


| Basic Information | |
|---|---|
| Family ID | F012917 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 276 |
| Average Sequence Length | 46 residues |
| Representative Sequence | GMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Number of Associated Samples | 239 |
| Number of Associated Scaffolds | 275 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.81 % |
| % of genes near scaffold ends (potentially truncated) | 93.12 % |
| % of genes from short scaffolds (< 2000 bps) | 88.77 % |
| Associated GOLD sequencing projects | 221 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (49.638 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (18.478 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.928 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (71.739 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.58% β-sheet: 0.00% Coil/Unstructured: 53.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 275 Family Scaffolds |
|---|---|---|
| PF00410 | Ribosomal_S8 | 62.18 |
| PF00347 | Ribosomal_L6 | 20.73 |
| PF00861 | Ribosomal_L18p | 9.45 |
| PF03719 | Ribosomal_S5_C | 1.45 |
| PF00673 | Ribosomal_L5_C | 1.09 |
| PF00238 | Ribosomal_L14 | 0.73 |
| PF00333 | Ribosomal_S5 | 0.73 |
| PF00344 | SecY | 0.73 |
| PF00411 | Ribosomal_S11 | 0.36 |
| PF03118 | RNA_pol_A_CTD | 0.36 |
| PF00416 | Ribosomal_S13 | 0.36 |
| PF17136 | ribosomal_L24 | 0.36 |
| PF00237 | Ribosomal_L22 | 0.36 |
| PF01250 | Ribosomal_S6 | 0.36 |
| PF04389 | Peptidase_M28 | 0.36 |
| PF00366 | Ribosomal_S17 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 275 Family Scaffolds |
|---|---|---|---|
| COG0096 | Ribosomal protein S8 | Translation, ribosomal structure and biogenesis [J] | 62.18 |
| COG0097 | Ribosomal protein L6P/L9E | Translation, ribosomal structure and biogenesis [J] | 20.73 |
| COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 9.45 |
| COG0098 | Ribosomal protein S5 | Translation, ribosomal structure and biogenesis [J] | 2.18 |
| COG0094 | Ribosomal protein L5 | Translation, ribosomal structure and biogenesis [J] | 1.09 |
| COG0093 | Ribosomal protein L14 | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 0.73 |
| COG0091 | Ribosomal protein L22 | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0099 | Ribosomal protein S13 | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0100 | Ribosomal protein S11 | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0186 | Ribosomal protein S17 | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.36 |
| COG0360 | Ribosomal protein S6 | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.45 % |
| Unclassified | root | N/A | 48.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876011|none_p084036 | Not Available | 555 | Open in IMG/M |
| 3300000792|BS_KBA_SWE02_21mDRAFT_10095188 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300001344|JGI20152J14361_10087519 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300001348|JGI20154J14316_10143160 | Not Available | 661 | Open in IMG/M |
| 3300001827|ACM21_1032166 | All Organisms → cellular organisms → Eukaryota → Sar | 820 | Open in IMG/M |
| 3300001827|ACM21_1032166 | All Organisms → cellular organisms → Eukaryota → Sar | 820 | Open in IMG/M |
| 3300001969|GOS2233_1086920 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300002153|JGI24540J26637_10153212 | Not Available | 613 | Open in IMG/M |
| 3300003265|JGI26118J46590_1046244 | Not Available | 512 | Open in IMG/M |
| 3300003428|JGI26111J50215_1049339 | Not Available | 508 | Open in IMG/M |
| 3300003554|Ga0008451J51688_118387 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300003555|Ga0008453J51685_122248 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300003621|JGI26083J51738_10025826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Chroococcaceae → Gloeocapsa → unclassified Gloeocapsa → Gloeocapsa sp. PCC 7428 | 1818 | Open in IMG/M |
| 3300004779|Ga0062380_10048137 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300005044|Ga0071351_1009402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2565 | Open in IMG/M |
| 3300005570|Ga0073993_138572 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005599|Ga0066841_10020333 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005805|Ga0079957_1002683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 15456 | Open in IMG/M |
| 3300005825|Ga0074476_1376322 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300005827|Ga0074478_1159377 | Not Available | 567 | Open in IMG/M |
| 3300005987|Ga0075158_10125766 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300005988|Ga0075160_10024995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 3245 | Open in IMG/M |
| 3300005988|Ga0075160_10572438 | Not Available | 606 | Open in IMG/M |
| 3300006040|Ga0073914_10098623 | Not Available | 573 | Open in IMG/M |
| 3300006059|Ga0075017_100998006 | Not Available | 652 | Open in IMG/M |
| 3300006164|Ga0075441_10316467 | Not Available | 569 | Open in IMG/M |
| 3300006356|Ga0075487_1498644 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300006357|Ga0075502_1650958 | Not Available | 622 | Open in IMG/M |
| 3300006379|Ga0075513_1338885 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300006382|Ga0075494_1377026 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300006384|Ga0075516_1337421 | Not Available | 773 | Open in IMG/M |
| 3300006393|Ga0075517_1527463 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300006394|Ga0075492_1468643 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300006396|Ga0075493_1574229 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300006397|Ga0075488_1540169 | Not Available | 546 | Open in IMG/M |
| 3300006397|Ga0075488_1581540 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300006399|Ga0075495_1606172 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300006400|Ga0075503_1037558 | Not Available | 561 | Open in IMG/M |
| 3300006401|Ga0075506_1589832 | Not Available | 650 | Open in IMG/M |
| 3300006403|Ga0075514_1024673 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 4797 | Open in IMG/M |
| 3300006484|Ga0070744_10027392 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300006484|Ga0070744_10187683 | Not Available | 590 | Open in IMG/M |
| 3300006602|Ga0075484_1467945 | Not Available | 551 | Open in IMG/M |
| 3300006641|Ga0075471_10318814 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300006803|Ga0075467_10113438 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300006805|Ga0075464_10370569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 868 | Open in IMG/M |
| 3300006869|Ga0075477_10093935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1289 | Open in IMG/M |
| 3300006875|Ga0075473_10057342 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300007177|Ga0102978_1393346 | Not Available | 1324 | Open in IMG/M |
| 3300007216|Ga0103961_1257809 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300007230|Ga0075179_1047313 | Not Available | 1277 | Open in IMG/M |
| 3300007232|Ga0075183_11432293 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300007232|Ga0075183_11485752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1235 | Open in IMG/M |
| 3300007236|Ga0075463_10074536 | Not Available | 1095 | Open in IMG/M |
| 3300007237|Ga0075177_1062136 | Not Available | 602 | Open in IMG/M |
| 3300007240|Ga0075176_1774736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 768 | Open in IMG/M |
| 3300007241|Ga0075170_1536901 | Not Available | 643 | Open in IMG/M |
| 3300007250|Ga0075165_1977953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1893 | Open in IMG/M |
| 3300007253|Ga0075182_10107996 | Not Available | 1197 | Open in IMG/M |
| 3300007550|Ga0102880_1047695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1147 | Open in IMG/M |
| 3300007614|Ga0102946_1110440 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300007629|Ga0102895_1058868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 986 | Open in IMG/M |
| 3300007653|Ga0102868_1042962 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300007681|Ga0102824_1131767 | Not Available | 657 | Open in IMG/M |
| 3300007692|Ga0102823_1015238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2168 | Open in IMG/M |
| 3300007715|Ga0102827_1109584 | Not Available | 626 | Open in IMG/M |
| 3300007784|Ga0102955_1147543 | Not Available | 641 | Open in IMG/M |
| 3300007861|Ga0105736_1106626 | Not Available | 612 | Open in IMG/M |
| 3300007958|Ga0105743_1013475 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300007981|Ga0102904_1134403 | Not Available | 584 | Open in IMG/M |
| 3300007981|Ga0102904_1145501 | Not Available | 562 | Open in IMG/M |
| 3300008928|Ga0103711_10000578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 2674 | Open in IMG/M |
| 3300008964|Ga0102889_1005680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae | 4198 | Open in IMG/M |
| 3300008993|Ga0104258_1108505 | Not Available | 519 | Open in IMG/M |
| 3300009001|Ga0102963_1171495 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300009003|Ga0102813_1292082 | Not Available | 505 | Open in IMG/M |
| 3300009054|Ga0102826_1146107 | Not Available | 563 | Open in IMG/M |
| 3300009080|Ga0102815_10105467 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300009141|Ga0102884_1059366 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300009149|Ga0114918_10617802 | Not Available | 572 | Open in IMG/M |
| 3300009179|Ga0115028_10741338 | Not Available | 756 | Open in IMG/M |
| 3300009216|Ga0103842_1009261 | All Organisms → cellular organisms → Eukaryota → Sar | 821 | Open in IMG/M |
| 3300009225|Ga0103851_1008089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1438 | Open in IMG/M |
| 3300009432|Ga0115005_11030543 | Not Available | 667 | Open in IMG/M |
| 3300009433|Ga0115545_1266920 | Not Available | 572 | Open in IMG/M |
| 3300009436|Ga0115008_10043871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3496 | Open in IMG/M |
| 3300009436|Ga0115008_10567111 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300009436|Ga0115008_11501292 | Not Available | 521 | Open in IMG/M |
| 3300009441|Ga0115007_10649550 | Not Available | 705 | Open in IMG/M |
| 3300009443|Ga0115557_1368862 | Not Available | 532 | Open in IMG/M |
| 3300009448|Ga0114940_10406424 | Not Available | 600 | Open in IMG/M |
| 3300009507|Ga0115572_10357694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 821 | Open in IMG/M |
| 3300009515|Ga0129286_10281643 | Not Available | 593 | Open in IMG/M |
| 3300009515|Ga0129286_10283545 | Not Available | 592 | Open in IMG/M |
| 3300009543|Ga0115099_10540245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 5517 | Open in IMG/M |
| 3300009543|Ga0115099_10565746 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300009592|Ga0115101_1053298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3759 | Open in IMG/M |
| 3300009592|Ga0115101_1081962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 11168 | Open in IMG/M |
| 3300009592|Ga0115101_1385508 | Not Available | 595 | Open in IMG/M |
| 3300009592|Ga0115101_1824540 | Not Available | 518 | Open in IMG/M |
| 3300009593|Ga0115011_10930854 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300009593|Ga0115011_11692229 | Not Available | 566 | Open in IMG/M |
| 3300009599|Ga0115103_1023745 | All Organisms → cellular organisms → Bacteria | 3761 | Open in IMG/M |
| 3300009599|Ga0115103_1737337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 1671 | Open in IMG/M |
| 3300009599|Ga0115103_1841569 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300009606|Ga0115102_10839193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4261 | Open in IMG/M |
| 3300009728|Ga0123371_146447 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300009735|Ga0123377_1033011 | Not Available | 764 | Open in IMG/M |
| 3300009753|Ga0123360_1128354 | All Organisms → cellular organisms → Eukaryota → Sar | 556 | Open in IMG/M |
| 3300010296|Ga0129348_1151416 | Not Available | 802 | Open in IMG/M |
| 3300010306|Ga0129322_1044360 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300010309|Ga0102890_1050171 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300010354|Ga0129333_10423816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1175 | Open in IMG/M |
| 3300010375|Ga0105239_11982540 | Not Available | 676 | Open in IMG/M |
| 3300010936|Ga0137784_1358662 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300012394|Ga0123365_1017076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1184 | Open in IMG/M |
| 3300012408|Ga0138265_1182812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 7480 | Open in IMG/M |
| 3300012413|Ga0138258_1030794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 6935 | Open in IMG/M |
| 3300012413|Ga0138258_1270196 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300012413|Ga0138258_1604274 | Not Available | 1033 | Open in IMG/M |
| 3300012413|Ga0138258_1756421 | Not Available | 1408 | Open in IMG/M |
| 3300012419|Ga0138260_10910378 | Not Available | 611 | Open in IMG/M |
| 3300012471|Ga0129334_1040216 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012472|Ga0129328_1136051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2337 | Open in IMG/M |
| 3300012516|Ga0129325_1205512 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300012516|Ga0129325_1312702 | Not Available | 560 | Open in IMG/M |
| 3300012518|Ga0129349_1057735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1018 | Open in IMG/M |
| 3300012523|Ga0129350_1404359 | Not Available | 569 | Open in IMG/M |
| 3300012724|Ga0157611_1050474 | Not Available | 624 | Open in IMG/M |
| 3300012782|Ga0138268_1674525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1597 | Open in IMG/M |
| 3300012935|Ga0138257_1371052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2438 | Open in IMG/M |
| 3300012935|Ga0138257_1716177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1135 | Open in IMG/M |
| 3300012954|Ga0163111_11054497 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012968|Ga0129337_1361876 | Not Available | 631 | Open in IMG/M |
| 3300012989|Ga0164305_10011281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 4314 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10527205 | Not Available | 569 | Open in IMG/M |
| 3300015374|Ga0132255_100585330 | Not Available | 1649 | Open in IMG/M |
| 3300016850|Ga0186201_101932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2251 | Open in IMG/M |
| 3300017731|Ga0181416_1129436 | Not Available | 607 | Open in IMG/M |
| 3300017764|Ga0181385_1226723 | Not Available | 562 | Open in IMG/M |
| 3300017764|Ga0181385_1227077 | Not Available | 561 | Open in IMG/M |
| 3300018603|Ga0192881_1001226 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300018605|Ga0193339_1000667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1965 | Open in IMG/M |
| 3300018605|Ga0193339_1003501 | Not Available | 1272 | Open in IMG/M |
| 3300018635|Ga0193376_1018908 | Not Available | 608 | Open in IMG/M |
| 3300018649|Ga0192969_1005179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2105 | Open in IMG/M |
| 3300018745|Ga0193000_1009171 | Not Available | 1319 | Open in IMG/M |
| 3300018745|Ga0193000_1071386 | Not Available | 510 | Open in IMG/M |
| 3300018791|Ga0192950_1014726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 984 | Open in IMG/M |
| 3300018792|Ga0192956_1079771 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300018792|Ga0192956_1083381 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300018813|Ga0192872_1063658 | Not Available | 648 | Open in IMG/M |
| 3300018844|Ga0193312_1000334 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300018911|Ga0192987_1063110 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300018927|Ga0193083_10000798 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300018927|Ga0193083_10001345 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300018942|Ga0193426_10028054 | Not Available | 1119 | Open in IMG/M |
| 3300018982|Ga0192947_10059547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1212 | Open in IMG/M |
| 3300019010|Ga0193044_10028327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1713 | Open in IMG/M |
| 3300019010|Ga0193044_10036111 | Not Available | 1558 | Open in IMG/M |
| 3300019036|Ga0192945_10005214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2141 | Open in IMG/M |
| 3300019048|Ga0192981_10300587 | Not Available | 599 | Open in IMG/M |
| 3300019049|Ga0193082_10016384 | Not Available | 1708 | Open in IMG/M |
| 3300019053|Ga0193356_10188280 | Not Available | 726 | Open in IMG/M |
| 3300019099|Ga0193102_1003142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1214 | Open in IMG/M |
| 3300019100|Ga0193045_1013185 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300019103|Ga0192946_1004722 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300019133|Ga0193089_1011358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales | 1870 | Open in IMG/M |
| 3300019134|Ga0193515_1016241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1280 | Open in IMG/M |
| 3300019153|Ga0192975_10197170 | Not Available | 712 | Open in IMG/M |
| 3300019696|Ga0194017_1015282 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300019698|Ga0193986_1008138 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300019701|Ga0194015_1016028 | Not Available | 783 | Open in IMG/M |
| 3300019707|Ga0193989_1053526 | Not Available | 513 | Open in IMG/M |
| 3300019712|Ga0193969_1044983 | Not Available | 567 | Open in IMG/M |
| 3300019717|Ga0193972_1043434 | Not Available | 554 | Open in IMG/M |
| 3300019730|Ga0194001_1021919 | Not Available | 729 | Open in IMG/M |
| 3300019733|Ga0194013_1000062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5922 | Open in IMG/M |
| 3300019740|Ga0193988_1063059 | Not Available | 572 | Open in IMG/M |
| 3300019742|Ga0193965_1071125 | Not Available | 574 | Open in IMG/M |
| 3300019759|Ga0193961_1087519 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300019768|Ga0193960_1167786 | Not Available | 562 | Open in IMG/M |
| 3300019935|Ga0193950_1007676 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300020083|Ga0194111_10203633 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300020175|Ga0206124_10130396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1024 | Open in IMG/M |
| 3300020219|Ga0163146_10570564 | Not Available | 578 | Open in IMG/M |
| 3300020382|Ga0211686_10417794 | Not Available | 540 | Open in IMG/M |
| 3300020453|Ga0211550_10503455 | Not Available | 568 | Open in IMG/M |
| 3300021267|Ga0210353_103869 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300021274|Ga0210327_136574 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300021275|Ga0210342_115875 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300021282|Ga0210303_1017008 | Not Available | 594 | Open in IMG/M |
| 3300021298|Ga0210349_1001610 | Not Available | 1428 | Open in IMG/M |
| 3300021298|Ga0210349_1150829 | Not Available | 862 | Open in IMG/M |
| 3300021299|Ga0210302_1018581 | Not Available | 1659 | Open in IMG/M |
| 3300021302|Ga0210328_1035272 | Not Available | 594 | Open in IMG/M |
| 3300021305|Ga0210296_1007484 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300021305|Ga0210296_1123180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3395 | Open in IMG/M |
| 3300021308|Ga0210350_1003547 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300021309|Ga0210326_1150929 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300021329|Ga0210362_1016413 | Not Available | 500 | Open in IMG/M |
| 3300021331|Ga0210347_1264157 | Not Available | 1036 | Open in IMG/M |
| 3300021334|Ga0206696_1094695 | Not Available | 532 | Open in IMG/M |
| 3300021334|Ga0206696_1244169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 4315 | Open in IMG/M |
| 3300021346|Ga0210335_1355177 | Not Available | 1059 | Open in IMG/M |
| 3300021346|Ga0210335_1450642 | Not Available | 583 | Open in IMG/M |
| 3300021350|Ga0206692_1287660 | Not Available | 699 | Open in IMG/M |
| 3300021389|Ga0213868_10316235 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300021465|Ga0193947_1000649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 6269 | Open in IMG/M |
| 3300021845|Ga0210297_1020097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2969 | Open in IMG/M |
| 3300021961|Ga0222714_10494487 | Not Available | 629 | Open in IMG/M |
| 3300022369|Ga0210310_1000396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3096 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10091181 | Not Available | 716 | Open in IMG/M |
| (restricted) 3300023085|Ga0233406_10011379 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| (restricted) 3300023085|Ga0233406_10061668 | Not Available | 582 | Open in IMG/M |
| 3300023230|Ga0222709_1039898 | Not Available | 609 | Open in IMG/M |
| (restricted) 3300023271|Ga0233403_10154311 | Not Available | 675 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10086111 | Not Available | 1238 | Open in IMG/M |
| 3300024343|Ga0244777_10007263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 7124 | Open in IMG/M |
| 3300024343|Ga0244777_10697167 | Not Available | 608 | Open in IMG/M |
| 3300025130|Ga0209594_1239514 | Not Available | 526 | Open in IMG/M |
| 3300025577|Ga0209304_1078808 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300025684|Ga0209652_1182382 | Not Available | 523 | Open in IMG/M |
| 3300025732|Ga0208784_1035904 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300025771|Ga0208427_1103235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 982 | Open in IMG/M |
| 3300025810|Ga0208543_1159547 | Not Available | 525 | Open in IMG/M |
| 3300025831|Ga0210015_1230431 | All Organisms → cellular organisms → Eukaryota → Sar | 599 | Open in IMG/M |
| 3300025849|Ga0209603_1227274 | Not Available | 694 | Open in IMG/M |
| 3300025879|Ga0209555_10250582 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300025879|Ga0209555_10386333 | Not Available | 515 | Open in IMG/M |
| 3300025892|Ga0209630_10283982 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300025896|Ga0208916_10193737 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300025945|Ga0207679_11605743 | Not Available | 596 | Open in IMG/M |
| 3300026130|Ga0209961_1074943 | Not Available | 609 | Open in IMG/M |
| 3300026166|Ga0208276_1011137 | Not Available | 1167 | Open in IMG/M |
| 3300026187|Ga0209929_1101089 | Not Available | 749 | Open in IMG/M |
| 3300027193|Ga0208800_1058335 | Not Available | 525 | Open in IMG/M |
| 3300027195|Ga0208676_1016828 | Not Available | 675 | Open in IMG/M |
| 3300027197|Ga0208922_1059318 | Not Available | 641 | Open in IMG/M |
| 3300027203|Ga0208925_101077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1897 | Open in IMG/M |
| 3300027212|Ga0208554_1026477 | Not Available | 938 | Open in IMG/M |
| 3300027215|Ga0208166_1022423 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300027218|Ga0208165_1025805 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300027218|Ga0208165_1047116 | Not Available | 630 | Open in IMG/M |
| 3300027228|Ga0208308_1003685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2020 | Open in IMG/M |
| 3300027230|Ga0208171_1023617 | Not Available | 602 | Open in IMG/M |
| 3300027245|Ga0208445_1011536 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300027308|Ga0208796_1032240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1228 | Open in IMG/M |
| 3300027418|Ga0208022_1014359 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300027525|Ga0208437_1040471 | Not Available | 1139 | Open in IMG/M |
| 3300027608|Ga0208974_1117173 | Not Available | 699 | Open in IMG/M |
| 3300027714|Ga0209815_1003198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 9501 | Open in IMG/M |
| 3300027714|Ga0209815_1071062 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300027751|Ga0208304_10057563 | Not Available | 1503 | Open in IMG/M |
| 3300027751|Ga0208304_10147063 | Not Available | 869 | Open in IMG/M |
| 3300027781|Ga0209175_10333868 | Not Available | 637 | Open in IMG/M |
| 3300027786|Ga0209812_10061811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1823 | Open in IMG/M |
| 3300027810|Ga0209302_10146827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1156 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10167261 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10601299 | Not Available | 521 | Open in IMG/M |
| 3300028329|Ga0210315_1023737 | Not Available | 772 | Open in IMG/M |
| 3300028599|Ga0265309_10996834 | Not Available | 578 | Open in IMG/M |
| 3300028600|Ga0265303_11373155 | Not Available | 589 | Open in IMG/M |
| 3300030670|Ga0307401_10359388 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031589|Ga0307996_1020748 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300031773|Ga0315332_10802881 | Not Available | 571 | Open in IMG/M |
| 3300031785|Ga0310343_10883493 | Not Available | 673 | Open in IMG/M |
| 3300032092|Ga0315905_10349889 | Not Available | 1403 | Open in IMG/M |
| 3300032156|Ga0315295_11986996 | Not Available | 546 | Open in IMG/M |
| 3300032258|Ga0316191_11268547 | Not Available | 532 | Open in IMG/M |
| 3300032263|Ga0316195_10410394 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032275|Ga0315270_10670879 | Not Available | 677 | Open in IMG/M |
| 3300032276|Ga0316188_10508872 | Not Available | 643 | Open in IMG/M |
| 3300033979|Ga0334978_0457477 | Not Available | 597 | Open in IMG/M |
| 3300033992|Ga0334992_0465487 | Not Available | 554 | Open in IMG/M |
| 3300034280|Ga0334997_0224067 | Not Available | 1230 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 18.48% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.94% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.16% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 4.71% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.62% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 3.26% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.17% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.81% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.81% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.81% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat | 1.45% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.09% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.09% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.09% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.72% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.72% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.72% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.72% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.72% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.72% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.72% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.72% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.72% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.72% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.72% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.36% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.36% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater, Plankton | 0.36% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.36% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.36% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.36% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 0.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.36% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.36% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.36% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.36% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.36% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.36% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.36% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.36% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine | 0.36% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.36% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.36% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.36% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.36% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.36% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.36% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.36% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876011 | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-3LG-Hyp-75m | Environmental | Open in IMG/M |
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001827 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23k | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300002153 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Metagenome | Environmental | Open in IMG/M |
| 3300003265 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 | Environmental | Open in IMG/M |
| 3300003428 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 | Environmental | Open in IMG/M |
| 3300003554 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_04_M0_20 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003555 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_17_M020 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005044 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0048 | Environmental | Open in IMG/M |
| 3300005570 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser CG13 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005599 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91A | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
| 3300005987 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA | Engineered | Open in IMG/M |
| 3300005988 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA | Engineered | Open in IMG/M |
| 3300006040 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_30-Apr-14 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006356 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006379 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006382 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006384 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006393 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006394 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006396 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006397 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006602 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007230 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007232 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007237 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 A RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007240 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007241 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007250 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 B RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007253 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A1 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007614 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007715 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 | Environmental | Open in IMG/M |
| 3300007784 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007958 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0um | Environmental | Open in IMG/M |
| 3300007981 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 | Environmental | Open in IMG/M |
| 3300008928 | Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E3 | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300008993 | Marine microbial communities from eastern North Pacific Ocean - P1 free-living | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009141 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009216 | Microbial communities of water from the North Atlantic ocean - ACM47 | Environmental | Open in IMG/M |
| 3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009448 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009515 | Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2 | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009728 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_213_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009735 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009753 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_190_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010306 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010309 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010936 | Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15m | Environmental | Open in IMG/M |
| 3300012394 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012408 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012413 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012471 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012472 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012516 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012518 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012782 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012935 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016850 | Metatranscriptome of marine eukaryotic communities from unknown location in ASW medium w/o silicate, at 20 C, 30 psu salinity and 743 ?mol photons light - Tryblionella compressa CCMP 561 (MMETSP0745) | Host-Associated | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300018603 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906) | Environmental | Open in IMG/M |
| 3300018605 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177) | Environmental | Open in IMG/M |
| 3300018635 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782126-ERR1712207) | Environmental | Open in IMG/M |
| 3300018649 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161) | Environmental | Open in IMG/M |
| 3300018745 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134) | Environmental | Open in IMG/M |
| 3300018791 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085) | Environmental | Open in IMG/M |
| 3300018792 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892) | Environmental | Open in IMG/M |
| 3300018813 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172) | Environmental | Open in IMG/M |
| 3300018844 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982) | Environmental | Open in IMG/M |
| 3300018911 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001042 (ERX1809744-ERR1740134) | Environmental | Open in IMG/M |
| 3300018927 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125) | Environmental | Open in IMG/M |
| 3300018942 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003) | Environmental | Open in IMG/M |
| 3300018982 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935) | Environmental | Open in IMG/M |
| 3300019010 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838) | Environmental | Open in IMG/M |
| 3300019036 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086) | Environmental | Open in IMG/M |
| 3300019048 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166) | Environmental | Open in IMG/M |
| 3300019049 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232) | Environmental | Open in IMG/M |
| 3300019053 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241) | Environmental | Open in IMG/M |
| 3300019099 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084) | Environmental | Open in IMG/M |
| 3300019100 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839) | Environmental | Open in IMG/M |
| 3300019103 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021) | Environmental | Open in IMG/M |
| 3300019133 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071) | Environmental | Open in IMG/M |
| 3300019134 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165) | Environmental | Open in IMG/M |
| 3300019153 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469) | Environmental | Open in IMG/M |
| 3300019696 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_3-4_MG | Environmental | Open in IMG/M |
| 3300019698 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_2-3_MG | Environmental | Open in IMG/M |
| 3300019701 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_1-2_MG | Environmental | Open in IMG/M |
| 3300019707 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_0-1_MG | Environmental | Open in IMG/M |
| 3300019712 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_5-6_MG | Environmental | Open in IMG/M |
| 3300019717 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_8-9_MG | Environmental | Open in IMG/M |
| 3300019730 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MG | Environmental | Open in IMG/M |
| 3300019733 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_9-10_MG | Environmental | Open in IMG/M |
| 3300019740 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_4-5_MG | Environmental | Open in IMG/M |
| 3300019742 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_8_MG | Environmental | Open in IMG/M |
| 3300019759 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_4_MG | Environmental | Open in IMG/M |
| 3300019768 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_3_MG | Environmental | Open in IMG/M |
| 3300019935 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_1_MG | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020219 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1 | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
| 3300021267 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.489 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021274 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.268 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021275 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.429 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021282 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021298 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.460 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021299 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021302 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.270 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021305 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021308 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.462 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021309 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.266 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021331 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.456 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021334 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021346 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.374 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021465 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_0-1_MG | Environmental | Open in IMG/M |
| 3300021845 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R876 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022369 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300023085 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MG | Environmental | Open in IMG/M |
| 3300023230 | Saline water microbial communities from Ace Lake, Antarctica - #1692 | Environmental | Open in IMG/M |
| 3300023271 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_1_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300025130 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025831 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-22 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026130 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91A (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027195 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
| 3300027203 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027215 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027218 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027228 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027230 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027245 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027308 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027525 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027781 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027786 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028329 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300030670 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_0840361 | 2236876011 | Marine Estuarine | NNVLNGMVLLKFLRFPLNDSGYYEKYDSLEEISQVWDRKKHLRRKRWSQE |
| BS_KBA_SWE02_21mDRAFT_100951883 | 3300000792 | Marine | TMDKILNGMILFKFLRFPLNDCGYYENYSSFSEINQVWDRKKHLKRKRWSQE* |
| JGI20152J14361_100875191 | 3300001344 | Pelagic Marine | FKFLRFPLNDSGYYDKYSELSEVTQVWDKKKHLKRKRWSQE* |
| JGI20154J14316_101431602 | 3300001348 | Pelagic Marine | GIILFKFLRFPLNDSGYYDKYSELSEVTQVWDKKKHLKRKRWSQE* |
| ACM21_10321661 | 3300001827 | Marine Plankton | MILFKFLRFPLNDVGYYAKYFSFSEINQIWDKKRHLKRKRWSQE |
| ACM21_10321662 | 3300001827 | Marine Plankton | MILFKFLRFPLNDVGYYAKYFSFSEINQIWDKKRHLKRKRWSQE* |
| GOS2233_10869205 | 3300001969 | Marine | PLNDCGYYDKYSSLGEINQVWDKKKHLRRKRWSQE* |
| JGI24540J26637_101532121 | 3300002153 | Marine | FLRFPLNDCGYYDKYSSFGEINQVWDXKKHLRRKRWSQE* |
| JGI26118J46590_10462442 | 3300003265 | Marine | KFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE* |
| JGI26111J50215_10493392 | 3300003428 | Marine | FKFLRFPLNDCGYYDKYSSFSEVNQIWDRKKHLKRKRWSQE* |
| Ga0008451J51688_1183871 | 3300003554 | Seawater | KSMDKILNGMILFKFLRFPLNDCGYYEKYSSFSEVSQIWDRKKHLKRKRWSQE* |
| Ga0008453J51685_1222481 | 3300003555 | Seawater | ILLKFLRFPLNDCGYYEKYASLAEVNQAWDKKKHLRRKRWSQE* |
| JGI26083J51738_100258261 | 3300003621 | Marine | RSRTFDRVLNGMVLLKFLRFPLNDCGYYEKYASLAEVNQSWDKKKHLRRKRWSQE* |
| Ga0062380_100481372 | 3300004779 | Wetland Sediment | MILFKFLRFPLNDCGYYDKYESFSDINRTWDKKRQLKRKRWSQAQE* |
| Ga0071351_10094021 | 3300005044 | Freshwater, Plankton | YQSKSIDKILNGMILFKFLRFPLNDCGYYEKYSSFSEVSQVWDRKRHLKRKRWSQE* |
| Ga0073993_1385723 | 3300005570 | Groundwater | LNGMILFKFLRFPLNDCGYYEKYDSIPEVNRAWDKKKHLKRKRWSQE* |
| Ga0066841_100203331 | 3300005599 | Marine | MILFKFLRFPLNDCGYYDRYESFSDINKTWDKKRHLKRKRWSQE* |
| Ga0079957_100268325 | 3300005805 | Lake | LPKKDTFSKLLNGLILFKFLRFPLNDYGYYEKYSSLSEISQLWDRKKHLRRKRKRWSQE* |
| Ga0074476_13763223 | 3300005825 | Sediment (Intertidal) | SKSMDKILNGMILFKFLRFPLNDCGYYDKYSSVSELNQFWDRKKHLKRKRWSQE* |
| Ga0074478_11593772 | 3300005827 | Sediment (Intertidal) | ILFKFLRFPLNDCGYYDKYSSLSEVNQVWDRKKHLKRKRWSQE* |
| Ga0075158_101257661 | 3300005987 | Wastewater Effluent | IDKILNGMILFKFLRFPLNDCGYYEKYDSFSDLNRAWDKKRHLKRKRWSQE* |
| Ga0075160_100249951 | 3300005988 | Wastewater Effluent | FKFLRFPLNDCGYYDKYSSFSEINQVWDRKKHLKRKRWSQE* |
| Ga0075160_105724381 | 3300005988 | Wastewater Effluent | FLRFPLNDCGYYEKYDSFSDLNRAWDKKRHLKRKRWSQE* |
| Ga0073914_100986231 | 3300006040 | Sand | FKFLRFPLNDCGYYAKYSSFSEINQVWDKKKHLKRKRWSQE* |
| Ga0075017_1009980062 | 3300006059 | Watersheds | MILFKFLRFPLNDCGYYEKYSSFSEINHIWERKKSLKRKRWSQE* |
| Ga0075441_103164671 | 3300006164 | Marine | VLNGMILLKFLRFPLNDCGYYEKYASLAEVNQSWDKKKHLRRKRWSQE* |
| Ga0075487_14986442 | 3300006356 | Aqueous | MILFKFLRFPLNDCGYYEKYSSFSEINQNWDRKRHLKRKRWSHE* |
| Ga0075502_16509581 | 3300006357 | Aqueous | SLPKGRDKTFDRILNGIILLKFLRFPLNDSGYYQKFESLSAVNQSWDRKKHLRRKRWSQE |
| Ga0075513_13388851 | 3300006379 | Aqueous | KAKTINKVLNGIILFKFFRFPLNDAGYYEKYSSLSQINQQWDRKKHLRRKRWSQE* |
| Ga0075494_13770263 | 3300006382 | Aqueous | FLRFPLNDCGYYDKYSSFGEINQIWDKKKHLRRKRWSQE* |
| Ga0075516_13374211 | 3300006384 | Aqueous | DKILNGMILFKFLRFPLNDCGYYEKYVSFAEVNQVWDRKKHLKRKRWSQE* |
| Ga0075517_15274631 | 3300006393 | Aqueous | FPLNDCGYYDKHSSFEEINQIWDRKKHLRRKRWSQE* |
| Ga0075492_14686431 | 3300006394 | Aqueous | PLNDCGYYEKYASLNEVSQNWDRKKHLRRKRWSQE* |
| Ga0075493_15742291 | 3300006396 | Aqueous | GMILLKFLRFPLNDCGYYEKYESLAEVNQTWDKKKHLRRKRWSQE* |
| Ga0075488_15401691 | 3300006397 | Aqueous | KSIDKILNGMILFKFLRFPLNDCGYYEKYSSIPEINRAWDKKKHLKRKRWSQE* |
| Ga0075488_15815401 | 3300006397 | Aqueous | FLRFPLNDSGYYQKFESLSAVNQSWDRKKHLRRKRWSQE* |
| Ga0075495_16061721 | 3300006399 | Aqueous | KFLRFPLNDCGYYDKYSSFGEINQIWDKKKHLRRKRWSQE* |
| Ga0075503_10375582 | 3300006400 | Aqueous | LNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE* |
| Ga0075506_15898321 | 3300006401 | Aqueous | NVLNGMVLLKFLRFPLNDSGYYEKYESVNEISQVWDRKKHLRRKRWSQE* |
| Ga0075514_10246735 | 3300006403 | Aqueous | MISLKKSEIPKILNGMILFRFLRFPLNDCGYYDKYSSFYEINQTWDKKRHLKRKRWSQE* |
| Ga0070744_100273924 | 3300006484 | Estuarine | ILFKFLRFPLNDSGYYDKYSSFSEINRAWDKKRHLKRKRWSQE* |
| Ga0070744_101876831 | 3300006484 | Estuarine | DRVLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE* |
| Ga0075484_14679451 | 3300006602 | Aqueous | FPLNDCGYYDKYSSFGEINQIWDRKKHLRRKRWSQE* |
| Ga0075471_103188143 | 3300006641 | Aqueous | LNDCGYYDKYSSFGEINQIWDKKKHLRRKRWSQE* |
| Ga0075467_101134381 | 3300006803 | Aqueous | LFKFLRFPLNDVGYYAKYSSFSEINQIWDKKRHLKRKRWSQE* |
| Ga0075464_103705691 | 3300006805 | Aqueous | MILFKFLRFPLNDCGYYEKYSSISEISQTWDKKKHLKRKRWSQE* |
| Ga0075477_100939353 | 3300006869 | Aqueous | TTFNNVLNGMVLLKFLRFPLNDSGYYEKYESVNEISQVWDRKKHLRRKRWSQE* |
| Ga0075473_100573421 | 3300006875 | Aqueous | FLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE* |
| Ga0102978_13933461 | 3300007177 | Freshwater Lake | KFLRFPLNDCGYYDKYSSVSELNQFWDRKKHLKRKRWSQE* |
| Ga0103961_12578093 | 3300007216 | Freshwater Lake | FKFLRFPLNDCGYYEKYESFSDINRTWDKKRHLKRKRWSQE* |
| Ga0075179_10473134 | 3300007230 | Wastewater Effluent | NGMILLKFLRFPLNDCGYYDKYSSFEEINQVWDRKKHLRRKRWSQE* |
| Ga0075183_114322932 | 3300007232 | Wastewater Effluent | MDRILNGMILFRFLRFPLNDSGYYDKHSSFSEINRVWDRKRHLKRKRWSQE* |
| Ga0075183_114857521 | 3300007232 | Wastewater Effluent | KILNGMILFKFLRFPLNDYGYYEKYSSFSEISQVWDRKRQLKRKRWSQE* |
| Ga0075463_100745363 | 3300007236 | Aqueous | NGIILFKFFRFPLNDAGYYEKYSSLSQINQQWDRKKHLRRKRWSQE* |
| Ga0075177_10621362 | 3300007237 | Wastewater Effluent | NRVLNGMVLLKFLRFPLNDCGYYDKYSSFAEITQIWDKKKHLRRKRWSQD* |
| Ga0075176_17747361 | 3300007240 | Wastewater Effluent | LFKFLRFPLNDCGYYDKYDSFAEINRTWDKKRHLKRKRWSQE* |
| Ga0075170_15369011 | 3300007241 | Wastewater Effluent | KFLRFPLNDCGYYDKYSSFEEINQVWDRKKHLRRKRWSQE* |
| Ga0075165_19779531 | 3300007250 | Wastewater Effluent | KFLRFPLNDCGYYEKYSSFSEVSQVWDRKRHLKRKRWSQE* |
| Ga0075182_101079963 | 3300007253 | Wastewater Effluent | KFLRFPLNDCGYYDKYSSFAEITQIWDKKKHLRRKRWSQD* |
| Ga0102880_10476951 | 3300007550 | Estuarine | NGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKTLRRKRWSQE* |
| Ga0102946_11104401 | 3300007614 | Soil | ILNGMILFKFLRFPLNDCGYFEKYESFSELNRTWDKKRHLKRKRWSQE* |
| Ga0102895_10588683 | 3300007629 | Estuarine | ILFKFLRFPLNDCGYYDKYSSYSEVSQVWDRKRHLKRKRWSQE* |
| Ga0102868_10429621 | 3300007653 | Estuarine | LLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKTLRRKRWSQE* |
| Ga0102824_11317672 | 3300007681 | Estuarine | VLLKFLRFPLNDSGYYERYESVSEISQVWDRKKHLRRKRWSQE* |
| Ga0102823_10152381 | 3300007692 | Estuarine | LLKFLRFPLNYSGYYERYESVSEISQVWDRKKHLRRKRWSQE* |
| Ga0102827_11095841 | 3300007715 | Estuarine | VLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKTLRRKRWSQE* |
| Ga0102955_11475432 | 3300007784 | Soil | LFKFLRFPLNDCGYYDKYESFSDVNQAWDKKRHLKRKRWSQE* |
| Ga0105736_11066262 | 3300007861 | Estuary Water | FLRFPLNDCGIYSKYSTASDLNSNWDRKRHLRRKRWSQE* |
| Ga0105743_10134751 | 3300007958 | Estuary Water | FLRFPFNDSGYYEKYASLAEVSQVWDKKKHLRRKRWSQE* |
| Ga0102904_11344031 | 3300007981 | Estuarine | LNDCGYYDKYSSFGEINQVWDKKKTLRRKRWSQE* |
| Ga0102904_11455012 | 3300007981 | Estuarine | RFPLNDSGYYEKSLSLQEINQVWDRKKHLRRKRWSQE* |
| Ga0103711_100005781 | 3300008928 | Ocean Water | SKSMDKILNGMILFKFLRFPLNDCGYYDKYSSFSEVSQVWDRKRHLKRKRWSQE* |
| Ga0102889_10056806 | 3300008964 | Estuarine | MILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE* |
| Ga0104258_11085052 | 3300008993 | Ocean Water | PLNDSGYYERYESVSEISQVWDRKKHLRRKRWSQE* |
| Ga0102963_11714951 | 3300009001 | Pond Water | ILNGMVLFKFLRFPLNDCGYYEKYSSFSEVNQVWDRKKHLKRKRWSQE* |
| Ga0102813_12920821 | 3300009003 | Estuarine | LNGMVLLKFLRFPLNDSGYYEKYESLNEISQVWDRKKHLRRKRWSQE* |
| Ga0102826_11461072 | 3300009054 | Estuarine | LNDCGYYEKYASLAEVNQAWDKKKHLRRKRWSQE* |
| Ga0102815_101054671 | 3300009080 | Estuarine | PLNDCGYYEKYSSFSEVNQVWDRKKHLKRKRWSQE* |
| Ga0102884_10593661 | 3300009141 | Estuarine | MVLLKFLRFPLNDCGYYEKYASLAEVNQSWDKKKQLRRKRWSQE* |
| Ga0114918_106178022 | 3300009149 | Deep Subsurface | VLNGMILLKFLRFPLNDCGYYEKYESLADVNQTWDKKKHLRRKRWSQE* |
| Ga0115028_107413381 | 3300009179 | Wetland | RFPLNDCGYYDKYSSFAEITQIWDKKKHLRRKRWSQD* |
| Ga0103842_10092612 | 3300009216 | River Water | MILLKFLRFPLNDCGYYEKFESLSEVIQSWDKKKHLRRKRWSQEQ* |
| Ga0103851_10080892 | 3300009225 | River Water | MSLLKFFKFPLNDAGFYEKYESLNEVSQVWDKKKQLRRKRWSQVQE* |
| Ga0115005_110305433 | 3300009432 | Marine | LNDCGYYDKYSSFSEVSQIWDRKKHLKRKRWSQE* |
| Ga0115545_12669201 | 3300009433 | Pelagic Marine | RTIDKVLNGMILLKFLRFPLNDCGYYEKYASLAEVSQSWDKKRHLRRKRWSQE* |
| Ga0115008_100438711 | 3300009436 | Marine | ILFKFLRFPLNDCGYYEKYSSIPEINRAWDKKKHLKRKRWSQE* |
| Ga0115008_105671111 | 3300009436 | Marine | MILFKFLRFPLNDCGYYDKYESFSEITQTWDNKKHLKRKRWSQE* |
| Ga0115008_115012921 | 3300009436 | Marine | FPLNDSGYYEKYESLNEISQVWDRKKHLRRKRWSQE* |
| Ga0115007_106495501 | 3300009441 | Marine | IDKILNGMILFKFLRFPLNDCGYYEKYESFSEISRTWDKKRHLKRKRWSQE* |
| Ga0115557_13688622 | 3300009443 | Pelagic Marine | MILLKFLRFPLNDCGYYEKYASLAEVNQAWDKKKHLRRKRWSQE* |
| Ga0114940_104064242 | 3300009448 | Groundwater | DKILNGMILFKFLRFPLNECGYYDKYESFSEITTAWEKKRHLKRKRWSQVE* |
| Ga0115572_103576941 | 3300009507 | Pelagic Marine | SSKKLKTRARILNGMILFKFLRFPLNDAGYYEKYSTLEEVNQVWERKKHLKRKRWSQE* |
| Ga0129286_102816432 | 3300009515 | Sediment | MDKILNGMILFKFLRFPLNDCGYYDKYSSFSEVNQVWDRKKHLKRKRWSQE* |
| Ga0129286_102835451 | 3300009515 | Sediment | IDKILNGMILFKFLRFPLNDCGYYEKYSSFSEINRNWDRKKHLKRKRWSQE* |
| Ga0115099_105402451 | 3300009543 | Marine | SRTFDRVLNGMILLKFLRFPFNDCGYYEKYASLAEVNQAWDKKKHLRRKRWSQE* |
| Ga0115099_105657461 | 3300009543 | Marine | QTFDRVLNGMILLKFLRFPLNDCGYYEKYASLAEVNQTWDKKKHLRRKRWSQE* |
| Ga0115101_10532984 | 3300009592 | Marine | MVLLKFLRFPLNDCGYYEKYSSLAEVSQSWDKKKHLLRKRWSQE* |
| Ga0115101_10819629 | 3300009592 | Marine | VLNGMVLLKFLRFPLNDSGYYEKYESLNEISQVWDRKKHLRRKRWSQE* |
| Ga0115101_13855081 | 3300009592 | Marine | GMILFKFLRFPLNDCGYYDKYESFSEITQTWDNKKHLKRKRWSQE* |
| Ga0115101_18245402 | 3300009592 | Marine | FLRFPLNDCGYYEKYASLAEVSQSWDKKRHLRRKRWSQE* |
| Ga0115011_109308541 | 3300009593 | Marine | LNDFGYYDKYSSLSEINQAWDRKKHLKRKRWSQE* |
| Ga0115011_116922292 | 3300009593 | Marine | GMILLKFLRFPLNDCGYYDKYSSLGEINQVWDKKKHLRRKRWSQE* |
| Ga0115103_10237454 | 3300009599 | Marine | MVLLKFLRFPLNDCGYYEKYSSLAEVSQSWDKKKHLRRKRWSQE* |
| Ga0115103_17373372 | 3300009599 | Marine | MDRILNGMILFKFLRFPLNDVGYYAKYSSFSEINQIWDKKRHLKRKRWSQE* |
| Ga0115103_18415691 | 3300009599 | Marine | LFKFLRFPLNDCGYYEKYSSFSEVNQVWDRKKHLKRKRWSQE* |
| Ga0115102_108391939 | 3300009606 | Marine | LLCHHIQKKTIFNNIFNGMVLLKFLRFPLNDSGYYEKYESLQDISQTWDRKKHLRRKRWSQE* |
| Ga0123371_1464473 | 3300009728 | Marine | ILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE* |
| Ga0123377_10330111 | 3300009735 | Marine | RTFDRVLNGMILLKFLRFPLNDSGYYDKFDSVAQINQSWDRKKQLRRKRWSQE* |
| Ga0123360_11283542 | 3300009753 | Marine | MVLLKFLRFPLNDSGYYERYESLQDISQVWDRKKHLRRKRWAQE* |
| Ga0129348_11514163 | 3300010296 | Freshwater To Marine Saline Gradient | DKILNGMILFKFLRFPLNDCGYYEKYSSFSEVNQAWDRKKHLRRKRWSQE* |
| Ga0129322_10443603 | 3300010306 | Aqueous | SRSKTVDRLLNGMILLKFLRFPLNDCGYYDKYSSFGEINQIWDKKKHLRRKRWSQE* |
| Ga0102890_10501713 | 3300010309 | Estuarine | TRARTFDRVLNGMILLKFLRFPFNDSGYYEKYASLAEVSQVWDKKKHLRRKRWSQE* |
| Ga0129333_104238161 | 3300010354 | Freshwater To Marine Saline Gradient | VLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE* |
| Ga0105239_119825403 | 3300010375 | Corn Rhizosphere | LFKFLRFPLNDCGYYEKYESFSEINRTWDKKRHLKRKRWSQE* |
| Ga0137784_13586624 | 3300010936 | Marine | MLLLKFLRFPLNDCGYYEKYESLTEVNKSWDKKKHLRRKRWSQE* |
| Ga0123365_10170761 | 3300012394 | Marine | LNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE* |
| Ga0138265_118281215 | 3300012408 | Polar Marine | LRFPLNDCGYYEKYSSLEEVNQNWDKKKHLRRKRWSQE* |
| Ga0138258_103079415 | 3300012413 | Polar Marine | MVLLKFLRFPLNDCGYYEKYASLAEVNQAWDKKKHLRRKRWSQE* |
| Ga0138258_12701961 | 3300012413 | Polar Marine | KTFDRILNGIILLKFLRFPLNDTGYYQKFESLSEVSQSWDKKKHLRRKRWSQE* |
| Ga0138258_16042741 | 3300012413 | Polar Marine | TFHRILNSLILLKLLRFPLNDCGYYEKYSSLEEINQTWDKKKHLRRKRWSQE* |
| Ga0138258_17564215 | 3300012413 | Polar Marine | FPLKDIGYYNKYSSLPEINQIWERKSHLKRKRWSQE* |
| Ga0138260_109103781 | 3300012419 | Polar Marine | KILNGMILFKFLRFPLNDCGYYDKYSSFSEVSQVWDRKRHLKRKRWSQE* |
| Ga0129334_10402161 | 3300012471 | Aqueous | LFKFLRFPLNDCGYYEKYSSFSEVSQVWDRKRHLKRKRWSQE* |
| Ga0129328_11360511 | 3300012472 | Aqueous | KFLRFPLNDCGYYEKYSSFSEINRTWDRKRHLKRKRWSQE* |
| Ga0129325_12055121 | 3300012516 | Aqueous | LNDCGYYTKYSSLEEINQTWDKKKHLRRKRWSQE* |
| Ga0129325_13127022 | 3300012516 | Aqueous | LLQFLRFPLNDCGYYDKYSSFGEINQIWDKKKHLRRKRWSQE* |
| Ga0129349_10577353 | 3300012518 | Aqueous | ILLKFLRFPLNDYGYYEKYTSLPQITKVWDRKKHLRRKRWSQE* |
| Ga0129350_14043592 | 3300012523 | Aqueous | LNDSGYYERYESISEIRQVWDRKKHLRRKRWSQE* |
| Ga0157611_10504741 | 3300012724 | Freshwater | RVLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWYKKKTLRRKRWSQE* |
| Ga0138268_16745254 | 3300012782 | Polar Marine | FKFLRFPLNDCGYYDKYSSFSEVSQIWDRKKHLKRKRWSQE* |
| Ga0138257_13710524 | 3300012935 | Polar Marine | MILFKFLRFPLNDCGYYEKYASIPEVNRAWDKKKHLKRKRWSQE* |
| Ga0138257_17161771 | 3300012935 | Polar Marine | PFNDSGHYEKYASLAEVSQVWDKKKHLRRKRWSQE* |
| Ga0163111_110544973 | 3300012954 | Surface Seawater | FPLNDCGYYDKYDSFAEINRTWDKKRHLKRKRWSQE* |
| Ga0129337_13618762 | 3300012968 | Aqueous | LNGMVLLKFLRFPLNDCGYYDKYSSFAEITQIWDKKKHLRRKRWSQD* |
| Ga0164305_100112819 | 3300012989 | Soil | DKILNGIILFKFLRFPLNDCGYYEKYESFSELNQAWDKKRHLKRKRWSQE* |
| (restricted) Ga0172369_105272052 | 3300013125 | Freshwater | LNGLILFRFLRFPLNDSGYYDKHSSFADINRVWDRKRHLKRKRWSQE* |
| Ga0132255_1005853301 | 3300015374 | Arabidopsis Rhizosphere | SIDKILNGMILFKFLRFPLNDCGYYEKYESFSEINRNWDKKRHLKRKRWSQE* |
| Ga0186201_1019321 | 3300016850 | Host-Associated | LFKFLRFPLNDCGYYDKYSSLSEVNQVWDRKKHLKRKRWSQE |
| Ga0181416_11294362 | 3300017731 | Seawater | VTGSASKKTTTFNNVLNGMILLKFLRFPLNDSGYYERYESLDEIRQVWDRKKHLRRKRWSQE |
| Ga0181385_12267231 | 3300017764 | Seawater | RSQTFDRVLNGMILLKFLRFPLNDCGYYEKYASLAEVNQSWDKKKHLRRKRWSQE |
| Ga0181385_12270772 | 3300017764 | Seawater | ILNGMILLKFLRFPLNDCGYYEKYASLAEVSQSWDKKRHLRRKRWSQE |
| Ga0192881_10012262 | 3300018603 | Marine | MILLKFLRFPLNDSGYYERYESLDEIRQVWDRKKHLRRKRWSQE |
| Ga0193339_10006675 | 3300018605 | Marine | GSINKILSGMILFKFLRFPLNDCGYYDKYEAFSEINRAWDRKRHLKRKRWSQE |
| Ga0193339_10035014 | 3300018605 | Marine | VKNRLLNGMILFKLLRFPLNDSGYYTKYSSLSEVSQFWDRKKPLRRKRWSQE |
| Ga0193376_10189082 | 3300018635 | Marine | ILNGMILFKFLRFPLNDCGYYDKYSSFSEVNQIWDKKRQLKRKRWSQE |
| Ga0192969_10051791 | 3300018649 | Marine | FPLNDCGYYEKYSSLEEVNQTWDKKKHLRRKRWSQE |
| Ga0193000_10091714 | 3300018745 | Marine | LNGMILFKFLRFPLNDCGYYDKHSSFAEVSQVWDRKKHLKRKRWSQE |
| Ga0193000_10713861 | 3300018745 | Marine | NGMILFKFLRFPLNDCGYYDKYSSFSEVNQIWDKKRQLKRKRWSQE |
| Ga0192950_10147261 | 3300018791 | Marine | FPLNDLGYYNKYSSLPEINQVWERKNHLKRKRWSQE |
| Ga0192956_10797711 | 3300018792 | Marine | KSMDKILNGMILFKFLRFPLNDCGYYDKYSSFSEVSQVWDRKRHLKRKRWSQE |
| Ga0192956_10833811 | 3300018792 | Marine | MILFKFLRFPLNDCGYYDKYSSFSEVSQVWDRKKHLKRKRWSQE |
| Ga0192872_10636581 | 3300018813 | Marine | LRFPLNDSGYYEKYESLQDISQTWDRKKHLRRKRWSQE |
| Ga0193312_10003341 | 3300018844 | Marine | TIDRILNGMVLLKFLRFPLNDCGYYDKYSSFAEINQIWDKKKHLRRKRWSQQ |
| Ga0192987_10631103 | 3300018911 | Marine | QTFDKILNSLILLKLLRFPLNDCGYYEKYSSLEEVNQTWDKKKHLRRKRWSQD |
| Ga0193083_100007981 | 3300018927 | Marine | RSIDKILNGMILFRFLRFPLNDCGYYDKYSSFYEINQTWDNKKHLKRKRWSQE |
| Ga0193083_100013454 | 3300018927 | Marine | RDKTFDRILNGIILLKFLRFPLNDSGYYQKFESLSEVNQSWDRKKHLRRKRWSQE |
| Ga0193426_100280541 | 3300018942 | Marine | LRFPLNDSGYYTKYSSFSEVNQFWDRKKHLRRKRWSQE |
| Ga0192947_100595473 | 3300018982 | Marine | LRFPLNDSGYYERYESLQDISQVWDRKKHLRRKRWSQE |
| Ga0193044_100283271 | 3300019010 | Marine | FPLNDCGYYDKYSSFGEINQVWDRKKHLRRKRWSQE |
| Ga0193044_100361111 | 3300019010 | Marine | GMILFKFLRFPLNDCGYYDKYEAFSEINRAWDRKRHLKRKRWSQE |
| Ga0192945_100052141 | 3300019036 | Marine | FKFLRFPLNDCGYYDKYSSFSEVSQVWDRKRHLKRKRWSQE |
| Ga0192981_103005872 | 3300019048 | Marine | SQTFDKILNSLILLKLLRFPLNDCGYYEKYSSLEEVNQTWDKKKHLRRKRWSQD |
| Ga0193082_100163844 | 3300019049 | Marine | TWGTTFNNVLNGMVLLKFLRFPLNDSGYYEKYESLNEISQVWDRKKHLRRKRWSQE |
| Ga0193356_101882803 | 3300019053 | Marine | TWGRKTIDRILNGIILFKFLRFPLNDSGYYNKYSSLPEINQVWDRKSHLKRKRWSQE |
| Ga0193102_10031421 | 3300019099 | Marine | LNDCGYYDKYSSFSEVNQVWDRKKHLKRKRWSQQE |
| Ga0193045_10131851 | 3300019100 | Marine | PLNDCGYYDKYSSFAEINQVWDKKKHLRRKRWSQQ |
| Ga0192946_10047224 | 3300019103 | Marine | SKSIDKILNGMILFKFLRFPLNDCGYYDKYSSFSEINQIWDKKRQLKRKRWSQE |
| Ga0193089_10113585 | 3300019133 | Marine | VDRVLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDRKKHLRRKRWSQE |
| Ga0193515_10162411 | 3300019134 | Marine | TRSATIDKVLNGMLLLKFLRFPLNDCGYYEKYESLAEVNKSWDKKKHLRRKRWSQE |
| Ga0192975_101971703 | 3300019153 | Marine | KLLRFPLNDCGYYEKYSSLEEVNQTWDKKKHLRRKRWSQE |
| Ga0194017_10152821 | 3300019696 | Sediment | MILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0193986_10081383 | 3300019698 | Sediment | LKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0194015_10160281 | 3300019701 | Sediment | VLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0193989_10535262 | 3300019707 | Sediment | PLNYSGYYEKYSSFSEVSQVWDRKKHLRRKRWSQE |
| Ga0193969_10449831 | 3300019712 | Sediment | KFLRFPLNDCGNYEKYSSFSEVNQAWDRKKHLRRKRWSQE |
| Ga0193972_10434341 | 3300019717 | Sediment | KSMDKILNGMILFKFLRFPLNDFGYYDKYSSFSEINQVWDRKKHLKRKRWSQE |
| Ga0194001_10219193 | 3300019730 | Sediment | KTVDRVLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0194013_100006211 | 3300019733 | Sediment | LLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0193988_10630592 | 3300019740 | Sediment | FLRFPLNDSGYYEKYSSFSEVSQVWDRKKHLRRKRWSQE |
| Ga0193965_10711252 | 3300019742 | Freshwater Microbial Mat | LNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0193961_10875193 | 3300019759 | Freshwater Microbial Mat | PLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0193960_11677862 | 3300019768 | Freshwater Microbial Mat | LFKFLRFPLNDCGNYEKYSSFSEVNQAWDRKKHLRRKRWSQE |
| Ga0193950_10076761 | 3300019935 | Freshwater Microbial Mat | ILFKFLRFPLKDSGYYNKYSSLLEIKEVWSQKKNLKRKRWSQN |
| Ga0194111_102036331 | 3300020083 | Freshwater Lake | VLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKTLRRKRWSQE |
| Ga0206124_101303963 | 3300020175 | Seawater | NGMILLKFLRFPLNDCGYYDKYSSLGEINQVWDKKKHLRRKRWSQE |
| Ga0163146_105705641 | 3300020219 | Freshwater Microbial Mat | MILFKFLRFPLNDCGYYEKYQSFSDINRAWDKKRHLKRKRWSQE |
| Ga0211686_104177941 | 3300020382 | Marine | LLKFLRFPFNDSGHYEKYASLAEVSQVWDKKKHLRRKRWSQE |
| Ga0211550_105034551 | 3300020453 | Marine | NGIILFKFLRFPLNDSGYYDKYSELSEVTQVWDKKKHLKRKRWSQE |
| Ga0210353_1038694 | 3300021267 | Estuarine | LRFPLNDCGYYDKYESFTEINRAWDKKRHLKRKRWSQE |
| Ga0210327_1365741 | 3300021274 | Estuarine | ILNGMILFKFLRFPLNDCGYYDKYSSIPEINRAWDKKKHLKRKRWSQE |
| Ga0210342_1158751 | 3300021275 | Estuarine | IDKILNGMILFKFLRFPLNDCGYYDKYSSIPEVNQVWDKKKHLKRKRWSQE |
| Ga0210303_10170082 | 3300021282 | Estuarine | VLLKFLRFPLNDCGYYDKYSSFAEITQIWDKKKHLRRKRWSQD |
| Ga0210349_10016101 | 3300021298 | Estuarine | YRSKTMDKILNGMILFKFLRFPLNDCGYYEKYSSFSEINQVWDRKKHLKRKRWSQE |
| Ga0210349_11508291 | 3300021298 | Estuarine | ILFKFLRFPLNDCGYYEKYSSFSEINQVWDKKKHLKRKRWSQE |
| Ga0210302_10185814 | 3300021299 | Estuarine | VLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKNLTS |
| Ga0210328_10352722 | 3300021302 | Estuarine | DKILNGMILFKFLRFPLNDCGYYEKYESFSDINRNWDKKKHLKRKRWSQE |
| Ga0210296_10074843 | 3300021305 | Estuarine | FPLNDSGYYDKYSSFSEINQVWDRKKHLKRKRWSQE |
| Ga0210296_11231806 | 3300021305 | Estuarine | ILFKFLRFPLNDCGYYNKYSSFSELNQAWDKKKHLKRKRWSQE |
| Ga0210350_10035471 | 3300021308 | Estuarine | IDKILNGMILFKFLRFPLNDCGYYEKYSSFSEVNQVWDRKRHLKRKRWSQE |
| Ga0210326_11509293 | 3300021309 | Estuarine | FPLNDCGYYDKYESFTDINRTWDKKRHLKRKRWSQE |
| Ga0210362_10164131 | 3300021329 | Estuarine | IDKILNGMILFKFLRFPLNDCGYYEKYDSFSDLNRTWDKKRHLKRKRWSQE |
| Ga0210347_12641571 | 3300021331 | Estuarine | ILFKFLRFPLNDCGYYDKYSSIPEINRAWDKKKHLKRKRWSQE |
| Ga0206696_10946951 | 3300021334 | Seawater | SPSTNGATFNNVLNGMVLLKFLRFPLNDSGYYEKYDSLEEISQVWDRKKHLRRKRWSQE |
| Ga0206696_12441698 | 3300021334 | Seawater | FKFLRFPLNDCGYYDKYSSFSEVSQVWDRKKHLKRKRWSQE |
| Ga0210335_13551771 | 3300021346 | Estuarine | IDKILNGMILFKFLRFPLNDCGYYDKYSSIPEINRAWDKKKHLKRKRWSQE |
| Ga0210335_14506421 | 3300021346 | Estuarine | KYQSKSIDRILNGMILFKFLRFPLNDCGYYEKYSSFSELSQVWDKKKHLKRKRWSQE |
| Ga0206692_12876603 | 3300021350 | Seawater | SKSMDKILNGMILFKFLRFPLNDCGYYDKYSSFSEVSQVWDRKKHLKRKRWSQE |
| Ga0213868_103162351 | 3300021389 | Seawater | RSQTFDRVLNGMILLKFLRFPLNDCGYYEKYASLAEVNQTWDKKKHLRRKRWSQE |
| Ga0193947_100064912 | 3300021465 | Sediment | FPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0210297_10200976 | 3300021845 | Estuarine | FLRFPLNDSGYYDKHSSFSEINRVWDRKRHLKRKRWSQE |
| Ga0222714_104944871 | 3300021961 | Estuarine Water | KSIDKILNGMILFKFLRFPLNDCGYYEKYESFSEINQIWDRKKHLKRKRWSQTQE |
| Ga0210310_10003966 | 3300022369 | Estuarine | TIDKVLNGMVLLKFLRFPLNDCGYYEKYSSLAEVSQSWDKKKHLRRKRWSQE |
| (restricted) Ga0233404_100911813 | 3300022913 | Seawater | DRILNGMILLKFLRFPLNDCGYYEKYASLNEVSQVWDKKKHLRRKRWSQE |
| (restricted) Ga0233406_100113791 | 3300023085 | Seawater | RSRTIDRVLNGMVLLKFLRFPLNDCGYYEKYESLAEVNQSWDKKKQLRRKRWSQE |
| (restricted) Ga0233406_100616681 | 3300023085 | Seawater | PKNRSRTIDKVLNGMVLLKFLRFPLNDCGYYEKYSSLAEVSQSWDKKKHLRRKRWSQE |
| Ga0222709_10398981 | 3300023230 | Saline Water | PLNDCGYYEKYSSFSEVNQVWERKKHLKRKRWSQE |
| (restricted) Ga0233403_101543113 | 3300023271 | Seawater | RFPLNDCGYYEKYASLAEVSQSWDKKKHLRRKRWSQE |
| (restricted) Ga0255039_100861114 | 3300024062 | Seawater | PLNDCGYYDKYSSLGEINQVWDKKKHLRRKRWSQE |
| Ga0244777_1000726315 | 3300024343 | Estuarine | LRFPLNDAGYYEKYYSLSQINQQWDRKKHLRRKRWSQE |
| Ga0244777_106971671 | 3300024343 | Estuarine | SSAKKTTFNNVLNGMVLLKFLRFPLNDSGYYEKYESLNEISQVWDRKKHLRRKRWSQE |
| Ga0209594_12395141 | 3300025130 | Groundwater | FRFLRFPLNDSGYYDKHSSFADINRVWDRKRHLKRKRWSQE |
| Ga0209304_10788081 | 3300025577 | Pelagic Marine | FLRFPLNDCGYYDKYSSLGEINQVWDKKKHLRRKRWSQE |
| Ga0209652_11823822 | 3300025684 | Marine | YRTTVMDRILNGMILFKFLRFPLNDSGYYDKYSSFSEINRVWDNKRHLKRKRWSQE |
| Ga0208784_10359044 | 3300025732 | Aqueous | FLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0208427_11032351 | 3300025771 | Aqueous | TTFNNVLNGMVLLKFLRFPLNDSGYYEKYESVNEISQVWDRKKHLRRKRWSQE |
| Ga0208543_11595471 | 3300025810 | Aqueous | KARSRTLDKVLNGMILFKFLRFPLNDCGYYEKYSSFSEVNQVWDRKKHLRRKRWSQE |
| Ga0210015_12304311 | 3300025831 | Aquifer | ESIDKILNGMILFKFLRFPLNDCGYYDKYESFTEINRAWDKKRHLKRKRWSQAQD |
| Ga0209603_12272742 | 3300025849 | Pelagic Marine | SSKKLKTRARILNGMILFKFLRFPLNDAGYYEKYSTLEEVNQVWERKKHLKRKRWSQE |
| Ga0209555_102505821 | 3300025879 | Marine | LNGMVLLKFLRFPLNDCGYYEKYSSLAEVSQSWDKKKHLRRKRWSQE |
| Ga0209555_103863331 | 3300025879 | Marine | LKFLRFPFNDSGYYEKYASLAEVSQVWDKKKHLRRKRWSQE |
| Ga0209630_102839823 | 3300025892 | Pelagic Marine | KTVDRVLNGMILLKFLRFPLNDCGYYDKYSSLGEINQVWDKKKHLRRKRWSQE |
| Ga0208916_101937371 | 3300025896 | Aqueous | ILNGMILFKFLRFPLNDCGYYEKYSSISEISQTWDKKKHLKRKRWSQE |
| Ga0207679_116057432 | 3300025945 | Corn Rhizosphere | QSMDKILNGMILFKFLRFPLNDCGYYEKYDSFSDLNRAWDKKRHLKRKRWSQE |
| Ga0209961_10749431 | 3300026130 | Water | KPIDKILNGMILFKFLRFPLNDCGYYEKYSSFAEVSQVWDRKKHLKRKRWSQE |
| Ga0208276_10111374 | 3300026166 | Marine | GMILFKFLRFPLNDCGYYDRYESFSDINKTWDKKRHLKRKRWSQE |
| Ga0209929_11010891 | 3300026187 | Pond Water | PKYNSKSMDKILNGMILLKFLRFPLNDCGYYEKYSSFSEANQIWDRKKHLKRKRWSQE |
| Ga0208800_10583352 | 3300027193 | Estuarine | TIDRVLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0208676_10168282 | 3300027195 | Estuarine | DKILNGMILFKFLRFPLNDCGYYEKYSSFSEVNRAWDRKRHLKRKRWSQE |
| Ga0208922_10593181 | 3300027197 | Estuarine | LNGMVLLKFLRFPLNDSGYYERYESVSEISQVWDRKKHLRRKRWSQE |
| Ga0208925_1010771 | 3300027203 | Estuarine | LKFLRFPLNDCGYYDKYSSFGEINQIWDKKKHLRRKRWSQE |
| Ga0208554_10264773 | 3300027212 | Estuarine | LRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0208166_10224233 | 3300027215 | Estuarine | FLRFPLNDCGYYDKYSSFGEINQVWDKKKTLRRKRWSQE |
| Ga0208165_10258053 | 3300027218 | Estuarine | VLNGMILLKFLRFPLNDCGYYDKYSSLGEINQVWDKKKHLRRKRWSQE |
| Ga0208165_10471161 | 3300027218 | Estuarine | GMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0208308_10036851 | 3300027228 | Estuarine | ATIDKVLNGMLLLKFLRFPLNDCGYYEKYESLAEVNKSWDKKKHLRRKRWSQE |
| Ga0208171_10236172 | 3300027230 | Estuarine | GMVLLKFLRFPLNDSGYYERYESVSEISQVWDRKKHLRRKRWSQE |
| Ga0208445_10115363 | 3300027245 | Estuarine | NRSRTIDKVLNGMILLKFLRFPLNDCGYYEKYASLAEVSQSWDKKKHLRRKRWSQE |
| Ga0208796_10322401 | 3300027308 | Estuarine | DRILNGIILLKFLRFPLNDSGYYQKFESLSEVNQSWDRKKHLRRKRWSQE |
| Ga0208022_10143595 | 3300027418 | Estuarine | RFPLNDCGYYDKYSSFGEINQVWDKKKTLRRKRWSQE |
| Ga0208437_10404713 | 3300027525 | Estuarine | LRFPLNDCGYYDKYSSFGEINQVWYKKKTLRRKRWSQE |
| Ga0208974_11171731 | 3300027608 | Freshwater Lentic | TIDRVLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKTLRRKRWSQE |
| Ga0209815_100319816 | 3300027714 | Marine | MLGGMILFEFLRFPLNDCGYYEKYTSVSEINKTWERKKHLNRKRWSQSLN |
| Ga0209815_10710621 | 3300027714 | Marine | VLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDRKKHLRRKRWSQE |
| Ga0208304_100575634 | 3300027751 | Estuarine | RLLSGMILLNFLRFPLNDCGIYSKYSTASELNSNWDRKRHLRRKRWSQE |
| Ga0208304_101470633 | 3300027751 | Estuarine | KTIDRVLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKTLRRKRWSQE |
| Ga0209175_103338682 | 3300027781 | Wastewater Effluent | FLRFPLNDCGYYEKYDSFSDLNRAWDKKRHLKRKRWSQE |
| Ga0209812_100618111 | 3300027786 | Wastewater Effluent | TVDKILNGMILFKFLRFPLNDCGYYDKYSSFSEINRAWDKKRHLKRKRWSQE |
| Ga0209302_101468271 | 3300027810 | Marine | PLNDCGYYDKYSSFSEVSQIWDRKKHLKRKRWSQE |
| (restricted) Ga0233413_101672613 | 3300027996 | Seawater | RSRTIDRILNGMILLKFLRFPLNDCGYYEKYASLNEVSQVWDKKKHLRRKRWSQE |
| (restricted) Ga0233414_106012991 | 3300028045 | Seawater | TMEKTLNGMILFNFLRFPLNDCGSYEKYSTLSEINTSWERKKHLRRKRWSHD |
| Ga0210315_10237371 | 3300028329 | Estuarine | RILNGMILFRFLRFPLNDSGYYDKHSSFSEINRVWDRKRHLKRKRWSQE |
| Ga0265309_109968342 | 3300028599 | Sediment | HYRSKSIDKILNGMILFKFLRFPLNDCGYYEKYSSIPEINQAWDKKKHLKRKRWSQE |
| Ga0265303_113731551 | 3300028600 | Sediment | FKFLKFPLNDCGYYEKYESFAEINYTWDKKRHLKRKRWSQE |
| Ga0307401_103593883 | 3300030670 | Marine | FPLNDCGYYDKYSSFSEVSQVWDRKRHLKRKRWSQE |
| Ga0307996_10207481 | 3300031589 | Marine | RFPLNDCGYYDKYSSFGEINQVWDKKKHLRRKRWSQE |
| Ga0315332_108028811 | 3300031773 | Seawater | RVLNGMILLKFLRFPLNDCGYYDKYSSLGEINQVWDKKKHLRRKRWSQE |
| Ga0310343_108834933 | 3300031785 | Seawater | LFKFLRFPLNDCGYYDKYSSFSEVNQVWDRKKHLKRKRWSQQE |
| Ga0315905_103498891 | 3300032092 | Freshwater | SKTVNRVLNGMVLLKFLRFPLNDCGYYDKYSSFAEINQIWDKKKHLRRKRWSQD |
| Ga0315295_119869961 | 3300032156 | Sediment | DKILNGMILFKFLRFPLNDCGYYEKYSSFSEINQVWDRKKHLKRKRWSQE |
| Ga0316191_112685472 | 3300032258 | Worm Burrow | SNSIDKILNGMILFKFLRFPLNDCGYYDKYESFSDVNQAWDKKRHLKRKRWSQE |
| Ga0316195_104103943 | 3300032263 | Sediment | LRFPLNDCGYYDKYESFTDINRTWDKKRHLKRKRWSQE |
| Ga0315270_106708791 | 3300032275 | Sediment | SKTIDRVLNGMILLKFLRFPLNDCGYYDKYSSFGEINQVWDKKKTLRRKRWSQE |
| Ga0316188_105088721 | 3300032276 | Worm Burrow | SESIDRILNGMILFKFLRFPLNDCGYYDKYSSFSEINQIWDNKKSLKRKRWSQE |
| Ga0334978_0457477_3_158 | 3300033979 | Freshwater | MDRILNGMILFRFLRFPLNDSGYYDKHSSFSEINRVWDRKRHLKRKRWSQE |
| Ga0334992_0465487_49_183 | 3300033992 | Freshwater | MILLKFLRFPLNDCGYYDKYSSFGEINQVWYKKKTLRRKRWSQE |
| Ga0334997_0224067_1064_1228 | 3300034280 | Freshwater | SKSMDKILNGMILFKFLRFPLNDCGYYDKYSSFSEVNQVWDRKKHFKRKRWSQE |
| ⦗Top⦘ |