


| Basic Information | |
|---|---|
| Family ID | F013529 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 270 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLALLIAYLIWK |
| Number of Associated Samples | 190 |
| Number of Associated Scaffolds | 270 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 7.46 % |
| % of genes near scaffold ends (potentially truncated) | 35.93 % |
| % of genes from short scaffolds (< 2000 bps) | 79.26 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (74.444 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (20.370 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.407 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.259 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 270 Family Scaffolds |
|---|---|---|
| PF05065 | Phage_capsid | 16.30 |
| PF13550 | Phage-tail_3 | 1.48 |
| PF11651 | P22_CoatProtein | 1.48 |
| PF05133 | Phage_prot_Gp6 | 1.11 |
| PF03237 | Terminase_6N | 0.74 |
| PF02794 | HlyC | 0.74 |
| PF11753 | DUF3310 | 0.37 |
| PF00149 | Metallophos | 0.37 |
| PF16786 | RecA_dep_nuc | 0.37 |
| PF02195 | ParBc | 0.37 |
| PF06147 | DUF968 | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 270 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 16.30 |
| COG2994 | ACP:hemolysin acyltransferase (hemolysin-activating protein) | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 74.44 % |
| All Organisms | root | All Organisms | 20.74 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 4.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 20.37% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 16.67% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.11% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.52% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.19% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.07% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.70% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.22% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.22% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 2.96% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.96% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.85% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.48% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.48% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 1.11% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.11% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.11% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.11% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.11% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.74% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.74% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.74% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.74% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.37% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.37% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.37% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.37% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.37% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.37% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.37% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.37% |
| Surface Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater | 0.37% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.37% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.37% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.37% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.37% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300000255 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_135 | Environmental | Open in IMG/M |
| 3300000256 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - ample_F_10_SI03_120 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001830 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3l | Environmental | Open in IMG/M |
| 3300001846 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300003476 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2 | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004110 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300004831 | Marine surface microbial communities from the North Atlantic Ocean - filtered matter | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006617 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ09 time point | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009757 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_205_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300016724 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011507AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020266 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951) | Environmental | Open in IMG/M |
| 3300020269 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041) | Environmental | Open in IMG/M |
| 3300020283 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556066-ERR599155) | Environmental | Open in IMG/M |
| 3300020314 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022825 | Saline water microbial communities from Ace Lake, Antarctica - #730 | Environmental | Open in IMG/M |
| 3300022842 | Saline water microbial communities from Ace Lake, Antarctica - #46 | Environmental | Open in IMG/M |
| 3300022843 | Saline water microbial communities from Ace Lake, Antarctica - #5 | Environmental | Open in IMG/M |
| 3300022857 | Saline water microbial communities from Ace Lake, Antarctica - #419 | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023229 | Saline water microbial communities from Ace Lake, Antarctica - #551 | Environmental | Open in IMG/M |
| 3300023230 | Saline water microbial communities from Ace Lake, Antarctica - #1692 | Environmental | Open in IMG/M |
| 3300023240 | Saline water microbial communities from Ace Lake, Antarctica - #870 | Environmental | Open in IMG/M |
| 3300023293 | Saline water microbial communities from Ace Lake, Antarctica - #1165 | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025513 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025707 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300029306 | Marine harbor viral communities from the Indian Ocean - SCH3 | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032255 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyrite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100606784 | 3300000101 | Marine | MNKWIWLNTKKKIKWIWIKAKNNPMYSIPLALLLIYLVWK* |
| DelMOSum2010_101466383 | 3300000101 | Marine | MNQIIIMKARKWSKWVWIKSKNNPMYSIPLALLIVYLIWN* |
| DelMOSum2010_101492542 | 3300000101 | Marine | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLIIAYLIWK* |
| DelMOSum2010_101859532 | 3300000101 | Marine | MNQLIKLKLKKWCKWVWIKAKNNPMYSIPLAVLIIYLLVK* |
| DelMOSpr2010_1000811812 | 3300000116 | Marine | MNQLIWLKSKKAVKWIWVKAKNNPMYSIPLAIVIIIILGS* |
| DelMOSpr2010_102325612 | 3300000116 | Marine | MNKWIWLKTKKKVKWIWVKAKNNPMYSIPLACLIIYLIWK* |
| DelMOSpr2010_102768152 | 3300000116 | Marine | MNQLIKLKLKKWCKWVWIKAKNNPMYSIPVAVLIIYLLVK* |
| DelMOWin2010_101193653 | 3300000117 | Marine | MNQWLWLKGKKKVKWIXIKAKTNPMYSXPLALLIVYLIWK* |
| DelMOWin2010_102074391 | 3300000117 | Marine | MNKWIWQKTKKKAKWIWVKAKNNPMYSIPLACLIVYLIWK* |
| DelMOWin2010_102108222 | 3300000117 | Marine | MNQLIKLKLKKWCKWIWVKAKNNPMYSIPLACLIIYLIWK* |
| LPaug09P1610mDRAFT_10091061 | 3300000149 | Marine | MNKWIWFKSKKKIKWIWVKAKNNPMYSIPLICLIAYLV |
| LP_F_10_SI03_135DRAFT_10521201 | 3300000255 | Marine | IMKAKKWSKLVWIKAKNNPMYSIPLVLVIAYLIWK* |
| LP_F_10_SI03_120DRAFT_10648702 | 3300000256 | Marine | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLALLIAYLIWK* |
| BBAY93_101345793 | 3300000973 | Macroalgal Surface | MNQIIWMKARKWAKWIWVKAKNNPMYSIPLVILIAWLIWK* |
| JGI20151J14362_101326362 | 3300001346 | Pelagic Marine | MNKWIIKQARKWSKWVWRKAVNNPMYSIPLVLIIAYLIWK* |
| JGI20151J14362_102044811 | 3300001346 | Pelagic Marine | NQWLWLKGKKKVKWIWIKAKTNPMYSIPLALLIVYLIWK* |
| JGI20160J14292_101601762 | 3300001349 | Pelagic Marine | MNKLIKLKLKKWCKWVWIKAKNNPMYSIPVAVLIIYLLVK* |
| JGI20158J14315_101951682 | 3300001355 | Pelagic Marine | MNQWIWLKGKKKVKWIWVKAKNNPMYSIPLACLIIYLIWN* |
| JGI24006J15134_100076507 | 3300001450 | Marine | MNQLIWLKSKKAVKWAWIKAKNNPMYSIPLAIIIIIILGS* |
| JGI24004J15324_101065152 | 3300001472 | Marine | MNKWIWLKTKKKIKWIWIKAKNNPMYSIPXXCLIAYLVWSN* |
| ACM40_10125512 | 3300001830 | Marine Plankton | MNQIILMKVKKWAKWTWVKAKNNPMYSIPLVVLIAWLIWK* |
| ACM22_10194971 | 3300001846 | Marine Plankton | KKERQGRKKMNQLIMMKAKKWSKWIWVKAKNNPMYSIPIVILIAWLIWK* |
| KVRMV2_1001617393 | 3300002231 | Marine Sediment | NKIIIMKAKKWSKWAWVKAKNNPMYSIPLVLIIAYLIWK* |
| KVRMV2_1016948962 | 3300002231 | Marine Sediment | MNQWIWKQTRKWTKWVWRKALNNPMYSIPVILIIAYLIWSN* |
| KVWGV2_100189833 | 3300002242 | Marine Sediment | MNKIIIMKAKKCSKWAWVKAKNNPMYSIPLVLIIAYLIWK* |
| JGI25128J35275_10026941 | 3300002488 | Marine | MNQWLWLKSKKKVKWIWVKAKNNPMYSIPLALLIVYLIWK* |
| NAP2_10339723 | 3300003476 | Estuarine | MNKIIIMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYFIWK |
| JGI26273J51734_101049823 | 3300003620 | Marine | MNKWIWLKAKKKIKWIWIKAKNNPMYSIPLVCLIAYLVWSN* |
| JGI26273J51734_101412312 | 3300003620 | Marine | MNQLIWLKSKKIAKWIWVKAKNNPMYSIPLAIIIIIILGS* |
| JGI26273J51734_101572201 | 3300003620 | Marine | MNQLIWLKSKKAVKWAWIKAKNNPMYSIPLAIVIIIILGS* |
| Ga0055584_1024776652 | 3300004097 | Pelagic Marine | MNKWIWKQTRKWSKWVWRKAINNPMYSIPIVLIIAYLIWK* |
| Ga0008648_100163904 | 3300004110 | Marine | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAYLIWK* |
| Ga0066605_103086932 | 3300004279 | Marine | MNQWIWLKGKKKVKWIWVKAKNNPMYSIPLALLIVYLIWK* |
| Ga0066222_12270212 | 3300004460 | Marine | MNQLIKLKLKKWTKKVWIKAKNNPMYSIPVAVLIIYLLVK* |
| Ga0066223_11312633 | 3300004461 | Marine | MNQLIWLKSKKAVKWAWIKAKNNPMYSIPLAIVIILSLIILVLERREK* |
| Ga0068515_1030123 | 3300004829 | Marine Water | MNKWIWLKSKKSAKWLWVKAKNNPMYSIPVIVVIIYLIVG* |
| Ga0068515_1054304 | 3300004829 | Marine Water | MNKMIMMKARKWIKWIWVKSKNNPMYSIPAVLIIAYLIWSN* |
| Ga0068515_1074552 | 3300004829 | Marine Water | MNEWIIFKIRKWSKWAWVKAKNNPMYSIPIAIVIIIILGS* |
| Ga0068515_1128782 | 3300004829 | Marine Water | MNEWILKQARKWSKWIWRKAINNPMYSIPLILIIAYLIWK* |
| Ga0068515_1129812 | 3300004829 | Marine Water | MNKIIKLKLKKWSKWVWIKAKNNPMYSVPLALLIIYLIWK* |
| Ga0068515_1204852 | 3300004829 | Marine Water | MNKWIWKQTRKWSKWVWVKAKNNPMYSIPLVLIIAYLIWSN* |
| Ga0068515_1219832 | 3300004829 | Marine Water | MNKWIWKQTRKWSKWVWVKAKNNPMYSIPLVLIIAYLIWK* |
| Ga0068515_1286412 | 3300004829 | Marine Water | MNKWILKQARKWTKWVWRKALNNPMYSIPLVLVIAYLIWSN* |
| Ga0069134_1646421 | 3300004831 | Surface Seawater | MNQWLWLKGKKKVKWIWIKAKNNPMYSIPLALFIVYLIWK* |
| Ga0068513_10037083 | 3300004951 | Marine Water | MNQWLWLKGKKKVKWIWIKAKTNPMYSIPLALLIVYLIWK* |
| Ga0068513_10238532 | 3300004951 | Marine Water | NQKKEKQGRKKMNQWIWKQTRKWTKWVWRKALNNPMYSIPVILIIAYLIWSN* |
| Ga0068513_10320301 | 3300004951 | Marine Water | RKKMNKWIWKQTRKWSKWVWVKAKNNPMYSIPLVLIIAYLIWSN* |
| Ga0066845_101517803 | 3300005432 | Marine | MNKWIWKKIRKTTKWIWVHAKENPMYSIPVVLIIAYLIWSN* |
| Ga0066825_102047602 | 3300005510 | Marine | MNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYLVWK* |
| Ga0066865_102566462 | 3300005523 | Marine | MNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIVAYFIWK* |
| Ga0075109_10287663 | 3300005912 | Saline Lake | MNKLIKLKLKKWCRWVWIKSKNNPMYSIPLAVLIIYLIWK* |
| Ga0075117_12251201 | 3300005914 | Saline Lake | MNQLIKLKLKKWCKWVWIKAKNNPMYSIPVAVLIIY |
| Ga0075119_10857142 | 3300005931 | Saline Lake | MNQLIKIKLKKWCKWIWIKAKNNPMYSIPVAVLIIYLLVK* |
| Ga0075478_100511703 | 3300006026 | Aqueous | MNKWIWKQTRKWSKWVWRKAVNNPMYSIPLVLIIAYLIWK* |
| Ga0075462_101615092 | 3300006027 | Aqueous | NQWLWLKGKKKVKWIWIKAKNNPMYSIPLALLIVYLIWK* |
| Ga0075486_10742773 | 3300006425 | Aqueous | MNKWILKQARKWSKWVWRKALNNPMYSIPLVLIIAYLIWK* |
| Ga0101443_10246814 | 3300006617 | Marine Surface Water | MNKWIWKQTRKWSKWVWRKALNNPMYSIPLLLIIAYLIWK* |
| Ga0098038_100615011 | 3300006735 | Marine | MNQWLWLKGKKKVKWIWIKAKNNPMYSIPLALLIIYLIGR* |
| Ga0098038_10575363 | 3300006735 | Marine | MNEWIIFKIRKWSKWVWVKAKNNPMYSIPIAIVIIIILGS* |
| Ga0098038_11259363 | 3300006735 | Marine | MNKIIMMKAKKWSKWAWVKAKNNPMYSIPLVLIIAYLIWK* |
| Ga0098038_11791832 | 3300006735 | Marine | MNKILIMKARKWSKWIWIKAKNNPMYSIPLALIIAYLVWK* |
| Ga0098038_12475821 | 3300006735 | Marine | KQERKKMNEWIWRQIRKKSKWVWIKAKNNPMYSIPLVLIIAYLIWSN* |
| Ga0098038_12506172 | 3300006735 | Marine | MNKWIYKKARKWTKWVWIKSKNNPMYSIPLALLIVYLIWK* |
| Ga0098037_11621463 | 3300006737 | Marine | MNKWMWKKIRKTTKWIWVHAKENPMYSIPVVLIIAYLIWK* |
| Ga0098037_12538372 | 3300006737 | Marine | MNQWLWLKGKKKVKWIWIKAKNNPMYSIPLVLLIAYLIWK* |
| Ga0098037_13047531 | 3300006737 | Marine | MNQWLWLKGKKKVKWIWIKAKANPMYSIPLALLIVYLIWK* |
| Ga0098042_10665733 | 3300006749 | Marine | MNKIIIMKARKWSKWVWVKAKNNPMYSIPLVLIIAYLVWK* |
| Ga0098042_11205452 | 3300006749 | Marine | MNKIIIMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYLVWK* |
| Ga0098042_11612161 | 3300006749 | Marine | NEKQGRKKMNKWIWKQTRKWSKWVWRKAVSNPMYSIPLVLIIAYLIWK* |
| Ga0098055_13678031 | 3300006793 | Marine | KRKEKQGRKKMNKWIWKQTRKWSKWIWRKAVSNPMYSIPLVLIIAYLIWK* |
| Ga0070749_102482803 | 3300006802 | Aqueous | MNQLIKLKLKKWSKWVWIKSKNNPMYSIPLAVLIIY |
| Ga0070749_103746862 | 3300006802 | Aqueous | MNQWLWLKGKKKVKWIWIKAKNNPMYSIPLALLIVYLIWK* |
| Ga0070749_103997561 | 3300006802 | Aqueous | QERKKMNKWIWLKTKKKVKWIWVKSKNNPMYSIPLACLIIYLIWK* |
| Ga0070749_105413732 | 3300006802 | Aqueous | MNKWLWLKGKKKVKWIWIKAKANPMYSIPLALLIVYLIWK* |
| Ga0070749_106694621 | 3300006802 | Aqueous | NKEKKMNQWLWLKGKKKVKWIWIKAKTNPMYSIPLALLIVYLIWK* |
| Ga0070754_102796203 | 3300006810 | Aqueous | MNKKIIMKAKKWSKWVWIKAKNNPMYSIPLVLIIAYLIWK* |
| Ga0075476_103168151 | 3300006867 | Aqueous | KKMNKWIWLKTKKKVKWIWVKAKTNPMYSIPLACLVVYLIWK* |
| Ga0075477_103848781 | 3300006869 | Aqueous | NEQGRKKMNKWIWLKTKKKVKWIWVKAKTNPMYSIPLACLVVYLIWK* |
| Ga0070750_101543783 | 3300006916 | Aqueous | MNQLIKLKLKKWSKWVWIKSKNNPMYSIPLAVLIIYLI |
| Ga0070750_103383871 | 3300006916 | Aqueous | QNEQGRKKMNKWIWQKTKKKAKWIWVKAKNNPMYSIPLACLIVYLIWK* |
| Ga0098060_10267704 | 3300006921 | Marine | MNKILIMKARKWSKWIWIKAKNNPMYSIPLVLIIAYLVWK* |
| Ga0098060_11655771 | 3300006921 | Marine | MNKIIMMKARKWTKWVWVKAKNNPMYSIPLALLIAY |
| Ga0098060_12188161 | 3300006921 | Marine | ERKKMNKIIMMKARKWTKWVWVKAKNNPMYSIPLALLIAYLIWK* |
| Ga0098036_11555581 | 3300006929 | Marine | MNKIIIMKAKKWSKWVWVKAKNNPMYSIPLVLILAYFIWK* |
| Ga0075463_100434994 | 3300007236 | Aqueous | KEMNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAYLIWK* |
| Ga0099851_10729782 | 3300007538 | Aqueous | MNKWLWLKGKKKVKWIWIKAKTNPMYSIPLALLIVYLIWK* |
| Ga0105744_11414222 | 3300007863 | Estuary Water | MNQWIWLKGKKKVKWIWVKAKNNPIYSIPLALLIVYLIWK* |
| Ga0105748_100071732 | 3300007992 | Estuary Water | MNQLIKFKLKKWSKWVWIKSKNNPMYSIPVAILIIYLIWK* |
| Ga0115566_107755601 | 3300009071 | Pelagic Marine | KQERKKMNQLIKLKLKKWCKWIWVKAKNNPMYSIPLACLIIYLIWK* |
| Ga0114918_105154281 | 3300009149 | Deep Subsurface | QNEQGRKKMNKWIWLKTKKKVKWIWVKAKNNPMYSIPLACLIVYLIWK* |
| Ga0115546_10886783 | 3300009435 | Pelagic Marine | KENKMNQWIWLKGKKKVKWIWVKAKNNLMYSIPLALLIVYLIWK* |
| Ga0115553_11540031 | 3300009445 | Pelagic Marine | MNKIIIMKAKKWSKWVWIKAKNNPMYSTPLVLVIAYLIWM* |
| Ga0115553_11609581 | 3300009445 | Pelagic Marine | EKKNKEKEMNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAYLIWK* |
| Ga0115565_102611673 | 3300009467 | Pelagic Marine | WKQTRKWSKWVWRKAVNNPMYSIPLVLIIAYLIWK* |
| Ga0115554_10397976 | 3300009472 | Pelagic Marine | MNKLIKLKLKKWCKWVWIKAKNNPMYSIPLALLLIYLVWK* |
| Ga0115555_12168921 | 3300009476 | Pelagic Marine | VKKGRKMNQLIWLKSKKIAKWVWIKSKNNPMYSIPLALIIIYLIGR* |
| Ga0114932_103260942 | 3300009481 | Deep Subsurface | MNKIIIMKAKKWSKWVWVKAKNNPMYSIPLVLIVAYFIWK* |
| Ga0115003_101786244 | 3300009512 | Marine | NQLIKLKLKKWCKWVWIKAKNNPMYSIPVAVLIIYLLVK* |
| Ga0115011_115162762 | 3300009593 | Marine | MNKIIMMKARKWSKWVWVKAKNNPMYSIPLVLIIAYLIWK* |
| Ga0114906_10526472 | 3300009605 | Deep Ocean | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLIIAYLVWK* |
| Ga0114933_103498662 | 3300009703 | Deep Subsurface | MNKIIIMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYFIWK* |
| Ga0123367_11402303 | 3300009757 | Marine | MNQWIWLKSKKAVKWIWVKAKNNPMYSIPVAVLIIYLIVG* |
| Ga0115012_114902121 | 3300009790 | Marine | EENMNKWIWKKIRKTTKWIWVHAKENPMYSIPVVLIIAYLIWSN* |
| Ga0098043_10405273 | 3300010148 | Marine | MNEWIIFKIRKWSKWVWVKAKNNPMYSIPIAILIIIILGS* |
| Ga0098043_11102502 | 3300010148 | Marine | MNKIIIMKAKKWSKWVWVKSKNNPMYSIPLVLIIAYLVWK* |
| Ga0098043_11416041 | 3300010148 | Marine | MNQWLWLKSKKKIKWIWIKAKNNPMYSIPLALLIVYLIWK* |
| Ga0098043_11954492 | 3300010148 | Marine | MNQWIWKKIRKNIKWLWVKSKNNPMYSIPVVLIIAYLIWSN* |
| Ga0098059_11096063 | 3300010153 | Marine | MNQWLWLKSKKKVKWIWIKAKNNPMYSIPLALLIVYLIWK* |
| Ga0098059_11718862 | 3300010153 | Marine | MNKIIMMKARKWTKWVWVKAKNNPMYSIPLALLIAYLIWK* |
| Ga0098059_12541922 | 3300010153 | Marine | MNKIIIMKAKKWSKWVWIKSKNNPMYSIPLALLIAYLIWK* |
| Ga0151675_10050914 | 3300011254 | Marine | MNKWIIKQARKWSKWVWRKAINNPMYSIPLVLVIA |
| Ga0160423_100113403 | 3300012920 | Surface Seawater | MNELIMLKARKWSKWVWVKAKNNPMYSIPIAIIIIILLGS* |
| Ga0160423_101586004 | 3300012920 | Surface Seawater | MNEWIIFKIRKWSKWVWVKSKNNPMYSIPIAILIIIILGS* |
| Ga0160423_102950843 | 3300012920 | Surface Seawater | MNKWIWKKVRKTTKWIWVNSKENPMYSIPVVLIIAYLIWK* |
| Ga0160423_102989133 | 3300012920 | Surface Seawater | MNKIIMMKAKKWSKWVWVKGKNNPMYSIPLVLIIAYLVWK* |
| Ga0160423_103888661 | 3300012920 | Surface Seawater | MNQLIWFKARKWTKWVWVKAKNNPMYSIPAVIVIAWLIWK* |
| Ga0163179_105834723 | 3300012953 | Seawater | MNQWIWKKIRKNIKWLWVKSKNNPMYSIPVVLIIAYLIW |
| Ga0163111_105592953 | 3300012954 | Surface Seawater | MNKFIMMKAKKWSKWVWVKAKNNPMYSIPLVLIVAYVIWK* |
| Ga0129327_103232451 | 3300013010 | Freshwater To Marine Saline Gradient | KEMNQWLWLKGKKKVKWIWIKAKNNPMYSIPLALLIVYLIWK* |
| Ga0182048_10694231 | 3300016724 | Salt Marsh | KKMNKWIWKQTRKWSKWVWRKAVSNPMYSIPLVLIIAYLIWK |
| Ga0180120_102628181 | 3300017697 | Freshwater To Marine Saline Gradient | QERKKMNKWIWLKTKKKVKWIWVKAKNNPMYSIPLACLIIYIIWK |
| Ga0180120_104496101 | 3300017697 | Freshwater To Marine Saline Gradient | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLIIAYLIWK |
| Ga0181377_10152764 | 3300017706 | Marine | MNQWLWLKSKKKVKWIWIKAKNNPMYSIPLALLIVYLIWK |
| Ga0181403_11167862 | 3300017710 | Seawater | RKKMNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAYLIWK |
| Ga0181391_11016263 | 3300017713 | Seawater | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLALVIAYLIWK |
| Ga0181412_10063585 | 3300017714 | Seawater | MNQLIWLKSKKIAKWIWVKAKNNPMYSIPLAIVIIIILGS |
| Ga0181412_10154487 | 3300017714 | Seawater | MNKWIWKQTRKWSKWVWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0181412_10205654 | 3300017714 | Seawater | MNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0181383_10001182 | 3300017720 | Seawater | MNQWLWLKGKKKVKWIWIKAKANPMYSIPLALLIVYLIWK |
| Ga0181373_10318113 | 3300017721 | Marine | MNEWIWRQIRKKSKWVWIKAKNNPMYSIPLVLIIAYLIWS |
| Ga0181398_10048772 | 3300017725 | Seawater | MNQWLWLKSKKKVKWIWVKAKNNPMYSIPLALLIVYLIWK |
| Ga0181381_10253014 | 3300017726 | Seawater | KKNKEKEMNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYLVWK |
| Ga0181381_10812812 | 3300017726 | Seawater | MNKIIIMKAKKWSKWVWIKAKNNTMYSIPLVLVIAYLIWK |
| Ga0181417_100088114 | 3300017730 | Seawater | MHQWLWLKGKKKVKWIWIKAKANPMYSIPLALLIVYLIWK |
| Ga0181417_10205762 | 3300017730 | Seawater | MNEWIIFKIRKWSKWVWIKAKNNPMYSIPIAIVIIILLGS |
| Ga0181416_10225724 | 3300017731 | Seawater | MNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYL |
| Ga0181416_10382361 | 3300017731 | Seawater | KEKEMNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYLVWK |
| Ga0181416_10765971 | 3300017731 | Seawater | KEKEMNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0181426_10957731 | 3300017733 | Seawater | WLKGKKKVKWIWIKAKNNPMYSIPLALLIVYLIWK |
| Ga0187222_10258984 | 3300017734 | Seawater | IMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYLVWK |
| Ga0187222_10259174 | 3300017734 | Seawater | MNQWIWKKFRKNIKWLWVKSKNNPMYSIPVVLIIAYLIWSN |
| Ga0181431_11380662 | 3300017735 | Seawater | EKEMNKIIMMKAKKWSKLVWVKAKNNPMYSIPLVLIIAYLVWK |
| Ga0187218_11636172 | 3300017737 | Seawater | MMNKIIIMKAKKWSKWVWIKAKNNPMYSIPLALVIAYLIWK |
| Ga0181428_10184152 | 3300017738 | Seawater | MNQLIWLKSKKIAKWIWVKAKNNPMYSIPIAIVIIIILGS |
| Ga0181418_11499061 | 3300017740 | Seawater | MNEWIYKKARKWTKWVWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0181418_11817173 | 3300017740 | Seawater | MNKLIKLKVRKWSKWVWIKSKNNPMYSIPLALLIIYLIW |
| Ga0181402_11305882 | 3300017743 | Seawater | WLKSKKKVKWIWVKAKNNPMYSIPLALLIVYLIWK |
| Ga0181397_11953282 | 3300017744 | Seawater | MNKIIIMKAKKWSKWVWIKSKNNPMYSIPLALFIVYLIWK |
| Ga0181427_11382313 | 3300017745 | Seawater | MNKIIMMKAKKWSKLVWVKAKNNPMYSIPLVLIIAYLIW |
| Ga0181427_11456292 | 3300017745 | Seawater | WLKGKKKIKWIWIKAKANPMYSIPLALLIVYLIWK |
| Ga0181392_12068321 | 3300017749 | Seawater | QRRKKMNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLLIAYLIWK |
| Ga0181392_12421322 | 3300017749 | Seawater | EKQGRKKMNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLIIAYLIWK |
| Ga0181405_10184862 | 3300017750 | Seawater | MNEWIIFKIRKWSKWVWVKSKNNPMYSIPIAIVIIIILGS |
| Ga0181405_10189951 | 3300017750 | Seawater | QRRKKMNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAYLIWK |
| Ga0181400_11122722 | 3300017752 | Seawater | MNQWLWLKSKKKVKWIWVKAKNNPMYSIPLSLLIVYLIWK |
| Ga0181400_11513752 | 3300017752 | Seawater | IKLKVKKWSKWVWIKAKNNPMYSIPLALLIIYFMWK |
| Ga0181407_10578183 | 3300017753 | Seawater | MNEWIIFKIRKWSKWVWVKSKNNPMYSIPIAILIIILLGS |
| Ga0181407_11859651 | 3300017753 | Seawater | RKMNQLIWLKSKKIAKWIWVKAKNNPMYSIPLAIVIIIILGS |
| Ga0181382_10206405 | 3300017756 | Seawater | MNQLIWLKSRKIAKWVWIKSKNNPMYSIPLALIII |
| Ga0181382_11615631 | 3300017756 | Seawater | KKGRKMNQLIWLKSRKIAKWVWIKSKNNPMYSIPLALIIIYLIGR |
| Ga0181420_11205471 | 3300017757 | Seawater | IIMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0181420_11397121 | 3300017757 | Seawater | MNQWLWLKSKKKVKWIWGKAKNNTMYSIPLSLLIVYL |
| Ga0181409_12347592 | 3300017758 | Seawater | LLKRKEKQGRKKMNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAYLIWK |
| Ga0181422_10235696 | 3300017762 | Seawater | MNEWIYKKARKWTKWVWIKSKNNPMYSIPLVLLIAYLIWK |
| Ga0181385_11519142 | 3300017764 | Seawater | MNQIIIMKARKWSKWVWIKAKNNPMYSIPLALLIVYLIWK |
| Ga0181413_10322994 | 3300017765 | Seawater | MNKIIIMKAKKWSKWIWIKAKNNPMYSIPLVLVIAYLIWK |
| Ga0181413_12617233 | 3300017765 | Seawater | MNKIIIMKAKKWSKWVWIKAKNNPMYSITLVLVIAYL |
| Ga0187220_11987042 | 3300017768 | Seawater | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLLIAYLIWK |
| Ga0187221_10036721 | 3300017769 | Seawater | EKEMNKIIMMKAKKWSKLVWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0181394_11916901 | 3300017776 | Seawater | KEMNQWLWLKSKKKVKWIWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0181395_10430214 | 3300017779 | Seawater | MNQLIWLKSKKIAKWIWVKAKNNPMYSIPLALIIIYLIGR |
| Ga0181380_10545951 | 3300017782 | Seawater | IIFKIRKWSKWVWVKSKNNPMYSIPIAIIIIIILGS |
| Ga0181380_11967173 | 3300017782 | Seawater | MNQWLWLKGKKKIKWIWIKAKNNPMYSIPLALLIVYLIWK |
| Ga0181380_12399571 | 3300017782 | Seawater | QERKKMNQLIKLKLKKWSKWVWIKSKNNPMYSIPLAILIIYLIWN |
| Ga0181424_100580924 | 3300017786 | Seawater | MNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIRAYLVWK |
| Ga0181424_104639131 | 3300017786 | Seawater | RRKKMNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAYLIWK |
| Ga0181577_101216902 | 3300017951 | Salt Marsh | MNQWIFKKIRKWSKWVWRKAIANPMYSIPVVLIIAYLIWSN |
| Ga0181585_101005784 | 3300017969 | Salt Marsh | MNKWIWKQTRKWSKWVWRKAVSNPMYSIPLVLIIAYLIWK |
| Ga0181553_101022873 | 3300018416 | Salt Marsh | MNQWIWLKSKKAVKWLWVKAKNNPMYSIPVATIIIYLIVG |
| Ga0181553_105219831 | 3300018416 | Salt Marsh | MNQWIFKKIRKRSKWVWRKAIANPMYSIPVIVIIAYLILR |
| Ga0181563_100955592 | 3300018420 | Salt Marsh | MNQWIWKQTRKWTKWVWRKALNNPMYSIPVILIIAYLIWSN |
| Ga0181591_102249043 | 3300018424 | Salt Marsh | MNEWIIFKIRKWSKWVWVKAKNNPMYSIPIAIVIIIILGS |
| Ga0181568_100443347 | 3300018428 | Salt Marsh | MNQWIFKKIRKWSKWVWRKAIANPMYSIPVIVIIAYLILR |
| Ga0194032_10029494 | 3300019938 | Freshwater | MNQIIIMKARKWSKWVWIKSKNNPMYSIPLALLIVYLIWN |
| Ga0181595_100070323 | 3300020053 | Salt Marsh | MNKWILKQARKWSKWVWRKALNNPMYSIPLVLIIAYLIWK |
| Ga0181602_103283351 | 3300020173 | Salt Marsh | MNKWIWLKTKKKVKWIWVKAKTNPMYSIPLACLIVY |
| Ga0181599_10659402 | 3300020178 | Salt Marsh | MNKWIWKQTRKWSKWVWRKAVNNPMYSIPLVLIIAYLIWK |
| Ga0194115_1000173453 | 3300020183 | Freshwater Lake | MNQYLIFKLKKWKKYIWIKAKNNPFYSIPLICLLIYLIFF |
| Ga0211519_10040472 | 3300020266 | Marine | MNKWIWLKTKKKIKWIWIKAKNNPMYSIPVICLIAYLVWSN |
| Ga0211484_10099274 | 3300020269 | Marine | MNKFIMMKAKKWSKWVWVKAKNNPMYSIPLVLIVAYFIWK |
| Ga0211482_10320332 | 3300020283 | Marine | KEKEMNKFIMMKAKKWSKWVWVKAKNNPMYSIPLVLIVAYFIWK |
| Ga0211522_10051723 | 3300020314 | Marine | MNKIIMMKAKKWSKWVWVKAKNNPMYSIPLALIVAYFIWKYYG |
| Ga0211477_101681732 | 3300020374 | Marine | MNKIIIMKAKKWSKWVWVKAKNNPMYSIPLVLIVAYFIWK |
| Ga0211477_102832312 | 3300020374 | Marine | MNQWLWLKGKKKVKWIWIKAKNNPMYSIPLALLIVYLIWK |
| Ga0211472_104459862 | 3300020409 | Marine | ERKKMNELIWRQIRKKSKWVWVKAKNNPMYSIPVVLIIAYLIWSN |
| Ga0211699_101478583 | 3300020410 | Marine | MNEIIIFKIRKWSKWVWVKAKNNPMYSIPLAILIIILIGS |
| Ga0211512_100803714 | 3300020419 | Marine | MNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYFIWK |
| Ga0211558_100989403 | 3300020439 | Marine | MNEIIWRQIRKKSKWVWVKAKNNPMYSIPVVIIIAYLIWSS |
| Ga0211518_100361493 | 3300020440 | Marine | MNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYLVWK |
| Ga0211641_102179052 | 3300020450 | Marine | MNKIIMMKVKKWSKWVWVKGKNNPMYSIPLVLIIAYLVWK |
| Ga0211545_105124202 | 3300020452 | Marine | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAYLIWK |
| Ga0211514_103729952 | 3300020459 | Marine | MNQWLWLKSKKKIKWIWIKAKNNPMYSIPLVLLIVYLIWK |
| Ga0211676_103204611 | 3300020463 | Marine | MNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIIAYLVW |
| Ga0213858_103172953 | 3300021356 | Seawater | EMNQWLWLKGKKKVKWIWIKAKNNPMYSIPLALLIVYLIWK |
| Ga0213860_100013332 | 3300021368 | Seawater | MNKWIWKQTRKWSKWVWIKGKNNPMYSIPLVLIIAYLIWK |
| Ga0213863_100191812 | 3300021371 | Seawater | MNQLIKFKLKKWSKWVWIKSKNNPMYSIPLAILIIYLIWK |
| Ga0222716_102206203 | 3300021959 | Estuarine Water | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLALLIAYLIWK |
| Ga0222714_100843802 | 3300021961 | Estuarine Water | MNKWIWLKTKKKIKWVWVKAKNNPMYSIPLVCLAIYLIWSNNG |
| Ga0196883_10013792 | 3300022050 | Aqueous | MNKWIWQKTKKKAKWIWVKAKNNPMYSIPLACLIVYLIWK |
| Ga0212024_10073254 | 3300022065 | Aqueous | MNQLIWLKSKKIAKWVWIKSKNNPMYSIPLALIIIYLIGR |
| Ga0212024_10122383 | 3300022065 | Aqueous | MNKIIKLKLKKWSKWVWIKSKNNPMYSIPLALLIIYLIWK |
| Ga0212021_10883512 | 3300022068 | Aqueous | MNKWIWQKTKKKAKWIWVKAKNNPMYSIPLACLIIYLIWK |
| Ga0224906_100032520 | 3300022074 | Seawater | MNKWIWKQTRKWSKWVWRKSINNPMYSIPLICLIAYLVWSN |
| Ga0224906_10115934 | 3300022074 | Seawater | MNKIIMMKAKKWSKLVWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0224906_10132174 | 3300022074 | Seawater | MNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIVAYFIWK |
| Ga0196903_10406401 | 3300022169 | Aqueous | GRKMNQLIWLKSKKIAKWVWIKSKNNPMYSIPLALIIIYLIGR |
| Ga0212031_10923802 | 3300022176 | Aqueous | LNQNEQGRKKMNKWIWQKTKKKAKWIWVKAKNNPMYSIPLACLIVYLIWK |
| Ga0196891_10170743 | 3300022183 | Aqueous | MNKWLWLKGKKKVKWIWIKAKANPMYSIPLALLIVYLIWK |
| Ga0196901_10316684 | 3300022200 | Aqueous | MNKWIWLKTKKKVKWIWVKAKTNPMYSIPLACLIVYLIWK |
| Ga0222669_100087514 | 3300022825 | Saline Water | MNKWIWLKTKKKIKWVWIKAKTNPMYSIPLALLIFYIVWK |
| Ga0222632_100045231 | 3300022842 | Saline Water | MNQLIKLKLKKWCKWVWIKAKNNPMYSIPVAVLIIYLLVK |
| Ga0222631_10348952 | 3300022843 | Saline Water | KKMNQLIKLKLKKWCKWVWIKAKNNPMYSIPVAVLIIYLLVK |
| Ga0222653_10648553 | 3300022857 | Saline Water | MNQLIKLKLKKWCKWVWIKAKNNPMYSIPVAVLIIYLL |
| Ga0255781_1000039128 | 3300022934 | Salt Marsh | MNQLILMKARKWSKWVWRKAYNNPMYSIPLLLIIAYLVWK |
| Ga0255774_103449931 | 3300023087 | Salt Marsh | NQLILMKARKWSKWVWRKAYNNPMYSIPLLLIIAYLVWK |
| Ga0255751_102253093 | 3300023116 | Salt Marsh | RKEKQGRKKMNKWIWKQTRKWSKWVWRKAVSNPMYSIPLVLIIAYLIWK |
| Ga0222661_10048161 | 3300023229 | Saline Water | NQLIKLKLKKWTKKVWIKAKNNPMYSIPVAVLIIYLLVK |
| Ga0222709_10106391 | 3300023230 | Saline Water | KQRRKKMNQLIKLKLKKWCKWVWIKAKNNPMYSIPVAVLIIYLLVK |
| Ga0222676_10397683 | 3300023240 | Saline Water | KKMNQLIKLKLKKWTKKVWIKAKNNPMYSIPVAVLIIYLLVK |
| Ga0222688_10326462 | 3300023293 | Saline Water | KQGRKKMNKWIWLKTKKKIKWVWIKAKTNPMYSIPVAVLIIYLLVK |
| (restricted) Ga0233444_100439745 | 3300024264 | Seawater | MNQLIWLKSKKAVKWAWIKAKNNPMYSIPLAIVIIIILGS |
| Ga0209992_102245983 | 3300024344 | Deep Subsurface | MNQWIWLKSKKAVKWLWVKAKNNPMYSIPVAVLIIYLIVG |
| Ga0209992_104337462 | 3300024344 | Deep Subsurface | GKKKMNQLIWKKIRKWSKWVWRKSIANPMYSIPVIVIIAYLIWSING |
| Ga0208667_10217442 | 3300025070 | Marine | MNQWLWLKGKKKVKWIWIKAKNNPMYSIPLALFIVYLIWK |
| Ga0208298_10196454 | 3300025084 | Marine | MNKIIMMKARKWTKWVWVKAKNNPMYSIPLALLIAYLIWK |
| Ga0208666_10308251 | 3300025102 | Marine | KKNKEKEMNKIIMMKAKKWSKWVWVKAKNNPMYSIPLVLIVAYFIWK |
| Ga0208666_11427161 | 3300025102 | Marine | LNQKNVKQERKKMNEWIWRQIRKKSKWVWIKAKNNPMYSIPLVLIIAYLIWSN |
| Ga0208793_10721392 | 3300025108 | Marine | MNKIIMMKARKWTKWVWVKAKNNPMYSIPLALFIVYLIWK |
| Ga0209535_100059742 | 3300025120 | Marine | MNKWIWFKSKKKIKWIWVKAKNNPMYSIPLICLIAYLVWSN |
| Ga0209232_10659703 | 3300025132 | Marine | MNEWIIFKIRKWSKWVWVKSKNNPMYSIPIAIIIIIILGS |
| Ga0209336_100228792 | 3300025137 | Marine | MNKWIWLKAKKKIKWIWIKAKNNPMYSIPLVCLIAYLVWSN |
| Ga0209337_10382254 | 3300025168 | Marine | MNQLIWLKSKKAVKWAWIKAKNNPMYSIPLAIIIIIILGS |
| Ga0208030_11348201 | 3300025282 | Deep Ocean | LKRKEKQGRKKMNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLIIAYLVWK |
| Ga0208413_10754363 | 3300025513 | Saline Lake | MNKLIKLKLKKWCRWVWIKSKNNPMYSIPLAVLIIYL |
| Ga0208303_10464461 | 3300025543 | Aqueous | MNKWIWKQTRKWSKWVWRKAVNNPMYSIPLVLIIAYLI |
| Ga0209194_100091034 | 3300025632 | Pelagic Marine | MNKWIIKQTRKWSKWVWRKSINNPMYSIPLVLIIAYLIWK |
| Ga0209194_10246734 | 3300025632 | Pelagic Marine | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAYLIW |
| Ga0208160_10024292 | 3300025647 | Aqueous | MNKWIWLKMKKKIKWVWVKAKNNPMYSIPLAFLIVYLIWN |
| Ga0209601_100036167 | 3300025666 | Pelagic Marine | MNQWIWLKGKKKVKWIWVKAKNNPMYSIPLALLIVYLIWK |
| Ga0208898_100534912 | 3300025671 | Aqueous | MNKWIWLKTKKKIKWIWVKAKNNPMYSIPLLCLIIYLIWSNNG |
| Ga0209667_10552892 | 3300025707 | Marine | MNKIIIMKAKKWSKLVWIKAKNNPMYSIPLVLVIAYLIWK |
| Ga0208899_12587661 | 3300025759 | Aqueous | LIKLKLKKWSKWVWIKSKNNPMYSIPLAVLIIYLIWN |
| Ga0208645_10432821 | 3300025853 | Aqueous | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAYL |
| Ga0208645_10696753 | 3300025853 | Aqueous | MNKWIWKQARKWTKWVWRKAVNNPMYSIPLVLIIAYLIWK |
| Ga0209309_103890782 | 3300025881 | Pelagic Marine | MNQWIWLKGKKKVKWIWVKAKNNPMYSIPLACLIIYLIWN |
| Ga0209632_104665421 | 3300025886 | Pelagic Marine | MNQLIWLKSKKIAKWVWIKSKNNPMYSIPLALIIIYLI |
| Ga0208644_11221542 | 3300025889 | Aqueous | MNKWIWLKSKKSAKWLWVKAKNNPMYSIPVIVVIIYLIVG |
| Ga0135212_10279622 | 3300029306 | Marine Harbor | MNQWIWKQTRKWAKWVWVKAKNNPMYSIPVVLIIAYLIWSN |
| Ga0183683_100022858 | 3300029309 | Marine | MNKIIMMKAKKWSKWAWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0183683_100027443 | 3300029309 | Marine | MNKWIWKQTRRWSKWVWRKSINNPMYSVPIVLIIAFLIWK |
| Ga0183683_10002796 | 3300029309 | Marine | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLILIIAYLMWK |
| Ga0183683_10306062 | 3300029309 | Marine | MNKIIMMKARKWSKWVWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0183755_10090932 | 3300029448 | Marine | MNKIIIMKAKKWSKWAWVKAKNNPMYSIPLVLIIAYLIWK |
| Ga0183755_10202822 | 3300029448 | Marine | MNQWIWLKSKKAVKWIWVKAKNNPMYSIPVAVLIIYLIVG |
| Ga0183755_10246283 | 3300029448 | Marine | MNKIIMMKAKKWSKLVWVKAKNNPMYSIPLVLIVAYFIWK |
| Ga0307380_112365562 | 3300031539 | Soil | IQERKKMNKWIWLKTKKKVKWIWVKSKNNPMYSIPLACLIIYLIWK |
| Ga0307378_110947993 | 3300031566 | Soil | MNQLIKLKLKKWSKKVWIKAKNNPMYSIPLVVLIIYIIWK |
| Ga0315320_107288861 | 3300031851 | Seawater | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLVIAY |
| Ga0316209_10444824 | 3300032255 | Microbial Mat | MNKIIIMKAKKWSKWVWIKAKNNPMYSIPLVLIIAY |
| Ga0314858_109550_2_124 | 3300033742 | Sea-Ice Brine | MNQLIWLKSKKAVKWAWIKAKNNPMYSIPLAIIIIIILGSP |
| ⦗Top⦘ |