNGSAFTSKGNNFQASYEGGDGNDLTLTVVP* |
| Ga0164301_112825492 | 3300012960 | Soil | TFSNLVDGSTITIGNNTFQANYEGGDGNDLTLTVVP* |
| Ga0164309_104012091 | 3300012984 | Soil | TPIAGTFTNLPDGSIITTKGNKFQASYEGGDGNDLTLTVVH* |
| Ga0164308_103172041 | 3300012985 | Soil | SNLPNGSAFTSKGNNFQASYEGGDGNDLTLTVVP* |
| Ga0164308_105585302 | 3300012985 | Soil | NNTSGTPINGSFSNLSDGGTVTIGNTTFQANYEGGDGNDLTLTVVNN* |
| Ga0157374_100446505 | 3300013296 | Miscanthus Rhizosphere | SPINGTFDNLTDGGTITIGNNTFQANYEGGDGNDLTLMVLP* |
| Ga0157374_100889261 | 3300013296 | Miscanthus Rhizosphere | ATPIAGTFANLTDGATVVVGNNTFQANYEDGDGNDLTLTVVP* |
| Ga0157374_102232201 | 3300013296 | Miscanthus Rhizosphere | GTFANLADGATVIVGNNTFQANYEGGDGNDLTLTVVSL* |
| Ga0157374_103671791 | 3300013296 | Miscanthus Rhizosphere | TFSNLPDGSTITVGSNTFQANYEGGDGNDLTLTVVP* |
| Ga0157374_107068922 | 3300013296 | Miscanthus Rhizosphere | TFGNLPDGGTIQIGNNTFQANYEGGDGNDLTLTVTQ* |
| Ga0157374_107699642 | 3300013296 | Miscanthus Rhizosphere | GTFANLPDGGTIIIGQNTYQADYEGGDGNDLTLTVM* |
| Ga0157374_116376121 | 3300013296 | Miscanthus Rhizosphere | IAGTFVNLADGSTFTFGNNTFQASYEGGDGNDLTLTVVP* |
| Ga0157378_101166621 | 3300013297 | Miscanthus Rhizosphere | NNTAATPIAGTFGNLPDGGTLQIGNNTYQANYEGGDGNDLTLTVVE* |
| Ga0157378_101780051 | 3300013297 | Miscanthus Rhizosphere | PISGAFANLPDGAMITIGSNKFQANYEGGDGNDLTLTVVSF* |
| Ga0157378_102836792 | 3300013297 | Miscanthus Rhizosphere | MPSANPIRGAFGNLPDGAIVTVNGNNLQAIYSGGDGNDLTLTVVA* |
| Ga0157378_102998691 | 3300013297 | Miscanthus Rhizosphere | IAGTFANLPDGGTLTVGLNDFQANYEGGDGNDLTLTVVP* |
| Ga0163162_107718241 | 3300013306 | Switchgrass Rhizosphere | SPINGTFDNLTDGGTITIGNNTFQANYEGGDGNDLTLTVIGN* |
| Ga0163162_120675361 | 3300013306 | Switchgrass Rhizosphere | PINGSFSNLSGGGTVTIGNNTFQASYEGGDGNDLTLTVVQ* |
| Ga0157375_104529761 | 3300013308 | Miscanthus Rhizosphere | GTFANLPDGEILTSGGTTVQANYHGGTGNDLTLTVQ* |
| Ga0157375_107591943 | 3300013308 | Miscanthus Rhizosphere | ATPIAGAFGNLADGAIVTVNGNNLQASYTGGDGNDLTLTVVQ* |
| Ga0157375_115983731 | 3300013308 | Miscanthus Rhizosphere | TFGNLADGATLTVGSNKFQANYEGGDGNDLTLTVVQ* |
| Ga0157375_129363732 | 3300013308 | Miscanthus Rhizosphere | GATPIAGTFANLADGATVVVGNNTFQANYEDGDGNDLTLTVVP* |
| Ga0134079_106262612 | 3300014166 | Grasslands Soil | ANLPDGSTFTVGSNNYQVSYSGGDGNDLTLTVVL* |
| Ga0163163_105428161 | 3300014325 | Switchgrass Rhizosphere | TFANLSDGGSITVGGNTFQANYEGGDGNDLTLTVVP* |
| Ga0163163_122996882 | 3300014325 | Switchgrass Rhizosphere | AIVETFGNLPDGGTITVGSNTFQANYEGGDGNDLTLTVLP* |
| Ga0163163_123406222 | 3300014325 | Switchgrass Rhizosphere | VINNAAATPISGIFANLADGATVRVGNNTFQANYGGGDGNDLTLTVIP* |
| Ga0157380_109404221 | 3300014326 | Switchgrass Rhizosphere | FTVIDNTAAAPIAGTFVNLADGSIFTVGNNTFQASYEGGDGNDLTLMVVP* |
| Ga0157376_102612821 | 3300014969 | Miscanthus Rhizosphere | TFANLQDGATIVVGNNTFQAKYEGGGGNDLTLTVTG* |
| Ga0157376_103211762 | 3300014969 | Miscanthus Rhizosphere | FANLADGATVIVGSNTFQANYKGGDGNDLTLTVVP* |
| Ga0157376_106393941 | 3300014969 | Miscanthus Rhizosphere | AATPIAGTFANLADGITLDFGPNHLMVSYEGGDGNDLTFTVVP* |
| Ga0157376_120978122 | 3300014969 | Miscanthus Rhizosphere | PIIGSFNNLPDDGRITIGSNTFQANYEGGDGNDLTLTVVSN* |
| Ga0157376_122967571 | 3300014969 | Miscanthus Rhizosphere | TFSNLPDGSTITVGNNTFQANYEGGDGNDLTLTVVP* |
| Ga0137405_11329753 | 3300015053 | Vadose Zone Soil | SNLPDGEIVTINGNNFQASYSGGDGNDLTLTVVP* |
| Ga0137418_105431223 | 3300015241 | Vadose Zone Soil | GTFSNLPDGGIVNVNGNNLQASYEGGDGNDLTLTVVP* |
| Ga0137403_109283721 | 3300015264 | Vadose Zone Soil | GTFANLADGATFTIDNITFQADYQGGDGNDLTLTVVP* |
| Ga0134072_100411661 | 3300015357 | Grasslands Soil | GTFTNLPEGTILQAGRNKLQASYTGGDGNDLTLTVVQ* |
| Ga0132258_111144283 | 3300015371 | Arabidopsis Rhizosphere | LISGTFANLADGAIITVGSDNFQASYSGGDGNDLTLTVVL* |
| Ga0132256_1008939451 | 3300015372 | Arabidopsis Rhizosphere | TFSNLSDGAILTANGNNFQASYHGGDGNDLTLTVMP* |
| Ga0132256_1035486421 | 3300015372 | Arabidopsis Rhizosphere | TGAALTILSNTAATPTAGAFANLADGATIMIGNNTFQANYEGGDGNDLTLTVVE* |
| Ga0132257_1020968991 | 3300015373 | Arabidopsis Rhizosphere | TFSNLADQSTITAGGNTFRANYEGGDGNDLTLGVVP* |
| Ga0132257_1022143102 | 3300015373 | Arabidopsis Rhizosphere | ANLHDGSIVTIFGNHLQASYEGGDGNDLTLTVVR* |
| Ga0132257_1022840242 | 3300015373 | Arabidopsis Rhizosphere | LVIDNPSATPISGAFSNLPDGGILNLGGNNLQASYEGGDGNDLTLTVVP* |
| Ga0132257_1032442551 | 3300015373 | Arabidopsis Rhizosphere | PIAGTFLNLADDSTFTVGSNTFQANYEGGDGNDLTLTVVP* |
| Ga0132255_1020646172 | 3300015374 | Arabidopsis Rhizosphere | TPIAGTFANLADGITLDFGPNHLMVSYEGGDGNDLTFTVVP* |
| Ga0132255_1036049391 | 3300015374 | Arabidopsis Rhizosphere | GTFHNLRDGAIITVNGSNLQASYTGGDGNDLTLTVVP* |
| Ga0132255_1046791772 | 3300015374 | Arabidopsis Rhizosphere | AATPIAGTFANLHDGSIVTVFGNHLQASYEGGDGNDLTLTVVR* |
| Ga0182032_103568211 | 3300016357 | Soil | TFMNLPDGGTITVGNNTFQANYEGGDGNDLTLTVVP |
| Ga0187779_112433431 | 3300017959 | Tropical Peatland | GAFANLPDNAILSVNGKTLRESYEGGDGNDLTLTVMP |
| Ga0184618_102913152 | 3300018071 | Groundwater Sediment | SNTSANPIAGTFINLADGSTFTAGRNNFQASYEGGDSNDLTVTVVP |
| Ga0066655_104934692 | 3300018431 | Grasslands Soil | TFSNLPDGGTITAGNNTFQASYSGGDGNDLTLTVVP |
| Ga0066667_101390341 | 3300018433 | Grasslands Soil | ANRIAGTFANLADRSTFTAGSNTFQANYKGGDHNDLTLTVVP |
| Ga0066667_110793112 | 3300018433 | Grasslands Soil | FANLPDGSTFTAGRNNFQVNYSGGDGNDLTLAVVP |
| Ga0066667_120024222 | 3300018433 | Grasslands Soil | AATPIIGTFANLPDGSTFTVGPNTFQVNYEGGGDGNDLTLTVVP |
| Ga0210392_109923772 | 3300021475 | Soil | VTTFTDDANVTAGNNTFQSNYEGGDGNDLTLTVVP |
| Ga0207697_100546081 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | IVETFGNLPDGGTITVGSNTFQANYEGGDGNDLTLTVLP |
| Ga0207642_107770191 | 3300025899 | Miscanthus Rhizosphere | GTFANLPDGGTVTIGLNDFQANYEGGDGNDLTLAVVP |
| Ga0207642_109963211 | 3300025899 | Miscanthus Rhizosphere | NRAATPIAGTFSNIADGGTVTVGSNTFQANYEGGDGNDLTLTVVSN |
| Ga0207680_108893252 | 3300025903 | Switchgrass Rhizosphere | WTFSNLPDGSTITVGNNTFQANYEGGDGNDLTLTVVP |
| Ga0207645_103246752 | 3300025907 | Miscanthus Rhizosphere | NLPDGATVTVGVNTYQANYEGGDGNDLTLTVVRELRRRE |
| Ga0207649_113740782 | 3300025920 | Corn Rhizosphere | FSNLPDGSTITVGNNTFQANYEGGDGNDLTLTVVP |
| Ga0207646_115154762 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SVNPIAGTFDNLSDGAIITVNGNNLQASYEGGDGNDLTLTVVP |
| Ga0207681_115591931 | 3300025923 | Switchgrass Rhizosphere | AIVETFGNLPDGGTITVGSNTFQANYEGGDGNDLTLTVLP |
| Ga0207650_102986352 | 3300025925 | Switchgrass Rhizosphere | FSNLPDGGTITVGSNTYQANYEGGDGNDLTLTVVP |
| Ga0207650_110733651 | 3300025925 | Switchgrass Rhizosphere | RAIAGTFGNLPDGSTLTVGSNTFKANYGGGDGNDLTLTVVP |
| Ga0207659_104495502 | 3300025926 | Miscanthus Rhizosphere | INGTFDNLTDGGSITIGNNTFQANYEGGDGNDLTLTVIGN |
| Ga0207659_105739721 | 3300025926 | Miscanthus Rhizosphere | ITHRRRAIAGTFGNLPDGSTLTVGSNTFKANYGGGDGNDLTLTVVP |
| Ga0207659_106835951 | 3300025926 | Miscanthus Rhizosphere | ILGTFANLPDGGTIQIGNNTYQADYEGGDGNDLTLTVIP |
| Ga0207659_115796691 | 3300025926 | Miscanthus Rhizosphere | LNFPEGGKITSGRNTYQASYVGGDGNDMTLTVVTP |
| Ga0207687_109331311 | 3300025927 | Miscanthus Rhizosphere | IAGIFSNLPDGGTITVGNDTFQANYEGGDGNDLTLTVIQ |
| Ga0207700_118096541 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ANPIAGSFSNLQDGGIIKAGGNRLQASYEGGDGNDLTLTVVP |
| Ga0207701_103625552 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AATPIAGTFVNLSDGSAVTVGNNTFQANYEGGDGNDLTLTVIP |
| Ga0207701_106844972 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AATPIAGTFVNLSDGSAVTVGNNTFQANYEGGDGNDLTLTVVP |
| Ga0207701_106889821 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GTPINGSFSNLSDGGTVTIGNTTFQANYEGGDGNDLTLTVVNN |
| Ga0207701_116720032 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VVISNTSATPISGTFGNLADDATFKAGRNKFQADYEGGDGNDLTLTVVP |
| Ga0207644_105516862 | 3300025931 | Switchgrass Rhizosphere | NLPDGITFFERGNVIQASYEGGDGNDLTLTVLKSRDRN |
| Ga0207670_102029521 | 3300025936 | Switchgrass Rhizosphere | VETFSNLPDGGTITVGGNTFQANYEGGDGNDLTLTVLP |
| Ga0207670_111019392 | 3300025936 | Switchgrass Rhizosphere | GNLPDGGTISIGRNTYQANYEGGDGNDLTLTVVSN |
| Ga0207670_113401772 | 3300025936 | Switchgrass Rhizosphere | TAATPIAGTFGNLADGATVVVGNNTFQANYEGGDGNDLTLTVTQ |
| Ga0207669_102092223 | 3300025937 | Miscanthus Rhizosphere | LGTFGNLADGSIVTVRNNKFQVNYEGGDGNDLVLVSVR |
| Ga0207691_100220787 | 3300025940 | Miscanthus Rhizosphere | AGTFANLTDGATVVVGNNTFQANYEGGDGNDLTLTVQ |
| Ga0207689_116417821 | 3300025942 | Miscanthus Rhizosphere | AVTPISGTFSNLSDGGTILVGNNNTLQANYEGGDGNDLTLTVVP |
| Ga0207661_109256122 | 3300025944 | Corn Rhizosphere | TPISGAFANLPDGAMITIGSNKFQANYEGGDGNDLTLTVVSF |
| Ga0207651_102836551 | 3300025960 | Switchgrass Rhizosphere | GTFSNLPDGGIVNVNGNNLRASYSGGDGNDLTLEVVP |
| Ga0207651_104007161 | 3300025960 | Switchgrass Rhizosphere | FLACPGIHNLANGKIIAVNGNNLQASYKGGDGNDLTLTVVP |
| Ga0207658_100187061 | 3300025986 | Switchgrass Rhizosphere | AVAPIVGTFHNLANGKIIAVNGNSLQASYSGGDGNDLTLTVVP |
| Ga0207658_102873611 | 3300025986 | Switchgrass Rhizosphere | SATPISGTFVNLADGSTFTTGRNTFQANYESGDGNDLTLTVVTP |
| Ga0207658_103170761 | 3300025986 | Switchgrass Rhizosphere | INNTAATPISGVFANLADGATVIVGSNIFQANYEGGDGNDLTLTVVP |
| Ga0207658_109668901 | 3300025986 | Switchgrass Rhizosphere | AAILGTFANLPDGGTITIGSNTFQANYEGGDGNDLTLTVMP |
| Ga0207677_112625252 | 3300026023 | Miscanthus Rhizosphere | FANLTDGATVVVGNNTFQANYEDGDGNDLTLTVVP |
| Ga0207678_106578861 | 3300026067 | Corn Rhizosphere | GAFSNLPDGGTLTVGSNTFAADYGGGDGNDLTLTVVP |
| Ga0207648_102218961 | 3300026089 | Miscanthus Rhizosphere | TPIAGTFANLTDGATVVVGNNTFQANYEGGDGNDLTLTVQ |
| Ga0207648_102263462 | 3300026089 | Miscanthus Rhizosphere | PISGTFGNLADDATFKAGRNKFQADYEGGDGNDLTLTVVQ |
| Ga0207648_104337442 | 3300026089 | Miscanthus Rhizosphere | AGTFANLTDGATVVVGNNTFQANYEDGDGNDLTLTVVP |
| Ga0207648_108732831 | 3300026089 | Miscanthus Rhizosphere | IANLADGAVIPIWKANNYRVRYQGGDGNDLTLTVVP |
| Ga0207648_109713562 | 3300026089 | Miscanthus Rhizosphere | GHFSNLADGAIVTIGGAKFQANYEGGDGNDLTLTVIP |
| Ga0207676_106379011 | 3300026095 | Switchgrass Rhizosphere | TVFNAIDNTSVTTISGTFVNLADSSIFTVGSNTVQASYEGGDGNDLTLMVVP |
| Ga0207683_108731302 | 3300026121 | Miscanthus Rhizosphere | NGNFALLPDGGTISIGRNTYQANYEGGDGNDLTLTVVQ |
| Ga0207698_125092332 | 3300026142 | Corn Rhizosphere | MPIATAQGRTIRHASANPISGTFGNLGDGAIVNINGNNLQASYSGGDGNDLTLTVVP |
| Ga0209848_10650833 | 3300026221 | Permafrost Soil | MISNTAATAIGGNFANLADGAIISVNGINFQASYEGGDGNDL |
| Ga0209863_101649672 | 3300026281 | Prmafrost Soil | TATSPISGTFTNLADGATISVNGNNLQANYEGGDGNDLTLTVVQ |
| Ga0209155_11317181 | 3300026316 | Soil | NPISGTFSNLPDGGIVTINGNNLQANCEGGDGNDLTLTVVP |
| Ga0209804_11138891 | 3300026335 | Soil | TFANLADGAILSVGGNNLQASYEGGDGNDLTLTVVP |
| Ga0209057_10258754 | 3300026342 | Soil | GAFSNLPDGSTFTSNGNAYQVSYEGGDGNDLTLMVVP |
| Ga0209157_12871332 | 3300026537 | Soil | VGTFMNLPDGGTITADNNTFQADYEGGDGNDLTLTAIN |
| Ga0209474_107388862 | 3300026550 | Soil | GSSPIVGTFMNLPDGGTITAGNNTFQASYSGGDGNDLTLTVVP |
| Ga0209967_10644882 | 3300027364 | Arabidopsis Thaliana Rhizosphere | NIAANSIVGTFINLPGGSTFTVGSNTFQASYEGGDGNDLTLTVVP |
| Ga0207437_1014531 | 3300027431 | Soil | GTFANLADGTTFSSGGNTFKANYHGGNGNDLVLTVQ |
| Ga0209180_101697435 | 3300027846 | Vadose Zone Soil | LTVISDTAATPIAGTFTNLPDGAMFMQGRNTYQVSYEGGDGNDLTLTVLP |
| Ga0268266_106679432 | 3300028379 | Switchgrass Rhizosphere | PIGGAFANLPDGSIVVIGSNSYEVDYEGGDGNDLTLTVLP |
| Ga0268266_107197041 | 3300028379 | Switchgrass Rhizosphere | SFLNFPEGGKITSGRNTYQASYVGGDGNDMTLTVVTP |
| Ga0268264_117308821 | 3300028381 | Switchgrass Rhizosphere | AGTFSNLADGSTFNAGTNTFQVSYEGGDGNDLTLTVQ |
| Ga0307304_105781932 | 3300028885 | Soil | TFSNLPDGSTINVGGRNCQVSYSGGDGNDLTLTVVP |
| Ga0170834_1038461041 | 3300031057 | Forest Soil | TFSNLPDGATVNVNGNHLQASYEGFNGNDLTLTVVP |
| Ga0170824_1007774681 | 3300031231 | Forest Soil | TGIAGTFGNLPDGSTLMVGSNTFQANYEGGDGNDLTLTVVL |
| Ga0272434_13121872 | 3300031473 | Rock | TFVNLPDGSTFTSNDNTYQVNYKGGDGNDLTLTVVR |
| Ga0310886_103801052 | 3300031562 | Soil | TGTFHNLPEAAVLTVNGSKLQASYTGVDGNDLTLTVIP |
| Ga0308175_1003962891 | 3300031938 | Soil | TFSNLADGSTIAIGSNTYLVSYEGGDGNDLTLTVQ |
| Ga0310909_106910553 | 3300031947 | Soil | FSNLPDGSIITVGGKNCQVSYSGGDGNDLTLTVVP |
| Ga0308176_107509752 | 3300031996 | Soil | VIKNTAVTPISGTFSNLPNGAIVNGNNLQASYSGGDGNDLTLTVVP |
| Ga0306924_105462231 | 3300032076 | Soil | GGTFAKLPDGSIVTINGNNFQASYEGGDGNDLTLTVVP |
| ⦗Top⦘ |