


| Basic Information | |
|---|---|
| Family ID | F012874 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 276 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINV |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 276 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.95 % |
| % of genes near scaffold ends (potentially truncated) | 52.90 % |
| % of genes from short scaffolds (< 2000 bps) | 73.91 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.652 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow (17.754 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.420 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (38.768 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 276 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 2.17 |
| PF12224 | Amidoligase_2 | 2.17 |
| PF01645 | Glu_synthase | 2.17 |
| PF13183 | Fer4_8 | 1.81 |
| PF00528 | BPD_transp_1 | 1.81 |
| PF13416 | SBP_bac_8 | 1.45 |
| PF13549 | ATP-grasp_5 | 1.45 |
| PF13607 | Succ_CoA_lig | 1.45 |
| PF00583 | Acetyltransf_1 | 1.09 |
| PF04290 | DctQ | 1.09 |
| PF00817 | IMS | 1.09 |
| PF00106 | adh_short | 1.09 |
| PF00534 | Glycos_transf_1 | 1.09 |
| PF12897 | Asp_aminotransf | 1.09 |
| PF04029 | 2-ph_phosp | 0.72 |
| PF00137 | ATP-synt_C | 0.72 |
| PF01636 | APH | 0.72 |
| PF02646 | RmuC | 0.72 |
| PF00561 | Abhydrolase_1 | 0.72 |
| PF14622 | Ribonucleas_3_3 | 0.72 |
| PF03576 | Peptidase_S58 | 0.72 |
| PF02470 | MlaD | 0.72 |
| PF08545 | ACP_syn_III | 0.72 |
| PF07238 | PilZ | 0.72 |
| PF00890 | FAD_binding_2 | 0.72 |
| PF02915 | Rubrerythrin | 0.72 |
| PF00072 | Response_reg | 0.72 |
| PF05170 | AsmA | 0.72 |
| PF08450 | SGL | 0.72 |
| PF00483 | NTP_transferase | 0.72 |
| PF01297 | ZnuA | 0.72 |
| PF00294 | PfkB | 0.72 |
| PF05573 | NosL | 0.72 |
| PF02662 | FlpD | 0.72 |
| PF00300 | His_Phos_1 | 0.36 |
| PF02585 | PIG-L | 0.36 |
| PF02572 | CobA_CobO_BtuR | 0.36 |
| PF13458 | Peripla_BP_6 | 0.36 |
| PF08666 | SAF | 0.36 |
| PF08264 | Anticodon_1 | 0.36 |
| PF04024 | PspC | 0.36 |
| PF12418 | AcylCoA_DH_N | 0.36 |
| PF16868 | NMT1_3 | 0.36 |
| PF16363 | GDP_Man_Dehyd | 0.36 |
| PF01219 | DAGK_prokar | 0.36 |
| PF13279 | 4HBT_2 | 0.36 |
| PF00463 | ICL | 0.36 |
| PF12146 | Hydrolase_4 | 0.36 |
| PF00180 | Iso_dh | 0.36 |
| PF00355 | Rieske | 0.36 |
| PF00109 | ketoacyl-synt | 0.36 |
| PF00430 | ATP-synt_B | 0.36 |
| PF01381 | HTH_3 | 0.36 |
| PF02934 | GatB_N | 0.36 |
| PF13371 | TPR_9 | 0.36 |
| PF02274 | ADI | 0.36 |
| PF13242 | Hydrolase_like | 0.36 |
| PF00753 | Lactamase_B | 0.36 |
| PF01977 | UbiD | 0.36 |
| PF13442 | Cytochrome_CBB3 | 0.36 |
| PF00476 | DNA_pol_A | 0.36 |
| PF02604 | PhdYeFM_antitox | 0.36 |
| PF01144 | CoA_trans | 0.36 |
| PF02608 | Bmp | 0.36 |
| PF02538 | Hydantoinase_B | 0.36 |
| PF00793 | DAHP_synth_1 | 0.36 |
| PF00892 | EamA | 0.36 |
| PF01416 | PseudoU_synth_1 | 0.36 |
| PF01966 | HD | 0.36 |
| PF00389 | 2-Hacid_dh | 0.36 |
| PF03692 | CxxCxxCC | 0.36 |
| PF00589 | Phage_integrase | 0.36 |
| PF14522 | Cytochrome_C7 | 0.36 |
| PF03328 | HpcH_HpaI | 0.36 |
| PF16199 | Radical_SAM_C | 0.36 |
| PF01894 | UPF0047 | 0.36 |
| PF01261 | AP_endonuc_2 | 0.36 |
| PF00482 | T2SSF | 0.36 |
| PF08402 | TOBE_2 | 0.36 |
| PF00990 | GGDEF | 0.36 |
| PF02517 | Rce1-like | 0.36 |
| PF08821 | CGGC | 0.36 |
| PF00202 | Aminotran_3 | 0.36 |
| PF05973 | Gp49 | 0.36 |
| PF05157 | T2SSE_N | 0.36 |
| PF10518 | TAT_signal | 0.36 |
| PF07885 | Ion_trans_2 | 0.36 |
| PF13173 | AAA_14 | 0.36 |
| PF02627 | CMD | 0.36 |
| PF00196 | GerE | 0.36 |
| PF11006 | DUF2845 | 0.36 |
| PF00850 | Hist_deacetyl | 0.36 |
| PF07949 | YbbR | 0.36 |
| PF13239 | 2TM | 0.36 |
| PF14559 | TPR_19 | 0.36 |
| PF01740 | STAS | 0.36 |
| PF00211 | Guanylate_cyc | 0.36 |
| PF10035 | DUF2179 | 0.36 |
| PF01955 | CbiZ | 0.36 |
| PF00144 | Beta-lactamase | 0.36 |
| PF12804 | NTP_transf_3 | 0.36 |
| PF02911 | Formyl_trans_C | 0.36 |
| PF04909 | Amidohydro_2 | 0.36 |
| PF05670 | NFACT-R_1 | 0.36 |
| PF06315 | AceK_kinase | 0.36 |
| PF02321 | OEP | 0.36 |
| PF00348 | polyprenyl_synt | 0.36 |
| PF14358 | DUF4405 | 0.36 |
| PF01625 | PMSR | 0.36 |
| PF02518 | HATPase_c | 0.36 |
| PF02629 | CoA_binding | 0.36 |
| PF11812 | DUF3333 | 0.36 |
| PF09339 | HTH_IclR | 0.36 |
| PF00291 | PALP | 0.36 |
| PF00724 | Oxidored_FMN | 0.36 |
| PF13193 | AMP-binding_C | 0.36 |
| PF01370 | Epimerase | 0.36 |
| PF14241 | Obsolete Pfam Family | 0.36 |
| PF08245 | Mur_ligase_M | 0.36 |
| PF08843 | AbiEii | 0.36 |
| PF03462 | PCRF | 0.36 |
| PF09835 | DUF2062 | 0.36 |
| PF13847 | Methyltransf_31 | 0.36 |
| PF02852 | Pyr_redox_dim | 0.36 |
| PF16177 | ACAS_N | 0.36 |
| PF01891 | CbiM | 0.36 |
| PF00488 | MutS_V | 0.36 |
| PF02663 | FmdE | 0.36 |
| PF01326 | PPDK_N | 0.36 |
| PF00011 | HSP20 | 0.36 |
| PF07610 | DUF1573 | 0.36 |
| PF11845 | DUF3365 | 0.36 |
| PF11799 | IMS_C | 0.36 |
| PF12706 | Lactamase_B_2 | 0.36 |
| PF13386 | DsbD_2 | 0.36 |
| PF02142 | MGS | 0.36 |
| PF07969 | Amidohydro_3 | 0.36 |
| PF01061 | ABC2_membrane | 0.36 |
| PF13394 | Fer4_14 | 0.36 |
| PF07582 | Obsolete Pfam Family | 0.36 |
| PF13230 | GATase_4 | 0.36 |
| PF12838 | Fer4_7 | 0.36 |
| PF10133 | CooT | 0.36 |
| PF01244 | Peptidase_M19 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 276 Family Scaffolds |
|---|---|---|---|
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 2.17 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 2.17 |
| COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 1.45 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.45 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 1.09 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 0.72 |
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 0.72 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.72 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1908 | Coenzyme F420-reducing hydrogenase, delta subunit | Energy production and conversion [C] | 0.72 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.72 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.72 |
| COG4314 | Nitrous oxide reductase accessory protein NosL | Inorganic ion transport and metabolism [P] | 0.72 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.36 |
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.36 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 0.36 |
| COG0310 | ABC-type Co2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.36 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.36 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.36 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.36 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.36 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 0.36 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.36 |
| COG0818 | Diacylglycerol kinase | Lipid transport and metabolism [I] | 0.36 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 0.36 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG1293 | Ribosome quality control (RQC) protein RqcH, Rqc2/NEMF/Tae2 family, contains fibronectin-(FbpA) and RNA- (NFACT) binding domains | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.36 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG1744 | Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupN | Signal transduction mechanisms [T] | 0.36 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.36 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.36 |
| COG1865 | Adenosylcobinamide amidohydrolase | Coenzyme transport and metabolism [H] | 0.36 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.36 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.36 |
| COG2109 | ATP:corrinoid adenosyltransferase | Coenzyme transport and metabolism [H] | 0.36 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.36 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.36 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.36 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.36 |
| COG2191 | Formylmethanofuran dehydrogenase subunit E | Energy production and conversion [C] | 0.36 |
| COG2224 | Isocitrate lyase | Energy production and conversion [C] | 0.36 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.36 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.36 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.36 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.36 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.36 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.36 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.36 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.36 |
| COG4579 | Isocitrate dehydrogenase kinase/phosphatase | Signal transduction mechanisms [T] | 0.36 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.36 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.36 |
| COG4856 | Cyclic di-AMP synthase regulator CdaR, YbbR domain | Signal transduction mechanisms [T] | 0.36 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.36 |
| COG5561 | Predicted metal-binding protein, contains CGGC domain | Function unknown [S] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.01 % |
| Unclassified | root | N/A | 28.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000242|TDF_OR_ARG05_123mDRAFT_1008647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2699 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1091393 | Not Available | 582 | Open in IMG/M |
| 3300000568|Draft_10666689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3647 | Open in IMG/M |
| 3300002180|JGI24724J26744_10110942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 965 | Open in IMG/M |
| 3300003988|Ga0055475_10237099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 579 | Open in IMG/M |
| 3300004001|Ga0055450_10077143 | Not Available | 1173 | Open in IMG/M |
| 3300004001|Ga0055450_10096501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 1055 | Open in IMG/M |
| 3300004007|Ga0055476_10215374 | Not Available | 666 | Open in IMG/M |
| 3300004008|Ga0055446_10023520 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1329 | Open in IMG/M |
| 3300004008|Ga0055446_10163909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 646 | Open in IMG/M |
| 3300004028|Ga0055447_10137256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 744 | Open in IMG/M |
| 3300004028|Ga0055447_10145337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 728 | Open in IMG/M |
| 3300004030|Ga0055444_10013920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2263 | Open in IMG/M |
| 3300004030|Ga0055444_10335262 | Not Available | 587 | Open in IMG/M |
| 3300004147|Ga0055515_10223548 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005145|Ga0068713_1063169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1317 | Open in IMG/M |
| 3300005182|Ga0069000_10058289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
| 3300005215|Ga0069001_10049803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 973 | Open in IMG/M |
| 3300005252|Ga0068712_1014938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4434 | Open in IMG/M |
| 3300005254|Ga0068714_10000083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 192981 | Open in IMG/M |
| 3300005588|Ga0070728_10030373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3780 | Open in IMG/M |
| 3300005588|Ga0070728_10102706 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300005589|Ga0070729_10177589 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300005589|Ga0070729_10684391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300005589|Ga0070729_10686553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 550 | Open in IMG/M |
| 3300005590|Ga0070727_10065526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2140 | Open in IMG/M |
| 3300005590|Ga0070727_10763232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 542 | Open in IMG/M |
| 3300005600|Ga0070726_10034039 | All Organisms → cellular organisms → Bacteria | 2958 | Open in IMG/M |
| 3300005600|Ga0070726_10144136 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300005600|Ga0070726_10672528 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005612|Ga0070723_10033186 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
| 3300005612|Ga0070723_10270376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 794 | Open in IMG/M |
| 3300005825|Ga0074476_1602354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 691 | Open in IMG/M |
| 3300005920|Ga0070725_10141805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1039 | Open in IMG/M |
| 3300005920|Ga0070725_10515646 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006467|Ga0099972_10198302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 589 | Open in IMG/M |
| 3300006467|Ga0099972_10311415 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300006467|Ga0099972_10831869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 644 | Open in IMG/M |
| 3300006467|Ga0099972_10860508 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300006467|Ga0099972_11182035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1758 | Open in IMG/M |
| 3300006467|Ga0099972_11522778 | Not Available | 1654 | Open in IMG/M |
| 3300006467|Ga0099972_11988869 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300006467|Ga0099972_12052977 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300006467|Ga0099972_13021138 | Not Available | 953 | Open in IMG/M |
| 3300006467|Ga0099972_13196808 | Not Available | 2064 | Open in IMG/M |
| 3300006467|Ga0099972_13217760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 952 | Open in IMG/M |
| 3300007102|Ga0102541_1116523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 840 | Open in IMG/M |
| 3300007102|Ga0102541_1257603 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300007784|Ga0102955_1004707 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
| 3300007784|Ga0102955_1007868 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300007784|Ga0102955_1034058 | Not Available | 1189 | Open in IMG/M |
| 3300007784|Ga0102955_1047476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfocapsaceae | 1033 | Open in IMG/M |
| 3300007784|Ga0102955_1084705 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300007784|Ga0102955_1226591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 541 | Open in IMG/M |
| 3300009027|Ga0102957_1220086 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009033|Ga0102956_1001675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7446 | Open in IMG/M |
| 3300009033|Ga0102956_1004353 | All Organisms → cellular organisms → Bacteria | 4438 | Open in IMG/M |
| 3300009033|Ga0102956_1025097 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp. | 1824 | Open in IMG/M |
| 3300009033|Ga0102956_1028312 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300009033|Ga0102956_1231532 | Not Available | 622 | Open in IMG/M |
| 3300009033|Ga0102956_1316701 | Not Available | 541 | Open in IMG/M |
| 3300009079|Ga0102814_10844518 | Not Available | 507 | Open in IMG/M |
| 3300009138|Ga0102959_1094379 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300009145|Ga0102961_1052933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
| 3300009145|Ga0102961_1054552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 949 | Open in IMG/M |
| 3300010330|Ga0136651_10208424 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300010353|Ga0116236_10044653 | All Organisms → cellular organisms → Bacteria | 4808 | Open in IMG/M |
| 3300010392|Ga0118731_100056805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1547 | Open in IMG/M |
| 3300010392|Ga0118731_100334816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2017 | Open in IMG/M |
| 3300010392|Ga0118731_100875667 | Not Available | 2283 | Open in IMG/M |
| 3300010392|Ga0118731_101192184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 702 | Open in IMG/M |
| 3300010392|Ga0118731_101257581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2497 | Open in IMG/M |
| 3300010392|Ga0118731_101264406 | Not Available | 511 | Open in IMG/M |
| 3300010392|Ga0118731_101670985 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300010392|Ga0118731_102004239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → unclassified Desulfobacter → Desulfobacter sp. | 1030 | Open in IMG/M |
| 3300010392|Ga0118731_102311005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1670 | Open in IMG/M |
| 3300010392|Ga0118731_102565364 | All Organisms → cellular organisms → Bacteria | 8515 | Open in IMG/M |
| 3300010392|Ga0118731_103740915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3441 | Open in IMG/M |
| 3300010392|Ga0118731_105468616 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp. | 1667 | Open in IMG/M |
| 3300010392|Ga0118731_105568879 | Not Available | 636 | Open in IMG/M |
| 3300010392|Ga0118731_110042279 | Not Available | 837 | Open in IMG/M |
| 3300010392|Ga0118731_111865635 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
| 3300010392|Ga0118731_112792046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1053 | Open in IMG/M |
| 3300010392|Ga0118731_114598100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 849 | Open in IMG/M |
| 3300010392|Ga0118731_114989225 | Not Available | 629 | Open in IMG/M |
| 3300010430|Ga0118733_100100939 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 5825 | Open in IMG/M |
| 3300010430|Ga0118733_100237818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3603 | Open in IMG/M |
| 3300010430|Ga0118733_100403897 | All Organisms → cellular organisms → Bacteria | 2707 | Open in IMG/M |
| 3300010430|Ga0118733_100558485 | Not Available | 2276 | Open in IMG/M |
| 3300010430|Ga0118733_100686026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2040 | Open in IMG/M |
| 3300010430|Ga0118733_100883976 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300010430|Ga0118733_101221572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3 | 1501 | Open in IMG/M |
| 3300010430|Ga0118733_101532123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1329 | Open in IMG/M |
| 3300010430|Ga0118733_101768543 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300010430|Ga0118733_102657453 | Not Available | 988 | Open in IMG/M |
| 3300010430|Ga0118733_103008414 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300010430|Ga0118733_103153753 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300010430|Ga0118733_104259498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 765 | Open in IMG/M |
| 3300010430|Ga0118733_105238910 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300010430|Ga0118733_106730061 | Not Available | 599 | Open in IMG/M |
| 3300010430|Ga0118733_106798569 | Not Available | 596 | Open in IMG/M |
| 3300010430|Ga0118733_107614759 | Not Available | 561 | Open in IMG/M |
| 3300010430|Ga0118733_108421584 | Not Available | 533 | Open in IMG/M |
| 3300010430|Ga0118733_109449526 | Not Available | 502 | Open in IMG/M |
| 3300013099|Ga0164315_10019168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5407 | Open in IMG/M |
| 3300013101|Ga0164313_10136995 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10059891 | All Organisms → cellular organisms → Bacteria | 3867 | Open in IMG/M |
| 3300015370|Ga0180009_10058873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2309 | Open in IMG/M |
| 3300017990|Ga0180436_10670452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 775 | Open in IMG/M |
| 3300019710|Ga0194009_1034364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 622 | Open in IMG/M |
| 3300019719|Ga0193977_1024729 | Not Available | 708 | Open in IMG/M |
| 3300019741|Ga0194020_1032071 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300019756|Ga0194023_1092398 | Not Available | 610 | Open in IMG/M |
| 3300021297|Ga0210369_1037246 | Not Available | 594 | Open in IMG/M |
| 3300021511|Ga0190284_1137102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 515 | Open in IMG/M |
| 3300021514|Ga0190293_1003004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5722 | Open in IMG/M |
| 3300022201|Ga0224503_10003056 | All Organisms → cellular organisms → Bacteria | 4881 | Open in IMG/M |
| 3300022201|Ga0224503_10016382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2132 | Open in IMG/M |
| 3300022201|Ga0224503_10032628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1544 | Open in IMG/M |
| 3300022201|Ga0224503_10143837 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300022202|Ga0224498_10004791 | All Organisms → cellular organisms → Bacteria | 3555 | Open in IMG/M |
| 3300022202|Ga0224498_10008955 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
| 3300022202|Ga0224498_10080814 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300022206|Ga0224499_10044673 | Not Available | 1451 | Open in IMG/M |
| 3300022206|Ga0224499_10073377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1147 | Open in IMG/M |
| 3300022206|Ga0224499_10118529 | Not Available | 899 | Open in IMG/M |
| 3300022206|Ga0224499_10125623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 872 | Open in IMG/M |
| 3300022206|Ga0224499_10214821 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300022217|Ga0224514_10011945 | All Organisms → cellular organisms → Bacteria | 2734 | Open in IMG/M |
| 3300022217|Ga0224514_10012880 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
| 3300022217|Ga0224514_10032690 | Not Available | 1714 | Open in IMG/M |
| 3300022217|Ga0224514_10114969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-15 | 932 | Open in IMG/M |
| 3300022217|Ga0224514_10152884 | Not Available | 811 | Open in IMG/M |
| 3300022217|Ga0224514_10191746 | Not Available | 728 | Open in IMG/M |
| 3300022217|Ga0224514_10249052 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300022217|Ga0224514_10417986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 500 | Open in IMG/M |
| 3300022218|Ga0224502_10009818 | All Organisms → cellular organisms → Bacteria | 3474 | Open in IMG/M |
| 3300022218|Ga0224502_10012710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3068 | Open in IMG/M |
| 3300022218|Ga0224502_10020841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2426 | Open in IMG/M |
| 3300022218|Ga0224502_10027602 | Not Available | 2110 | Open in IMG/M |
| 3300022218|Ga0224502_10041637 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300022218|Ga0224502_10051428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1546 | Open in IMG/M |
| 3300022218|Ga0224502_10408347 | Not Available | 527 | Open in IMG/M |
| 3300022218|Ga0224502_10428861 | Not Available | 514 | Open in IMG/M |
| 3300022220|Ga0224513_10004528 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 5344 | Open in IMG/M |
| 3300022220|Ga0224513_10014505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2885 | Open in IMG/M |
| 3300022220|Ga0224513_10104254 | Not Available | 1084 | Open in IMG/M |
| 3300022220|Ga0224513_10270570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 674 | Open in IMG/M |
| 3300022306|Ga0224509_10008557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 3245 | Open in IMG/M |
| 3300022306|Ga0224509_10086925 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300022306|Ga0224509_10292754 | Not Available | 591 | Open in IMG/M |
| 3300022308|Ga0224504_10019280 | All Organisms → cellular organisms → Bacteria | 2636 | Open in IMG/M |
| 3300022389|Ga0210318_1047253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 765 | Open in IMG/M |
| 3300022391|Ga0210374_1051970 | Not Available | 752 | Open in IMG/M |
| 3300022391|Ga0210374_1147515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 514 | Open in IMG/M |
| 3300022396|Ga0210364_1164343 | Not Available | 519 | Open in IMG/M |
| 3300022552|Ga0212118_10527214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfosalsimonadaceae → Desulfosalsimonas → Desulfosalsimonas propionicica | 622 | Open in IMG/M |
| (restricted) 3300023089|Ga0233408_10117409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 578 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10179550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 914 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10292096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300025156|Ga0209834_10273165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfosalsimonadaceae → Desulfosalsimonas → Desulfosalsimonas propionicica | 624 | Open in IMG/M |
| 3300025561|Ga0210119_1011941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1567 | Open in IMG/M |
| 3300025561|Ga0210119_1016638 | Not Available | 1342 | Open in IMG/M |
| 3300025561|Ga0210119_1039623 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300025561|Ga0210119_1052409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfocapsaceae → Desulfofustis → Desulfofustis glycolicus | 776 | Open in IMG/M |
| 3300025566|Ga0210140_1135933 | Not Available | 515 | Open in IMG/M |
| 3300025583|Ga0210085_1061649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1055 | Open in IMG/M |
| 3300025599|Ga0210074_1037476 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1367 | Open in IMG/M |
| 3300025599|Ga0210074_1152296 | Not Available | 611 | Open in IMG/M |
| 3300025950|Ga0210134_1007061 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300025958|Ga0210069_1000233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 10441 | Open in IMG/M |
| 3300025958|Ga0210069_1002052 | All Organisms → cellular organisms → Bacteria | 2555 | Open in IMG/M |
| 3300025968|Ga0210103_1000883 | All Organisms → cellular organisms → Bacteria | 5801 | Open in IMG/M |
| 3300025968|Ga0210103_1003598 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
| 3300025969|Ga0210080_1000610 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 4103 | Open in IMG/M |
| 3300025984|Ga0210082_1011758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1328 | Open in IMG/M |
| 3300025991|Ga0210128_1012793 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300026059|Ga0208540_1001859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1956 | Open in IMG/M |
| 3300026106|Ga0209927_1012415 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300026126|Ga0209957_1003204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3714 | Open in IMG/M |
| 3300026126|Ga0209957_1006329 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 2655 | Open in IMG/M |
| 3300026131|Ga0209928_1050405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 628 | Open in IMG/M |
| 3300027536|Ga0209163_1090829 | Not Available | 778 | Open in IMG/M |
| 3300027592|Ga0209270_1003663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12900 | Open in IMG/M |
| 3300027592|Ga0209270_1040556 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300027690|Ga0209164_1000236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 167696 | Open in IMG/M |
| 3300027758|Ga0209379_10041310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1796 | Open in IMG/M |
| 3300027790|Ga0209273_10077826 | Not Available | 1490 | Open in IMG/M |
| 3300027790|Ga0209273_10089432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1371 | Open in IMG/M |
| 3300027820|Ga0209578_10040226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2432 | Open in IMG/M |
| 3300027828|Ga0209692_10230972 | Not Available | 838 | Open in IMG/M |
| 3300027828|Ga0209692_10373008 | Not Available | 615 | Open in IMG/M |
| 3300027845|Ga0209271_10010599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3622 | Open in IMG/M |
| 3300027845|Ga0209271_10035528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 2063 | Open in IMG/M |
| 3300027858|Ga0209013_10059655 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300027858|Ga0209013_10107635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1812 | Open in IMG/M |
| 3300027917|Ga0209536_100372711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1784 | Open in IMG/M |
| 3300027917|Ga0209536_100661248 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300027917|Ga0209536_101193248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 933 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10554420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300028420|Ga0210366_10227579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 720 | Open in IMG/M |
| 3300028598|Ga0265306_10781781 | Not Available | 529 | Open in IMG/M |
| 3300028600|Ga0265303_10253299 | Not Available | 1363 | Open in IMG/M |
| 3300032231|Ga0316187_10050911 | All Organisms → cellular organisms → Bacteria | 3308 | Open in IMG/M |
| 3300032231|Ga0316187_10063857 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 2917 | Open in IMG/M |
| 3300032231|Ga0316187_10071658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2738 | Open in IMG/M |
| 3300032231|Ga0316187_10243836 | Not Available | 1380 | Open in IMG/M |
| 3300032231|Ga0316187_10413539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1018 | Open in IMG/M |
| 3300032231|Ga0316187_10575473 | Not Available | 840 | Open in IMG/M |
| 3300032231|Ga0316187_10739843 | Not Available | 727 | Open in IMG/M |
| 3300032231|Ga0316187_10933270 | Not Available | 638 | Open in IMG/M |
| 3300032231|Ga0316187_11418152 | Not Available | 506 | Open in IMG/M |
| 3300032251|Ga0316198_10284228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 940 | Open in IMG/M |
| 3300032251|Ga0316198_10489201 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300032252|Ga0316196_10055699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Leisingera → unclassified Leisingera → Leisingera sp. ANG-M1 | 1858 | Open in IMG/M |
| 3300032252|Ga0316196_10132292 | Not Available | 1144 | Open in IMG/M |
| 3300032252|Ga0316196_10158233 | Not Available | 1028 | Open in IMG/M |
| 3300032252|Ga0316196_10164188 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300032252|Ga0316196_10193429 | Not Available | 910 | Open in IMG/M |
| 3300032258|Ga0316191_10056504 | All Organisms → cellular organisms → Bacteria | 2900 | Open in IMG/M |
| 3300032258|Ga0316191_10116703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1953 | Open in IMG/M |
| 3300032258|Ga0316191_10191395 | Not Available | 1493 | Open in IMG/M |
| 3300032258|Ga0316191_10355091 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 1067 | Open in IMG/M |
| 3300032258|Ga0316191_10375906 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300032258|Ga0316191_10403755 | Not Available | 995 | Open in IMG/M |
| 3300032258|Ga0316191_10478179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 906 | Open in IMG/M |
| 3300032258|Ga0316191_10503107 | Not Available | 881 | Open in IMG/M |
| 3300032258|Ga0316191_10532409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300032258|Ga0316191_10593462 | Not Available | 805 | Open in IMG/M |
| 3300032258|Ga0316191_11194091 | Not Available | 550 | Open in IMG/M |
| 3300032258|Ga0316191_11367482 | Not Available | 511 | Open in IMG/M |
| 3300032259|Ga0316190_10082547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2263 | Open in IMG/M |
| 3300032259|Ga0316190_10422254 | Not Available | 904 | Open in IMG/M |
| 3300032259|Ga0316190_11115716 | Not Available | 514 | Open in IMG/M |
| 3300032260|Ga0316192_10153001 | Not Available | 1609 | Open in IMG/M |
| 3300032260|Ga0316192_10258940 | Not Available | 1201 | Open in IMG/M |
| 3300032260|Ga0316192_10272692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1166 | Open in IMG/M |
| 3300032260|Ga0316192_10425404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 907 | Open in IMG/M |
| 3300032260|Ga0316192_10441210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 889 | Open in IMG/M |
| 3300032260|Ga0316192_10598137 | Not Available | 747 | Open in IMG/M |
| 3300032260|Ga0316192_10614882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 735 | Open in IMG/M |
| 3300032260|Ga0316192_10725864 | Not Available | 669 | Open in IMG/M |
| 3300032260|Ga0316192_10832236 | Not Available | 620 | Open in IMG/M |
| 3300032260|Ga0316192_10973314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 568 | Open in IMG/M |
| 3300032260|Ga0316192_11074820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 537 | Open in IMG/M |
| 3300032262|Ga0316194_10031150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3547 | Open in IMG/M |
| 3300032262|Ga0316194_10180001 | Not Available | 1356 | Open in IMG/M |
| 3300032262|Ga0316194_10181971 | Not Available | 1348 | Open in IMG/M |
| 3300032263|Ga0316195_10066753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1858 | Open in IMG/M |
| 3300032263|Ga0316195_10147845 | Not Available | 1229 | Open in IMG/M |
| 3300032263|Ga0316195_10402305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 725 | Open in IMG/M |
| 3300032272|Ga0316189_10046921 | Not Available | 3714 | Open in IMG/M |
| 3300032272|Ga0316189_10069710 | All Organisms → cellular organisms → Bacteria | 2936 | Open in IMG/M |
| 3300032272|Ga0316189_10107918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2263 | Open in IMG/M |
| 3300032272|Ga0316189_10153963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1838 | Open in IMG/M |
| 3300032272|Ga0316189_10214159 | Not Available | 1519 | Open in IMG/M |
| 3300032272|Ga0316189_10229979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1458 | Open in IMG/M |
| 3300032272|Ga0316189_10283647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1293 | Open in IMG/M |
| 3300032272|Ga0316189_10405537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1055 | Open in IMG/M |
| 3300032272|Ga0316189_10753044 | Not Available | 742 | Open in IMG/M |
| 3300032272|Ga0316189_11524088 | Not Available | 503 | Open in IMG/M |
| 3300032276|Ga0316188_10113812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1329 | Open in IMG/M |
| 3300032276|Ga0316188_10138346 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum | 1208 | Open in IMG/M |
| 3300032276|Ga0316188_10220453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 962 | Open in IMG/M |
| 3300032276|Ga0316188_10248317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 908 | Open in IMG/M |
| 3300033429|Ga0316193_10017064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 5565 | Open in IMG/M |
| 3300033429|Ga0316193_10262037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1371 | Open in IMG/M |
| 3300033429|Ga0316193_10280471 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300033429|Ga0316193_10606218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 872 | Open in IMG/M |
| 3300033429|Ga0316193_11045228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 649 | Open in IMG/M |
| 3300033429|Ga0316193_11621111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 513 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 17.75% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 14.86% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 13.04% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 10.51% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 10.51% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 7.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.25% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.90% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 2.54% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.09% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.09% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.09% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 1.09% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 1.09% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.72% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 0.72% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.72% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.72% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.72% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
| Marine Sediment | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.36% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.36% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.36% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.36% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.36% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.36% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.36% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300000568 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300002180 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 | Environmental | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300004001 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 | Environmental | Open in IMG/M |
| 3300004007 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 | Environmental | Open in IMG/M |
| 3300004008 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 | Environmental | Open in IMG/M |
| 3300004028 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 | Environmental | Open in IMG/M |
| 3300004030 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 | Environmental | Open in IMG/M |
| 3300004147 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 | Environmental | Open in IMG/M |
| 3300005145 | Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG | Engineered | Open in IMG/M |
| 3300005182 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2 | Environmental | Open in IMG/M |
| 3300005215 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 | Environmental | Open in IMG/M |
| 3300005252 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaG | Engineered | Open in IMG/M |
| 3300005254 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG | Engineered | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300007102 | Combined Assembly of Marine Sediment Inoculum and Enrichments | Engineered | Open in IMG/M |
| 3300007784 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009033 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009138 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG | Environmental | Open in IMG/M |
| 3300009145 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300015370 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG | Environmental | Open in IMG/M |
| 3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
| 3300019710 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_5-6_MG | Environmental | Open in IMG/M |
| 3300019719 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_4-5_MG | Environmental | Open in IMG/M |
| 3300019741 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_6-7_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300021297 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.669 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021351 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021511 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-1-2_MG | Environmental | Open in IMG/M |
| 3300021514 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-30-0-1_MG | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022389 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.24 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022391 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022396 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.633 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022552 | Guaymas_combined assembly | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025156 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025561 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025566 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025583 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025599 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025950 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025958 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025968 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025969 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025984 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025991 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026059 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026106 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026126 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026131 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027536 | Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027592 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027690 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TDF_OR_ARG05_123mDRAFT_10086472 | 3300000242 | Marine | MPAKAGIQKYLKTLDSRLRGNDAKGRFETFCESINIEISISNA* |
| TDF_OR_ARG05_123mDRAFT_10913931 | 3300000242 | Marine | MPAKAGIQNHLKILDSRLRGNDAKGGFKTFYETIKN* |
| Draft_106666891 | 3300000568 | Hydrocarbon Resource Environments | IQNILKTLDSGLRRNDAKLEFSTFYETIKYGSLMR* |
| JGI24724J26744_101109421 | 3300002180 | Marine | PAKAGIQNHLKLLDSRLRGNDVKGRFKTLCETISI* |
| Ga0055475_102370992 | 3300003988 | Natural And Restored Wetlands | MPAKAGIQNYFKTLDSRLRGNDVKKRFKTFYETVNIGFLQTTI* |
| Ga0055450_100771432 | 3300004001 | Natural And Restored Wetlands | MAAKAGIQKYLKTLDSRIRGNDVKGRFKTFYETIKIEDLCQSLRSA |
| Ga0055450_100965013 | 3300004001 | Natural And Restored Wetlands | NSVMPAKAGIKNYLKTLDSCLRRHDAKGRFKAFYKTINSSLSK* |
| Ga0055476_102153742 | 3300004007 | Natural And Restored Wetlands | MPAKAGIQNHLKILDSRLRGNDVKGRFKTFYETITSGGHKNNA* |
| Ga0055446_100235202 | 3300004008 | Natural And Restored Wetlands | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYQTINLGAPSNH* |
| Ga0055446_101639092 | 3300004008 | Natural And Restored Wetlands | MPAKVGIQKYLKTLDSRLRGNDAKGYFKTFCEFVNLEPRNFGTEF* |
| Ga0055447_101372562 | 3300004028 | Natural And Restored Wetlands | MPAKAGIQNYLETLGSRLRGNDVKGRFKTFYETINLQFTIPR* |
| Ga0055447_101453372 | 3300004028 | Natural And Restored Wetlands | MPAKAGIQNYLISLGSRLRGNDAKGHFKTFYETIIVGRLMFIF* |
| Ga0055444_100139202 | 3300004030 | Natural And Restored Wetlands | MPAKAGIKNYLKTLDSCLRRHDAKGRFRAFYKTINSSLSK* |
| Ga0055444_103352622 | 3300004030 | Natural And Restored Wetlands | MPAKAGIQNYLISLDSRLRGNDAKGVFKTFYETINLKSSIIMGAPNG* |
| Ga0055515_102235482 | 3300004147 | Natural And Restored Wetlands | RNSVMPAKAGIQNHLKILDSRLRGNDVKGRFKTFYETITSGGHKNNA* |
| Ga0068713_10631692 | 3300005145 | Enrichment Culture | MPAKAGIQNHLKSLDSRLRGNDAKGVFSTFYETIKYGAHKI* |
| Ga0069000_100582892 | 3300005182 | Natural And Restored Wetlands | MPAKAGIQNYLKTLDSRLRGNDAKGHFKTFYETINVGRLMFIF* |
| Ga0069001_100498031 | 3300005215 | Natural And Restored Wetlands | MPAKAGIQNYLETLGSRLRGNDVKGRFKIFYETINLQFTIPR* |
| Ga0068712_10149388 | 3300005252 | Enrichment Culture | MPAKAGIQNHLKSLDSRLRGNDAKGVFSTYYETIKSFIFNI* |
| Ga0068714_10000083164 | 3300005254 | Enrichment Culture | MPAKAGIQNHLKSLDSRLRGNDAKGVFSTFYKTIKYGAHKI* |
| Ga0070728_100303734 | 3300005588 | Marine Sediment | MPAKAGIQKHLKTLGFRLHGNDAKGRFETFYESINIEFSISYA* |
| Ga0070728_101027061 | 3300005588 | Marine Sediment | VMPAKAGIQNYLKTLDSRLRENDAKGRFKTFYETISL* |
| Ga0070729_101775892 | 3300005589 | Marine Sediment | MPAKAGIQNYLKTLDSRLRENDAKGRFKTFYETISL* |
| Ga0070729_106843912 | 3300005589 | Marine Sediment | MPAKAGIQNYLKTLDSGLRGNDVKGRFKTFYETIINKTG* |
| Ga0070729_106865531 | 3300005589 | Marine Sediment | SVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINI* |
| Ga0070727_100655262 | 3300005590 | Marine Sediment | MPAKAGIQKHLKTLDFRLHGNDAKGRFETFYESINIEFSISYA* |
| Ga0070727_107632321 | 3300005590 | Marine Sediment | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIILAKV |
| Ga0070726_100340392 | 3300005600 | Marine Sediment | MPAKAGIQKHLKTLGFRLRGNDAKGRFETFYESINIEFSISYA* |
| Ga0070726_101441362 | 3300005600 | Marine Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIN |
| Ga0070726_106725281 | 3300005600 | Marine Sediment | KVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGCFKTFYETINPLL* |
| Ga0070723_100331863 | 3300005612 | Marine Sediment | MPGKAGIQNYLKTLGSRLRGNDAKGRFKTFFNFVIIFYNSG* |
| Ga0070723_102703762 | 3300005612 | Marine Sediment | SVMPAKAGIQNYLKTLDSRLRGNDVKGRFKAFYETIKTF* |
| Ga0074476_16023542 | 3300005825 | Sediment (Intertidal) | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIFFEY* |
| Ga0070725_101418052 | 3300005920 | Marine Sediment | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIIMDQNP* |
| Ga0070725_105156462 | 3300005920 | Marine Sediment | QNYLKTLDSRFRENDVKGRFKTFYETINIESHPMPE* |
| Ga0099972_101983022 | 3300006467 | Marine | IQNYLKTLDSRLRGNDAKGGFKTFYETINLRSSIPACPGWV* |
| Ga0099972_103114151 | 3300006467 | Marine | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFNEAIKID |
| Ga0099972_108318691 | 3300006467 | Marine | MHAPAGIQKHLKILDFRLRGNDAKGGFKTFYETINI |
| Ga0099972_108605082 | 3300006467 | Marine | MPATAGIQNHLNILDSRLRGNDAKGGFKTFYETINTSV* |
| Ga0099972_111820352 | 3300006467 | Marine | MPAKAGIQNYLKKLDSRLRGNDAKGRFKTFYETIKFQYDM* |
| Ga0099972_115227782 | 3300006467 | Marine | MPAKAGIQNHLKILDSRLRGYDDKVGFKTFYETFNIDILND |
| Ga0099972_119888692 | 3300006467 | Marine | MPAKAGIQNYLKTLDSRLSGNDAKGRFKTFYETINVGR |
| Ga0099972_120529771 | 3300006467 | Marine | MPAKAGIQNYLKTLDSRLRGNDAKGCFKTFYETIKFRILIFFGI* |
| Ga0099972_130211382 | 3300006467 | Marine | VRNSVMPAKAGIQNHLKILDSRLRGIDAKGGFKTFYETIKTQIQNRL* |
| Ga0099972_131968081 | 3300006467 | Marine | MPAKADIQSYLKTLDSRLRENDAKGCFKAFYETINVGR |
| Ga0099972_132177601 | 3300006467 | Marine | MPVKAGIQNHLKILDSRLRRNDAKGDFKTFYETINIENYLYFGA* |
| Ga0102541_11165231 | 3300007102 | Marine Sediment | MPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYETINVGL |
| Ga0102541_12576031 | 3300007102 | Marine Sediment | MPAKAGIQNYLKKLYSRLRGNDVKGRFKTFYETINIQFRLIRIKTP |
| Ga0102955_10047071 | 3300007784 | Soil | GIQNYLKILDSRLRGNDAKGHFKTFYETINVGRLMFIF* |
| Ga0102955_10059531 | 3300007784 | Soil | NSVMPAKAGIQNYLKTLDSRLRGNDAKGVFKTFYDTINLKSSIIMGAPDG* |
| Ga0102955_10078683 | 3300007784 | Soil | MPAKAGIQNYLKTLDSSLRGNDVKGRFKAFYETTTLNIE* |
| Ga0102955_10340581 | 3300007784 | Soil | VMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINVHL* |
| Ga0102955_10474761 | 3300007784 | Soil | SVMPAKAGIQNYLKTLDSRLRGNDVKGRIKPFTKPSNFK* |
| Ga0102955_10847051 | 3300007784 | Soil | MPAKAGIQKYLKTLDSRLRGNDAKGRFQTFYDTINIDDATLYRF* |
| Ga0102955_12265911 | 3300007784 | Soil | MPAKAGIQNYLKTLDSRLRGNDAKGRFKISYETINIRRSMLEV |
| Ga0102957_12200861 | 3300009027 | Pond Water | AGIQNYLKTLDSRLRGNDVKGRFKTFYETIKIGPHDKIAGQFLI* |
| Ga0102957_13288911 | 3300009027 | Pond Water | MPAKAGIQNYLKILDSRLRGNDVEGRFKTFYETISVECSMLDVHLPS |
| Ga0102956_10016759 | 3300009033 | Soil | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINFRGKFV |
| Ga0102956_10043534 | 3300009033 | Soil | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINFEILN* |
| Ga0102956_10250973 | 3300009033 | Soil | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINVEHRIMLSLRS |
| Ga0102956_10283122 | 3300009033 | Soil | MPAKAGIQNYLKTLDSRLRGSDAKGCFKTFYETINC* |
| Ga0102956_12315321 | 3300009033 | Soil | KVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFQTFYDTINIDDATLYRF* |
| Ga0102956_13167013 | 3300009033 | Soil | MPAKAGIQNYLKTLDSCLRGHDAKGRFKTFYETINVV |
| Ga0102814_108445181 | 3300009079 | Estuarine | MPAKAGIQNYSKTLDSRLRGNDAKGRFKTYYETSRLQIEYPRNATDLN* |
| Ga0102959_10943791 | 3300009138 | Soil | MPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYESINIDDTTLYRYLQDY* |
| Ga0102961_10529331 | 3300009145 | Soil | RNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKIYYETINVLDA* |
| Ga0102961_10545521 | 3300009145 | Soil | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIN |
| Ga0136651_102084242 | 3300010330 | Marine Hydrothermal Vent | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYENIIY* |
| Ga0116236_100446534 | 3300010353 | Anaerobic Digestor Sludge | MPTKAGIQNILKCLASRLRGNDKEDDSSTFYETIKMAIYEY* |
| Ga0118731_1000568052 | 3300010392 | Marine | MPAKAGIQNYLKTLGSRLRGNDVKGRFKTFYKTINLQFTIPR* |
| Ga0118731_1003348161 | 3300010392 | Marine | MPAKAGIQNYLISLGSRLRGNDAKGRFKTFYEAINIDDATLYLF* |
| Ga0118731_1008756672 | 3300010392 | Marine | MPAKAGIQNYLKILDSRLRGNDAKGGFKIFYETIKVKY* |
| Ga0118731_1011921842 | 3300010392 | Marine | MPAKAGIQKYLKTLNSRLRGNDAKGRFETFYESINIEISISNA* |
| Ga0118731_1012575811 | 3300010392 | Marine | VRNSVMPAKAGIQNYLKILDSRLRGNDVKGCFKTYYETI* |
| Ga0118731_1012644061 | 3300010392 | Marine | MPAKAGIQNYLKTLGSRLRGNDVKGRFKTFYETIKLE |
| Ga0118731_1016709853 | 3300010392 | Marine | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINV |
| Ga0118731_1020042391 | 3300010392 | Marine | MPAKAGIQNYLKTLDFRLRGNDVKRRFKIYYGNINFSIRNIELNQEI* |
| Ga0118731_1023110053 | 3300010392 | Marine | MPAKAGIQNHLIILDSRLRGNDAKGGFKTFYETINYRIKKSV* |
| Ga0118731_1025653642 | 3300010392 | Marine | MPAKAGIQNHLKILDSRLRGKDAKGGFKTFYETINPEP* |
| Ga0118731_1037409151 | 3300010392 | Marine | IPAKAGIQNYLKTLDSRLRGNDAKRRFKTFYGTFNII* |
| Ga0118731_1054686163 | 3300010392 | Marine | MPAKAGIQNHLKILDSRLRGNDAKEGFKTFYETINVRDKTAWDC* |
| Ga0118731_1055688792 | 3300010392 | Marine | GIQNYLKTLDLRFRENDVKGRFKTFYETINIESHPMPE* |
| Ga0118731_1100422793 | 3300010392 | Marine | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKG* |
| Ga0118731_1118656352 | 3300010392 | Marine | MPAKAGIQNHLKILDSRLRGKDAKGGFKTFYETINDQ* |
| Ga0118731_1127920461 | 3300010392 | Marine | MPAKAGIQNHLKILDSRLRGNDAKGGFKTYYETITLDSL* |
| Ga0118731_1145981002 | 3300010392 | Marine | MPAKAGIQKYLKTLDSRLRGNDAKGRFETFNESINIEFSISNAQIF* |
| Ga0118731_1149892251 | 3300010392 | Marine | MPAKAGIQKYLKTLDSRLRGNDAKGHFKTIYESIN |
| Ga0118733_1001009395 | 3300010430 | Marine Sediment | MPAKAGIQNYLKILDSRLRGNDVKGGFKTFYETINIEIWNLFVF* |
| Ga0118733_1002378185 | 3300010430 | Marine Sediment | MPAKAGIQNHLKILDSRLRGNNAKGGLKTFYETIKN* |
| Ga0118733_1004038971 | 3300010430 | Marine Sediment | MPAKAGIQNYLKTLDFRLRGNDAKRRFKTFYGTIKIGCS |
| Ga0118733_1005584852 | 3300010430 | Marine Sediment | MPAKAGIQNHLKILDSRLRGNDTKEGFKTFYETIII* |
| Ga0118733_1006860262 | 3300010430 | Marine Sediment | MPAKAGIQNYLKILDSRLRGHDVKGRIKTFYDIIKII* |
| Ga0118733_1008839761 | 3300010430 | Marine Sediment | MPAKAGIQNHLKILDSRLRGNDAKEGFKTFYETIN |
| Ga0118733_1012215721 | 3300010430 | Marine Sediment | MPAKAGIQNYLKVLDSRLRGNDAKGGFKAFYETIKSKI* |
| Ga0118733_1015321233 | 3300010430 | Marine Sediment | MPAKAGIQNHLKILDSRLRGNDAKGGFKTFYETINIQ* |
| Ga0118733_1017685432 | 3300010430 | Marine Sediment | MPAKAGIQNYLKILDSRLRGNDVKGRFKTFYKTIYL* |
| Ga0118733_1026574532 | 3300010430 | Marine Sediment | MPAKAGIQNYLNTLDSRLRGNDANGRFKTFYETINV |
| Ga0118733_1030084141 | 3300010430 | Marine Sediment | PAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINPIP* |
| Ga0118733_1031537531 | 3300010430 | Marine Sediment | KAGIQNYLKTLGSRLRGNDVKGRFKTFYKTINLQFTIPR* |
| Ga0118733_1042594982 | 3300010430 | Marine Sediment | MPAKAGIQKYLKTLDSRLRGNDAKGRFETFNESINIEFSISNA* |
| Ga0118733_1052389102 | 3300010430 | Marine Sediment | SVLPAKAGIQNYLKTLDFRLRGNDAKGRFKTFYETINIDDATLYRL* |
| Ga0118733_1067300611 | 3300010430 | Marine Sediment | NSVMSAKAGIQKYLKTLDSRLRGNDVKGRIKTLYETIKFGI* |
| Ga0118733_1067985691 | 3300010430 | Marine Sediment | MPAKAGIQDYLKTLDSRLRGNDVKGRIKTFYETIKFGI* |
| Ga0118733_1076147591 | 3300010430 | Marine Sediment | MHAKAGIQNYLKILDSRLRGNDAKGGFKTFYETIKIPSTKTRISN |
| Ga0118733_1084215841 | 3300010430 | Marine Sediment | MPAKADIQNYLKTLDSRLRGNDAKGRFKTFYETINF |
| Ga0118733_1094495262 | 3300010430 | Marine Sediment | AKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKIEN* |
| Ga0164315_100191683 | 3300013099 | Marine Sediment | MPAKAGIQKRLKILDSRLRGNDTNGRFQTFYEGIIVNRNK* |
| Ga0164313_101369951 | 3300013101 | Marine Sediment | LTDSQKVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYENIIY* |
| (restricted) Ga0172371_100598914 | 3300013138 | Freshwater | MPAKAGIQNHLKSLDSRLRGNDAKGVFSTFYETIIIGDGHAA* |
| Ga0075345_10507291 | 3300014312 | Natural And Restored Wetlands | PAKAGVHNMLRLLDSRFRGNDEKGAFKTFYETISIEI* |
| Ga0180009_100588732 | 3300015370 | Groundwater | MPAKAGIQPRFSVVKSLDSRLRGNDNKGAFPTFYETIITLKN* |
| Ga0180436_106704522 | 3300017990 | Hypersaline Lake Sediment | MPAKAGIQKYMNLLDYRLRGNDAGRQFPTFYRKEN |
| Ga0194009_10343642 | 3300019710 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIQSSFVIPL |
| Ga0193977_10247292 | 3300019719 | Sediment | MPAKAGIQNYLNTLDSRLRGNDAKGVFKTFYETINLKSSIIMGSPDG |
| Ga0194020_10320711 | 3300019741 | Sediment | MPAKADIQNYLKSLDSRLRGNDVKGRFRTYYETIKINFRSRISAGVN |
| Ga0194023_10923981 | 3300019756 | Freshwater | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKSDIPKKG |
| Ga0210369_10372461 | 3300021297 | Estuarine | MPAKAGIQNSLKTLDCRIRGNDAKGRFKTFYENIKIPLAIGFIQR |
| Ga0210365_106311052 | 3300021351 | Estuarine | MPAKAGIQNHLKILDSRLRGNDVKGRFKAFYETIKINYSFHDPSIWWYT |
| Ga0190284_11371021 | 3300021511 | Hydrothermal Vent Microbial Mat | MPAKAGIQKYLNILDSRLRGNDAKERFETFYDFVNIQ |
| Ga0190293_10030042 | 3300021514 | Hydrothermal Vent Microbial Mat | MPAKAGIQKRLKILDSRLRGNDTNGRFQTFYEGIIVNRNK |
| Ga0224503_100030567 | 3300022201 | Sediment | MPAKAGIQKYLKTQDFRLRGNDAKGRFKTFYETINIGRSMFAFTVPAT |
| Ga0224503_100163821 | 3300022201 | Sediment | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINIDYATLY |
| Ga0224503_100326282 | 3300022201 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINVHL |
| Ga0224503_101438371 | 3300022201 | Sediment | RNSVMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYESINIDDTTLYRYLQDY |
| Ga0224498_100047913 | 3300022202 | Sediment | MPAKAGIQNYLKTLDSSLRGNDVKGRFKAFYETTTLNIE |
| Ga0224498_100089553 | 3300022202 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGHFKTFYETINVGRLMFIF |
| Ga0224498_100808142 | 3300022202 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFQTFYDTINIDDATLYRF |
| Ga0224499_100446733 | 3300022206 | Sediment | MPAKAGIQNYLETLGSRLRGNDVKGRFKTFYETINLQFTIPR |
| Ga0224499_100733771 | 3300022206 | Sediment | KVRNSVMPAKAGIQNYLISLDSRLRGNDAKGGFKTFYETINTD |
| Ga0224499_101185291 | 3300022206 | Sediment | VMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYDTINIDDATLYRF |
| Ga0224499_101256232 | 3300022206 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIE |
| Ga0224499_102148212 | 3300022206 | Sediment | MPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYESINIDDATLYRYLQDY |
| Ga0224514_100119451 | 3300022217 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGHFKTFYETIIVGRLMFIF |
| Ga0224514_100128802 | 3300022217 | Sediment | MPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYDTINIDDATLYRF |
| Ga0224514_100326902 | 3300022217 | Sediment | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINIDYATLYRF |
| Ga0224514_101149692 | 3300022217 | Sediment | AKAGIQNYLKTLDSRLRGNDAEGRFKTFYETIKLSLAKSLES |
| Ga0224514_101528842 | 3300022217 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGHFKTFYETIN |
| Ga0224514_101917461 | 3300022217 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKIFYQTIQFGPTRKRG |
| Ga0224514_102490522 | 3300022217 | Sediment | MPAKAGIQNYLKTLDSCLRGNDVKGRFKTFYETII |
| Ga0224514_104179862 | 3300022217 | Sediment | MPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYETIKVGL |
| Ga0224502_100098183 | 3300022218 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIQHSICSRCQPA |
| Ga0224502_100127103 | 3300022218 | Sediment | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINF |
| Ga0224502_100208414 | 3300022218 | Sediment | KVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKIYYETINVLDA |
| Ga0224502_100276023 | 3300022218 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGVFKTFYDTINLKSSIIMGSPDG |
| Ga0224502_100416371 | 3300022218 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYEGINFKFC |
| Ga0224502_100514281 | 3300022218 | Sediment | KVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFQTFYDTINIDDATLYRF |
| Ga0224502_104083472 | 3300022218 | Sediment | MLAKAGIQNYLKTLDSRIRGNDAKGRFKIFYETINIQ |
| Ga0224502_104288612 | 3300022218 | Sediment | LTNPQKARNSVMPAKAGIQKYLKTLGSRLHGNDVKGCIKTFYETIIIYY |
| Ga0224513_100045284 | 3300022220 | Sediment | MPAKAGIQNYLKTLDSRLRGSDAKGCFKTFYETINC |
| Ga0224513_100145051 | 3300022220 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIRRSIC |
| Ga0224513_101042542 | 3300022220 | Sediment | AKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINVHL |
| Ga0224513_102705702 | 3300022220 | Sediment | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINFEILN |
| Ga0224509_100085575 | 3300022306 | Sediment | MPAKADIQSYLKTLDSRLRENDAKGRFKAFYETINVDNFVKSR |
| Ga0224509_100869252 | 3300022306 | Sediment | RNSVMPAKAGIQNYLKTLDSRLRGSDAKGCFKTFYETINLER |
| Ga0224509_102927542 | 3300022306 | Sediment | PAKVGIQNYLKTLDSRLRGNDAKGRFKTFYDTINF |
| Ga0224504_100192801 | 3300022308 | Sediment | MPAKAGIQKYLKTPGYRLRRNDVKGRFKTIYESIKFERLKMI |
| Ga0210318_10472531 | 3300022389 | Estuarine | MPAKAGIQNYLKTLDSRLRGNDAKGLFETFYGTIRVKYYKFMHF |
| Ga0210374_10519702 | 3300022391 | Estuarine | MPAKAGIQNYFKTLDSRLRGNDVKGRFKTIYKTSKFRKKESREIP |
| Ga0210374_11475152 | 3300022391 | Estuarine | MAAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIN |
| Ga0210364_11643431 | 3300022396 | Estuarine | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKINPNNIFV |
| Ga0212118_105272142 | 3300022552 | Marine Hydrothermal Vent | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYENII |
| (restricted) Ga0233408_101174092 | 3300023089 | Seawater | MLAKADIQKYLKTLTSRLGGNDAKGRFETFYEFSNIDKPV |
| (restricted) Ga0233412_101795502 | 3300023210 | Seawater | MPAKAGIQKYLKTLDSRLRGNDAKGRFETFYESINIEISISNA |
| (restricted) Ga0255046_102920961 | 3300024519 | Seawater | MPAKAGIQNYLKTLDSRLRENDAKGRFKTFYETISL |
| Ga0209834_102731652 | 3300025156 | Marine Hydrothermal Vent | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYENIIY |
| Ga0210119_10119413 | 3300025561 | Natural And Restored Wetlands | MPVKAGIQNYLKTLDSRLRGNDAKGVFKTFYDTINLKSSIIMGAPDG |
| Ga0210119_10166381 | 3300025561 | Natural And Restored Wetlands | AKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINIDYATLYRF |
| Ga0210119_10396231 | 3300025561 | Natural And Restored Wetlands | VMPAKAGIQNYLKTLDSRLRGSDAKGCFKTFYETINLER |
| Ga0210119_10524091 | 3300025561 | Natural And Restored Wetlands | MPAKAGIQNYLKTLDSRLRRNDAKGRFKTFYETINLQYSFPFFPV |
| Ga0210140_11359331 | 3300025566 | Natural And Restored Wetlands | MPAKAGIQNYLKKLYSRLRGNDAKGRFKTFYEGIKN |
| Ga0210085_10616494 | 3300025583 | Natural And Restored Wetlands | NSVMPAKAGIKNYLKTLDSCLRRHDAKGRFKAFYKTINSSLSK |
| Ga0210074_10374762 | 3300025599 | Natural And Restored Wetlands | PAKAGIQNYLKTLDSRLRGNDVKGRFKTFYQTINLGAPSNH |
| Ga0210074_11522961 | 3300025599 | Natural And Restored Wetlands | MPAKAGIQNYLISLDSRLRGNDAKGVFKTFYETINLKSSIIMGAPNG |
| Ga0210134_10070611 | 3300025950 | Natural And Restored Wetlands | AKAGVHNMLRLLDSRFRGNDEKGAFKTFYETINIQFSSIF |
| Ga0210069_100023312 | 3300025958 | Natural And Restored Wetlands | KAGVHNMLRLLDSRFRGNDEKGAFKTFYETINIAI |
| Ga0210069_10020521 | 3300025958 | Natural And Restored Wetlands | AKAGVHNMLRLLDSRFRGNDEKGAFKTFYETIKVGF |
| Ga0210103_10008835 | 3300025968 | Natural And Restored Wetlands | KAGVHNMLRLLDSRFRGNDEKGAFKTFYETINIQFSSIF |
| Ga0210103_10035983 | 3300025968 | Natural And Restored Wetlands | KAGVHNMLRLLDSRFRGNDEKGAFKTFYETINIGIIE |
| Ga0210080_10006101 | 3300025969 | Natural And Restored Wetlands | VRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIRKGGRL |
| Ga0210082_10117583 | 3300025984 | Natural And Restored Wetlands | MPAKAGIQNHLKILDSRLRGNDVKERFKAFYETINVD |
| Ga0210128_10127934 | 3300025991 | Natural And Restored Wetlands | MPAKAGIQNYLISLDSRLRGNDAKGVFKTFYETINLKSSIIMG |
| Ga0208540_10018593 | 3300026059 | Natural And Restored Wetlands | AGVHNMLRLLDSRFRGNDEKGAFKTFYETINIRPSTFKYF |
| Ga0209927_10124151 | 3300026106 | Soil | KVRNSVMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINFEILN |
| Ga0209957_10032046 | 3300026126 | Soil | MPVKAGIQNYLKTLDSRLRGNDAKGVFKTFYETINHE |
| Ga0209957_10063291 | 3300026126 | Soil | ARNSVMPAKAGIQNYLKTLDSRLRGNDAKGCFKTFYETINC |
| Ga0209928_10504051 | 3300026131 | Soil | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIDIQRSM |
| Ga0209163_10908292 | 3300027536 | Enrichment Culture | MPAKAGIQNHMKSLDSRLRGNDAKGVFSTFYETITVDHPGRYGFM |
| Ga0209270_100366318 | 3300027592 | Enrichment Culture | MPAKAGIQNHLKSLDSRLRGNDAKGVFSTFYETIKYGAHKI |
| Ga0209270_10405564 | 3300027592 | Enrichment Culture | GIQNHPKSLDSRLRGNDGYGTFSTFYETIKDASFTF |
| Ga0209164_1000236143 | 3300027690 | Enrichment Culture | MPAKAGIQNHLKSLDSRLRGNDAKGVFSTFYKTIKYGAHKI |
| Ga0209379_100413102 | 3300027758 | Marine Sediment | MPAKAGIQKYLKTLDSRLRGNDAKGRFETFYESINIEFSISYA |
| Ga0209273_100778261 | 3300027790 | Marine Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGHFKTFYETINVGRSMFIF |
| Ga0209273_100894322 | 3300027790 | Marine Sediment | MPAKAGIQKHLKTLGFRLRGNDAKGRFETFYESINIEFSISYA |
| Ga0209578_100402262 | 3300027820 | Marine Sediment | MPAKAGIQKHLKTLGFRLHGNDAKGRFETFYESINIEFSISYA |
| Ga0209692_102309722 | 3300027828 | Marine Sediment | MPAKAGIQNYLISLDSRLRGNDAKGAFKTFYETINIE |
| Ga0209692_103730082 | 3300027828 | Marine Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIQSS |
| Ga0209271_100105993 | 3300027845 | Marine Sediment | MPAKAGIQKHLKTLDFRLHGNDAKGRFETFYESINIEFSISYA |
| Ga0209271_100355283 | 3300027845 | Marine Sediment | AKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIKVNRWTFLAI |
| Ga0209013_100596551 | 3300027858 | Marine | AKAGIQKCLKILDSRLRGNDANGRFQTFYEGIIFIK |
| Ga0209013_101076354 | 3300027858 | Marine | MPAKAGIQNYLKLLDSRLRGNDGKGRFKTFYETIN |
| Ga0209536_1003727112 | 3300027917 | Marine Sediment | MPAKADIQNYLKLLDSRLRGKDTKRGFKAFYEAIKL |
| Ga0209536_1006612481 | 3300027917 | Marine Sediment | MPAKAGIQKYLKTLDSRLRRNDVKGRFKAFYKTIN |
| Ga0209536_1011932483 | 3300027917 | Marine Sediment | MPAKAGIQKYLKILDSRLRGNDAKGRFKTFYETINIVDATLYRF |
| (restricted) Ga0233414_105544202 | 3300028045 | Seawater | MPAKAVQNYLKTLDSRLHGNDVKGRFKTFYETIKIGSMLNTNVANVE |
| Ga0210366_102275791 | 3300028420 | Estuarine | MPAKAGIQNYLKTLDCRLRGNDTKGRFKTFYETIKIRCW |
| Ga0265306_107817812 | 3300028598 | Sediment | MPAKAGIQNYLKILDSRLRGDDVKGRIKTFYETIKIE |
| Ga0265303_102532992 | 3300028600 | Sediment | AKAGIQNLLKILDSRLRGNDAKGGFKTFYETINIP |
| Ga0316187_100509112 | 3300032231 | Worm Burrow | MPAKAGIQKYLKTLNSRLRWNEVKGRFKTFYETINI |
| Ga0316187_100638571 | 3300032231 | Worm Burrow | MPAKAGIQNYLKTLDSSLLGNDVKGRFKAFYETTTLNIE |
| Ga0316187_100716583 | 3300032231 | Worm Burrow | MPAKAGIQKYLKTLDSRLRGNDAKGRFETFCESINIEISISNA |
| Ga0316187_102438361 | 3300032231 | Worm Burrow | MPAKAGIQNYLKTLDTCLRGNDLKKRIKAFYETIKISN |
| Ga0316187_104135391 | 3300032231 | Worm Burrow | MPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYETISIVS |
| Ga0316187_105754731 | 3300032231 | Worm Burrow | KVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINVHL |
| Ga0316187_107398432 | 3300032231 | Worm Burrow | MPAKAGIQNYLKTLGSRIRGNDVKGRFKTFYETIKIEIKI |
| Ga0316187_109332702 | 3300032231 | Worm Burrow | MPAEAGIQNYLKTLDSRLRGNDVKGRFKTFCEGIKL |
| Ga0316187_114181521 | 3300032231 | Worm Burrow | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIRRSVL |
| Ga0316198_102842282 | 3300032251 | Sediment | IPAKVGIQNYLKTLDSRLRGNDAKGRFKTFYETIKIAP |
| Ga0316198_104892011 | 3300032251 | Sediment | IQKYLKTLDSRLRGNDAKGRFKTFYETIRFDGLTFPG |
| Ga0316196_100556992 | 3300032252 | Sediment | MPAKAGIQNYLKILDSRLRGNDTKGRFKIYYETINVLDA |
| Ga0316196_101322922 | 3300032252 | Sediment | MPAKAGIQNYLETLGSRLRGHDVKGRFKTFYETIYLQFTIPR |
| Ga0316196_101582333 | 3300032252 | Sediment | MLAKAGIQNYLKTLDSRIRGNDAKGRFKIFYETINIQSS |
| Ga0316196_101641882 | 3300032252 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYDTINVEHRIMMSLRSAI |
| Ga0316196_101934291 | 3300032252 | Sediment | MPAKAGIQNYLKKLDSRLRGNDAKGRFKTFYEPINIQFRFI |
| Ga0316196_104663382 | 3300032252 | Sediment | MPAKAGIHSFLKTLDFRLRGNDAKGGFKTFNETINVGRSIFILKKTC |
| Ga0316191_100565043 | 3300032258 | Worm Burrow | MPAKAGIQNYLISLGSRLRGNDAKGHFKTFYETIIVGRLMFIF |
| Ga0316191_101167031 | 3300032258 | Worm Burrow | KAGIQNYLKTLDSRLRGNDAKGRFKTFYETINVHL |
| Ga0316191_101913951 | 3300032258 | Worm Burrow | MPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYETINK |
| Ga0316191_103550914 | 3300032258 | Worm Burrow | NYLKTLDSRLRGNDAKGRFKTFYETINIKCYFKPG |
| Ga0316191_103759061 | 3300032258 | Worm Burrow | MPAKASIQNYLKTLDSHLRGKDAKGRFKTFYEAINSYTRTRT |
| Ga0316191_104037553 | 3300032258 | Worm Burrow | KVRNSVMPAKVGIQNYLKTLDSRLRGNDAKGVFKTFYETIN |
| Ga0316191_104781792 | 3300032258 | Worm Burrow | MPAKSGIQKYLKTLDSRLRGNDTKGRFKAIYESIII |
| Ga0316191_105031072 | 3300032258 | Worm Burrow | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIKFDKA |
| Ga0316191_105324092 | 3300032258 | Worm Burrow | MPVGAGIQNYLKTLDSRLHGNDVKGRFKTFYETINFNSLQNR |
| Ga0316191_105934621 | 3300032258 | Worm Burrow | MPAEAGIQNYLKTLASRLRGNDVKGRFKTFYETIKIQTFYNF |
| Ga0316191_111940913 | 3300032258 | Worm Burrow | MPAKAGIQNHLKSLDSRLRGNDGKGAFLSFCETIK |
| Ga0316191_113674821 | 3300032258 | Worm Burrow | MPAKAGIQNYLRTLDSRLRGNDAKGRFKTFYETINLVPLNFTSLLCSD |
| Ga0316190_100825473 | 3300032259 | Worm Burrow | MPAKAGIQNYLETMGSRLRGNDVKGRFKTFYETINLQFTIPR |
| Ga0316190_104222543 | 3300032259 | Worm Burrow | MLAKAGIQNYLKTLDSRIRGNDAKGRFKIFYETINIQSSFVIPL |
| Ga0316190_111157161 | 3300032259 | Worm Burrow | MPAKAGIQNYLKTLDSRLRGNDAKKRFKTFYETIKFTIRNVRDG |
| Ga0316192_101530012 | 3300032260 | Worm Burrow | MPAKAGIQNYLKTLDSRLRGNDVKGRFKIFYEPINIQFRFIRVGFY |
| Ga0316192_102589402 | 3300032260 | Worm Burrow | MLAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIQQNKHPV |
| Ga0316192_102726921 | 3300032260 | Worm Burrow | MPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYETIKF |
| Ga0316192_104254042 | 3300032260 | Worm Burrow | MRAKAGIQNHLNTLDPCLRGNDVKGRFKIFYDTISV |
| Ga0316192_104412101 | 3300032260 | Worm Burrow | MPAEAGIHNYLKILDYRLRGNDVKGRFKTFYETITFLVW |
| Ga0316192_105981371 | 3300032260 | Worm Burrow | RNSVLPAKAGIQNYLKTLDSRLRGKDVKGCFKTFY |
| Ga0316192_106148822 | 3300032260 | Worm Burrow | MPAKAGIQNYLKSLDSRLRGNDVKGRFRTYYETINIQRSMLDVIGIFCSEQ |
| Ga0316192_107258641 | 3300032260 | Worm Burrow | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYDFIKIGISN |
| Ga0316192_108322361 | 3300032260 | Worm Burrow | MPAKAGIQKYLKTLDSRLRGNDAKGRFKNFYETIKP |
| Ga0316192_109733141 | 3300032260 | Worm Burrow | MPAKAGIQNYSKTLDSRLRGKDVKGRFKTFYETINIVDAALYLF |
| Ga0316192_110748202 | 3300032260 | Worm Burrow | MPAKAGIQNYLKILDSRLRGNDAKGGFKTFYETIDLQFSASGG |
| Ga0316194_100311502 | 3300032262 | Sediment | MPAKAGIQKYLKTLDSRLRGNDAKGRFETFCESINIEFSISNA |
| Ga0316194_101800011 | 3300032262 | Sediment | MPAKAGIQNYSKTLDSRLRGNDAKGRFKTFYVTINVRCSKFIF |
| Ga0316194_101819711 | 3300032262 | Sediment | MPAKAGIQNYLKTLDSGLRGNDAKGRFKTFYETIKI |
| Ga0316195_100667532 | 3300032263 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKITFCFNYCITDK |
| Ga0316195_101478451 | 3300032263 | Sediment | MPAKAGIQKYLKTLDSRLRGNDIKERFKTIYESIKIAN |
| Ga0316195_104023052 | 3300032263 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYGNIRVKYYKFMHF |
| Ga0316189_100469211 | 3300032272 | Worm Burrow | MPAKAGIQKYLKTLDSRLRGNDAKGRFKNFYETIKPGTAQL |
| Ga0316189_100697104 | 3300032272 | Worm Burrow | MPAKAGIQNYLKTLDSRLRGNDAKGRFKIFYETINIQQATNNRPLTN |
| Ga0316189_101079184 | 3300032272 | Worm Burrow | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINSNSGFLRM |
| Ga0316189_101539631 | 3300032272 | Worm Burrow | MPAKSGIQKYLKTLDSRLRGNDTKGRFKAIYESIIIKKYSN |
| Ga0316189_102141592 | 3300032272 | Worm Burrow | AKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIIIGY |
| Ga0316189_102299791 | 3300032272 | Worm Burrow | MPAKAGIQNYLKTLDSRLRENDAKGHFKTFTKPSILMT |
| Ga0316189_102836474 | 3300032272 | Worm Burrow | MPAKAGIQKYLKTLDSRLRGNDVKRGIKTFYETIKFDA |
| Ga0316189_104055371 | 3300032272 | Worm Burrow | MPAKAGIQKYLKTLDSRLRGNDAEGRFKTFYETIKVQGTRFRVQGS |
| Ga0316189_107530441 | 3300032272 | Worm Burrow | NSVMPAKAGIQNYLKTLDSRLRRNDVKGRFKAFYETIKTF |
| Ga0316189_115240881 | 3300032272 | Worm Burrow | MPEKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKD |
| Ga0316188_101138123 | 3300032276 | Worm Burrow | MPAKAGIQNYLKALDSRLRGNDAKGCFKTFYETINLDYFK |
| Ga0316188_101383461 | 3300032276 | Worm Burrow | MPAKAGIQNYLISLGSRLPGNDVKGRFKTFLNFAIIF |
| Ga0316188_102204532 | 3300032276 | Worm Burrow | SVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIFFEY |
| Ga0316188_102483171 | 3300032276 | Worm Burrow | MPAKAGIQNHLKILDSRLRGNDVQGHFKTFYETINSNKIWVKDD |
| Ga0316193_100170646 | 3300033429 | Sediment | MPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINI |
| Ga0316193_102620373 | 3300033429 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKSEGP |
| Ga0316193_102804712 | 3300033429 | Sediment | MPAKAGIQNYLKTLDSRLRGNNVKGRFKAIYETINLYVGPK |
| Ga0316193_106062181 | 3300033429 | Sediment | VRNSVMPAKAGIQKYLKTLDSRLRGNDAKGRFETFCESINIEISISNA |
| Ga0316193_110452281 | 3300033429 | Sediment | MPAKAGIQNYLISLGSRIRGNDAKGGFKIFYETINTD |
| Ga0316193_116211111 | 3300033429 | Sediment | MPAKAGIQNYLKTLDSRLRGNDAKGRFKIFYETINIQRSTLMDS |
| ⦗Top⦘ |