


| Basic Information | |
|---|---|
| Family ID | F012857 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 276 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRDILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Number of Associated Samples | 174 |
| Number of Associated Scaffolds | 276 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.41 % |
| % of genes near scaffold ends (potentially truncated) | 39.49 % |
| % of genes from short scaffolds (< 2000 bps) | 85.51 % |
| Associated GOLD sequencing projects | 169 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.188 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.928 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.159 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.594 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 276 Family Scaffolds |
|---|---|---|
| PF08327 | AHSA1 | 17.75 |
| PF00202 | Aminotran_3 | 12.32 |
| PF02129 | Peptidase_S15 | 10.87 |
| PF03734 | YkuD | 5.07 |
| PF02518 | HATPase_c | 3.99 |
| PF03401 | TctC | 2.54 |
| PF13875 | DUF4202 | 2.54 |
| PF05988 | DUF899 | 2.17 |
| PF02538 | Hydantoinase_B | 1.45 |
| PF11154 | DUF2934 | 1.09 |
| PF01494 | FAD_binding_3 | 0.72 |
| PF00313 | CSD | 0.72 |
| PF00857 | Isochorismatase | 0.72 |
| PF08530 | PepX_C | 0.72 |
| PF04392 | ABC_sub_bind | 0.36 |
| PF00583 | Acetyltransf_1 | 0.36 |
| PF05977 | MFS_3 | 0.36 |
| PF00027 | cNMP_binding | 0.36 |
| PF16868 | NMT1_3 | 0.36 |
| PF00848 | Ring_hydroxyl_A | 0.36 |
| PF00082 | Peptidase_S8 | 0.36 |
| PF00146 | NADHdh | 0.36 |
| PF13683 | rve_3 | 0.36 |
| PF12840 | HTH_20 | 0.36 |
| PF02861 | Clp_N | 0.36 |
| PF07690 | MFS_1 | 0.36 |
| PF02308 | MgtC | 0.36 |
| PF03466 | LysR_substrate | 0.36 |
| PF13365 | Trypsin_2 | 0.36 |
| PF13419 | HAD_2 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 276 Family Scaffolds |
|---|---|---|---|
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 5.07 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 5.07 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 2.90 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.54 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 2.17 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.45 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.72 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.72 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.72 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.72 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.72 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 0.72 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 0.36 |
| COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 0.36 |
| COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 0.36 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.36 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.36 |
| COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.19 % |
| Unclassified | root | N/A | 26.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0811068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1003940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2802 | Open in IMG/M |
| 3300000858|JGI10213J12805_11018130 | Not Available | 826 | Open in IMG/M |
| 3300002906|JGI25614J43888_10017956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2270 | Open in IMG/M |
| 3300002906|JGI25614J43888_10049555 | Not Available | 1272 | Open in IMG/M |
| 3300002910|JGI25615J43890_1078023 | Not Available | 576 | Open in IMG/M |
| 3300004281|Ga0066397_10037397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300004633|Ga0066395_10024081 | All Organisms → cellular organisms → Bacteria | 2458 | Open in IMG/M |
| 3300004633|Ga0066395_10033155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2170 | Open in IMG/M |
| 3300004633|Ga0066395_10233576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300005166|Ga0066674_10313440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300005167|Ga0066672_10731509 | Not Available | 630 | Open in IMG/M |
| 3300005167|Ga0066672_10784595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300005167|Ga0066672_10788716 | Not Available | 599 | Open in IMG/M |
| 3300005172|Ga0066683_10313837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 974 | Open in IMG/M |
| 3300005172|Ga0066683_10801941 | Not Available | 547 | Open in IMG/M |
| 3300005174|Ga0066680_10242919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1143 | Open in IMG/M |
| 3300005174|Ga0066680_10312652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
| 3300005179|Ga0066684_10197927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1298 | Open in IMG/M |
| 3300005180|Ga0066685_10382391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300005180|Ga0066685_11024167 | Not Available | 544 | Open in IMG/M |
| 3300005180|Ga0066685_11074817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300005181|Ga0066678_10383272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 931 | Open in IMG/M |
| 3300005187|Ga0066675_10347607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1084 | Open in IMG/M |
| 3300005187|Ga0066675_10730830 | Not Available | 745 | Open in IMG/M |
| 3300005332|Ga0066388_100045489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4417 | Open in IMG/M |
| 3300005332|Ga0066388_100748693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1577 | Open in IMG/M |
| 3300005332|Ga0066388_101368823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
| 3300005332|Ga0066388_101427895 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300005332|Ga0066388_101519803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1172 | Open in IMG/M |
| 3300005332|Ga0066388_101562486 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300005332|Ga0066388_102109025 | Not Available | 1014 | Open in IMG/M |
| 3300005332|Ga0066388_102127543 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300005332|Ga0066388_103168045 | Not Available | 841 | Open in IMG/M |
| 3300005332|Ga0066388_103394500 | Not Available | 813 | Open in IMG/M |
| 3300005332|Ga0066388_104800025 | Not Available | 688 | Open in IMG/M |
| 3300005332|Ga0066388_104815858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300005332|Ga0066388_107680679 | Not Available | 540 | Open in IMG/M |
| 3300005363|Ga0008090_10071173 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300005363|Ga0008090_10156861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 960 | Open in IMG/M |
| 3300005363|Ga0008090_10264986 | Not Available | 606 | Open in IMG/M |
| 3300005366|Ga0070659_101670029 | Not Available | 569 | Open in IMG/M |
| 3300005434|Ga0070709_10015817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 4295 | Open in IMG/M |
| 3300005434|Ga0070709_11515687 | Not Available | 545 | Open in IMG/M |
| 3300005436|Ga0070713_100053141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 3356 | Open in IMG/M |
| 3300005450|Ga0066682_10068170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2191 | Open in IMG/M |
| 3300005451|Ga0066681_10587729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300005468|Ga0070707_100191655 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
| 3300005518|Ga0070699_100001923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 18758 | Open in IMG/M |
| 3300005552|Ga0066701_10228908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1146 | Open in IMG/M |
| 3300005554|Ga0066661_10074094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1993 | Open in IMG/M |
| 3300005556|Ga0066707_10031155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2954 | Open in IMG/M |
| 3300005557|Ga0066704_10129346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1681 | Open in IMG/M |
| 3300005558|Ga0066698_10199141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1369 | Open in IMG/M |
| 3300005568|Ga0066703_10793171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300005587|Ga0066654_10171140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1114 | Open in IMG/M |
| 3300005713|Ga0066905_100023235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3354 | Open in IMG/M |
| 3300005713|Ga0066905_100054607 | All Organisms → cellular organisms → Bacteria | 2469 | Open in IMG/M |
| 3300005713|Ga0066905_100135043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1749 | Open in IMG/M |
| 3300005713|Ga0066905_100294849 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300005713|Ga0066905_100509066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1002 | Open in IMG/M |
| 3300005713|Ga0066905_100538990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300005713|Ga0066905_100642660 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300005713|Ga0066905_100758870 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005713|Ga0066905_100855767 | Not Available | 792 | Open in IMG/M |
| 3300005713|Ga0066905_100892238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 777 | Open in IMG/M |
| 3300005713|Ga0066905_101289885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300005764|Ga0066903_101448768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1293 | Open in IMG/M |
| 3300005764|Ga0066903_102152344 | Not Available | 1075 | Open in IMG/M |
| 3300005764|Ga0066903_104806474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Aurantiacibacter → Aurantiacibacter sediminis | 718 | Open in IMG/M |
| 3300005764|Ga0066903_104831485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300005764|Ga0066903_106397241 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005764|Ga0066903_106966117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300005764|Ga0066903_107253918 | Not Available | 573 | Open in IMG/M |
| 3300005764|Ga0066903_107487554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300005764|Ga0066903_107825354 | Not Available | 549 | Open in IMG/M |
| 3300005764|Ga0066903_107974140 | Not Available | 543 | Open in IMG/M |
| 3300005937|Ga0081455_10001663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 26933 | Open in IMG/M |
| 3300005937|Ga0081455_10140865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1873 | Open in IMG/M |
| 3300005983|Ga0081540_1079651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1480 | Open in IMG/M |
| 3300006028|Ga0070717_10229064 | Not Available | 1636 | Open in IMG/M |
| 3300006031|Ga0066651_10321471 | Not Available | 830 | Open in IMG/M |
| 3300006046|Ga0066652_101120474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300006049|Ga0075417_10126720 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300006050|Ga0075028_100994161 | Not Available | 521 | Open in IMG/M |
| 3300006755|Ga0079222_12341333 | Not Available | 534 | Open in IMG/M |
| 3300006791|Ga0066653_10101521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1313 | Open in IMG/M |
| 3300006794|Ga0066658_10291665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300006796|Ga0066665_11347264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300006796|Ga0066665_11513552 | Not Available | 524 | Open in IMG/M |
| 3300006797|Ga0066659_11835203 | Not Available | 514 | Open in IMG/M |
| 3300006800|Ga0066660_11466706 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006806|Ga0079220_10688049 | Not Available | 748 | Open in IMG/M |
| 3300006844|Ga0075428_100066081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3960 | Open in IMG/M |
| 3300006854|Ga0075425_100447004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1489 | Open in IMG/M |
| 3300006871|Ga0075434_100599619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1121 | Open in IMG/M |
| 3300006871|Ga0075434_101574869 | Not Available | 666 | Open in IMG/M |
| 3300006953|Ga0074063_10043113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1299 | Open in IMG/M |
| 3300009012|Ga0066710_102819411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 686 | Open in IMG/M |
| 3300009012|Ga0066710_103274058 | Not Available | 620 | Open in IMG/M |
| 3300009137|Ga0066709_100508488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1698 | Open in IMG/M |
| 3300009137|Ga0066709_101892830 | Not Available | 831 | Open in IMG/M |
| 3300009137|Ga0066709_102471825 | Not Available | 702 | Open in IMG/M |
| 3300009137|Ga0066709_102972430 | Not Available | 623 | Open in IMG/M |
| 3300009143|Ga0099792_10852534 | Not Available | 600 | Open in IMG/M |
| 3300009792|Ga0126374_10118557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1542 | Open in IMG/M |
| 3300009792|Ga0126374_10209835 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300009792|Ga0126374_10953202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300010041|Ga0126312_10807023 | Not Available | 681 | Open in IMG/M |
| 3300010043|Ga0126380_11858201 | Not Available | 546 | Open in IMG/M |
| 3300010046|Ga0126384_10109799 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300010046|Ga0126384_11593480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300010047|Ga0126382_10008405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4838 | Open in IMG/M |
| 3300010047|Ga0126382_10580373 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300010048|Ga0126373_13197032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300010159|Ga0099796_10282053 | Not Available | 699 | Open in IMG/M |
| 3300010333|Ga0134080_10095426 | Not Available | 1217 | Open in IMG/M |
| 3300010358|Ga0126370_10828041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 828 | Open in IMG/M |
| 3300010358|Ga0126370_11907371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300010358|Ga0126370_11912470 | Not Available | 577 | Open in IMG/M |
| 3300010359|Ga0126376_10596309 | Not Available | 1044 | Open in IMG/M |
| 3300010360|Ga0126372_10135730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1934 | Open in IMG/M |
| 3300010361|Ga0126378_10711225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. HBU65207 | 1116 | Open in IMG/M |
| 3300010361|Ga0126378_13294955 | Not Available | 513 | Open in IMG/M |
| 3300010362|Ga0126377_12716417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300010366|Ga0126379_10231243 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300010366|Ga0126379_11518605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300010371|Ga0134125_11714521 | Not Available | 683 | Open in IMG/M |
| 3300010376|Ga0126381_100092734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 3834 | Open in IMG/M |
| 3300010376|Ga0126381_101124707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1135 | Open in IMG/M |
| 3300010376|Ga0126381_102676663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300010398|Ga0126383_10895701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Aurantiacibacter → Aurantiacibacter sediminis | 973 | Open in IMG/M |
| 3300010398|Ga0126383_11459272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300010868|Ga0124844_1106714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1067 | Open in IMG/M |
| 3300010868|Ga0124844_1132927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 948 | Open in IMG/M |
| 3300012189|Ga0137388_10031649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4124 | Open in IMG/M |
| 3300012198|Ga0137364_10015309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4549 | Open in IMG/M |
| 3300012198|Ga0137364_10318523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1157 | Open in IMG/M |
| 3300012199|Ga0137383_10749779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 713 | Open in IMG/M |
| 3300012200|Ga0137382_10559991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300012200|Ga0137382_11300860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300012202|Ga0137363_10094732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2255 | Open in IMG/M |
| 3300012202|Ga0137363_11166703 | Not Available | 655 | Open in IMG/M |
| 3300012204|Ga0137374_10014351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9176 | Open in IMG/M |
| 3300012204|Ga0137374_10783389 | Not Available | 708 | Open in IMG/M |
| 3300012206|Ga0137380_11120767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300012208|Ga0137376_10432587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1143 | Open in IMG/M |
| 3300012208|Ga0137376_11552405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300012209|Ga0137379_10756208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300012210|Ga0137378_10783765 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300012285|Ga0137370_10208663 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300012350|Ga0137372_10443678 | Not Available | 974 | Open in IMG/M |
| 3300012356|Ga0137371_10639052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 816 | Open in IMG/M |
| 3300012356|Ga0137371_11145568 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012359|Ga0137385_11091117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300012361|Ga0137360_11353049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300012361|Ga0137360_11618381 | Not Available | 553 | Open in IMG/M |
| 3300012582|Ga0137358_10108966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1878 | Open in IMG/M |
| 3300012948|Ga0126375_10522006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300012948|Ga0126375_10541688 | Not Available | 877 | Open in IMG/M |
| 3300012948|Ga0126375_11572233 | Not Available | 565 | Open in IMG/M |
| 3300012955|Ga0164298_10376691 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300012957|Ga0164303_10548702 | Not Available | 750 | Open in IMG/M |
| 3300012958|Ga0164299_11235374 | Not Available | 567 | Open in IMG/M |
| 3300012971|Ga0126369_10358945 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300012971|Ga0126369_12295476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300013306|Ga0163162_11530349 | Not Available | 760 | Open in IMG/M |
| 3300013307|Ga0157372_13464415 | Not Available | 501 | Open in IMG/M |
| 3300013760|Ga0120188_1031554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 610 | Open in IMG/M |
| 3300014157|Ga0134078_10273790 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300014157|Ga0134078_10314359 | Not Available | 678 | Open in IMG/M |
| 3300015372|Ga0132256_100441867 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300016270|Ga0182036_10466391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300016270|Ga0182036_10914920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300016294|Ga0182041_10039113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3116 | Open in IMG/M |
| 3300016294|Ga0182041_11763476 | Not Available | 574 | Open in IMG/M |
| 3300016341|Ga0182035_10315162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1288 | Open in IMG/M |
| 3300016422|Ga0182039_12214701 | Not Available | 507 | Open in IMG/M |
| 3300017659|Ga0134083_10483629 | Not Available | 552 | Open in IMG/M |
| 3300018078|Ga0184612_10037753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2510 | Open in IMG/M |
| 3300018431|Ga0066655_10119046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1514 | Open in IMG/M |
| 3300018433|Ga0066667_10082773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2074 | Open in IMG/M |
| 3300018433|Ga0066667_10613495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 908 | Open in IMG/M |
| 3300018433|Ga0066667_11337391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300018468|Ga0066662_10893736 | Not Available | 871 | Open in IMG/M |
| 3300018468|Ga0066662_11589568 | Not Available | 682 | Open in IMG/M |
| 3300018482|Ga0066669_10060288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2452 | Open in IMG/M |
| 3300018482|Ga0066669_10398988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300018482|Ga0066669_10663356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300018482|Ga0066669_11858323 | Not Available | 559 | Open in IMG/M |
| 3300019789|Ga0137408_1064976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1498 | Open in IMG/M |
| 3300020580|Ga0210403_10504327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
| 3300021168|Ga0210406_10677511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300021178|Ga0210408_10867935 | Not Available | 704 | Open in IMG/M |
| 3300021178|Ga0210408_11266168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300021361|Ga0213872_10019377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3134 | Open in IMG/M |
| 3300021405|Ga0210387_10751233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300021432|Ga0210384_10269018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1534 | Open in IMG/M |
| 3300021560|Ga0126371_10545972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
| 3300021560|Ga0126371_11208352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
| 3300021560|Ga0126371_11320547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 854 | Open in IMG/M |
| 3300021560|Ga0126371_13596967 | Not Available | 523 | Open in IMG/M |
| 3300025898|Ga0207692_10212436 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300025898|Ga0207692_10532059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300025905|Ga0207685_10203227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
| 3300025939|Ga0207665_11147571 | Not Available | 620 | Open in IMG/M |
| 3300026118|Ga0207675_102592665 | Not Available | 517 | Open in IMG/M |
| 3300026304|Ga0209240_1005643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4717 | Open in IMG/M |
| 3300026550|Ga0209474_10049343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3020 | Open in IMG/M |
| 3300026552|Ga0209577_10271820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1273 | Open in IMG/M |
| 3300027646|Ga0209466_1005763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2611 | Open in IMG/M |
| 3300027909|Ga0209382_10192452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2342 | Open in IMG/M |
| 3300028722|Ga0307319_10321530 | Not Available | 513 | Open in IMG/M |
| 3300028878|Ga0307278_10123166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300028881|Ga0307277_10000119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 24268 | Open in IMG/M |
| 3300029636|Ga0222749_10679158 | Not Available | 564 | Open in IMG/M |
| 3300031543|Ga0318516_10295771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300031544|Ga0318534_10053613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2262 | Open in IMG/M |
| 3300031545|Ga0318541_10339002 | Not Available | 839 | Open in IMG/M |
| 3300031546|Ga0318538_10332158 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031549|Ga0318571_10174240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300031640|Ga0318555_10367447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300031640|Ga0318555_10498740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300031668|Ga0318542_10122858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1271 | Open in IMG/M |
| 3300031668|Ga0318542_10592583 | Not Available | 578 | Open in IMG/M |
| 3300031682|Ga0318560_10385391 | Not Available | 758 | Open in IMG/M |
| 3300031719|Ga0306917_10597762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 867 | Open in IMG/M |
| 3300031719|Ga0306917_10773448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300031724|Ga0318500_10064756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1590 | Open in IMG/M |
| 3300031736|Ga0318501_10675512 | Not Available | 569 | Open in IMG/M |
| 3300031744|Ga0306918_10148230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1729 | Open in IMG/M |
| 3300031764|Ga0318535_10405390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300031781|Ga0318547_10036113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2580 | Open in IMG/M |
| 3300031781|Ga0318547_10059511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2083 | Open in IMG/M |
| 3300031782|Ga0318552_10047585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2023 | Open in IMG/M |
| 3300031782|Ga0318552_10642198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300031793|Ga0318548_10332908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300031794|Ga0318503_10109218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300031797|Ga0318550_10132048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
| 3300031797|Ga0318550_10444907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300031805|Ga0318497_10605010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 615 | Open in IMG/M |
| 3300031820|Ga0307473_10283747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300031831|Ga0318564_10122257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1159 | Open in IMG/M |
| 3300031833|Ga0310917_10147214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1551 | Open in IMG/M |
| 3300031833|Ga0310917_10225627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1257 | Open in IMG/M |
| 3300031835|Ga0318517_10340633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300031879|Ga0306919_10558136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
| 3300031879|Ga0306919_10735275 | Not Available | 759 | Open in IMG/M |
| 3300031894|Ga0318522_10030877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1811 | Open in IMG/M |
| 3300031896|Ga0318551_10045883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2187 | Open in IMG/M |
| 3300031896|Ga0318551_10102324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1525 | Open in IMG/M |
| 3300031896|Ga0318551_10642662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300031910|Ga0306923_10193851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. | 2322 | Open in IMG/M |
| 3300031941|Ga0310912_11068404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300031942|Ga0310916_10173850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1790 | Open in IMG/M |
| 3300031959|Ga0318530_10099972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1152 | Open in IMG/M |
| 3300031981|Ga0318531_10400875 | Not Available | 621 | Open in IMG/M |
| 3300032010|Ga0318569_10086679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1401 | Open in IMG/M |
| 3300032010|Ga0318569_10455789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300032043|Ga0318556_10092379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1524 | Open in IMG/M |
| 3300032054|Ga0318570_10345304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300032059|Ga0318533_10784665 | Not Available | 699 | Open in IMG/M |
| 3300032059|Ga0318533_11030169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300032060|Ga0318505_10011614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3192 | Open in IMG/M |
| 3300032060|Ga0318505_10238911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 854 | Open in IMG/M |
| 3300032066|Ga0318514_10508791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300032066|Ga0318514_10657693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300032090|Ga0318518_10041563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2153 | Open in IMG/M |
| 3300032091|Ga0318577_10059739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1727 | Open in IMG/M |
| 3300032174|Ga0307470_11928738 | Not Available | 503 | Open in IMG/M |
| 3300032180|Ga0307471_103868522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300032205|Ga0307472_100168819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1624 | Open in IMG/M |
| 3300032205|Ga0307472_102615293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300032261|Ga0306920_101143813 | Not Available | 1127 | Open in IMG/M |
| 3300033289|Ga0310914_10757136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300033290|Ga0318519_10018614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3055 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 14.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.45% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.09% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.09% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.36% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.36% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_08110682 | 2228664022 | Soil | MRDGFDYEIPDTTACKEWLGIVGSIVAAVAICAFLFGGSIFT |
| AF_2010_repII_A100DRAFT_10039402 | 3300000655 | Forest Soil | MRDRFDSRXPDTAPYKEWLGIVGTMLAAVVXCAFLFGGGVLT* |
| JGI10213J12805_110181302 | 3300000858 | Soil | MVDGGSAMLEDLEREIRDTAPYAEWLGIVGSMAVAALVCAVLFSGGIFT* |
| JGI25614J43888_100179563 | 3300002906 | Grasslands Soil | MRDHFDSGIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGILT* |
| JGI25614J43888_100495553 | 3300002906 | Grasslands Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| JGI25615J43890_10780232 | 3300002910 | Grasslands Soil | MRDIFESKIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066397_100373971 | 3300004281 | Tropical Forest Soil | MREILESEIPDTAPYKEWLGIVGSMGVAVLICAVLFAGGVLT* |
| Ga0066395_100240812 | 3300004633 | Tropical Forest Soil | MRDIIEKEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066395_100331552 | 3300004633 | Tropical Forest Soil | MRDSFDYDIPDTSACKEWLGVVGSMMVAVAICAVLYAGGILT* |
| Ga0066395_102335761 | 3300004633 | Tropical Forest Soil | MREILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066674_103134401 | 3300005166 | Soil | MRDIFENEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066672_107315091 | 3300005167 | Soil | MRASLRGIPDTTPYKEWLGFVGSIVVAVLVYVVALSGSVPT* |
| Ga0066672_107845952 | 3300005167 | Soil | MGGAMRETLESGIADTAPYKEWLGLVASMMVPVLICALLFAGGIPT* |
| Ga0066672_107887162 | 3300005167 | Soil | MRDTLQRGVPDTAPYKEWLGIVGSMVAAVAICAVLFAGGFLT* |
| Ga0066683_103138371 | 3300005172 | Soil | MRKTLESGIPDTAPYKEWLGLVCSMVAAVLICAVLFAGVS* |
| Ga0066683_108019411 | 3300005172 | Soil | MGGVMRKTLESGIPDTAPYKEWLGLVCSMVAAVLICAVLFAGVS |
| Ga0066680_102429191 | 3300005174 | Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLYAGGVLT* |
| Ga0066680_103126521 | 3300005174 | Soil | MRDDFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILM* |
| Ga0066684_101979271 | 3300005179 | Soil | MGGAMRETLERGIPDTAPYKEWLGLVCSMVAAVLIYALLFAGVS* |
| Ga0066685_103823912 | 3300005180 | Soil | MGGVMRETLESGIPDTAPYKEWLGLVCSMVAAVLICALLFAGVS* |
| Ga0066685_110241671 | 3300005180 | Soil | MRDTLQRGVPDTAPYKEWLGIVGSMVAAVAICAVLFAGGVLT |
| Ga0066685_110748171 | 3300005180 | Soil | MRDSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILM* |
| Ga0066678_103832721 | 3300005181 | Soil | MGGVMRETLESGIPDTAPYKEWLGLVCSMVAAVLICAVLFAGVS* |
| Ga0066675_103476071 | 3300005187 | Soil | MRDIFENEIPDTAPYKEWLGIVGSMLVAVLICVVLFAGGVLT* |
| Ga0066675_107308302 | 3300005187 | Soil | MRNRLDSRLPDTAPYKEWLGIVGSMLAAVAICGVLFAGGLLT* |
| Ga0066388_1000454894 | 3300005332 | Tropical Forest Soil | MRDGFDYEIPDTTACKEWLGIVGSMVAAVAICAFLFGGSIFT* |
| Ga0066388_1007486932 | 3300005332 | Tropical Forest Soil | MRNRLDSRLPDTAPYKEWLGIVGSMLAAVAICGVLFARGFFT* |
| Ga0066388_1013688232 | 3300005332 | Tropical Forest Soil | MRNRLDSRIPDTSPYKEWLGIVGSMMAAIAICAVLFAGGLLT* |
| Ga0066388_1014278952 | 3300005332 | Tropical Forest Soil | MGDAVRNRLDRRIPDTTPYKEWLGIVGSMVAAVAICAVLFAGGLLT* |
| Ga0066388_1015198031 | 3300005332 | Tropical Forest Soil | MRKTVEHGIPDTAPYKEWLGIVGTMAVAVLICAVLFASSIPT* |
| Ga0066388_1015624861 | 3300005332 | Tropical Forest Soil | DHRTGGAMRDILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066388_1021090252 | 3300005332 | Tropical Forest Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVIICAVLFAGGVLT* |
| Ga0066388_1021275432 | 3300005332 | Tropical Forest Soil | MRDIFESELPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066388_1031680452 | 3300005332 | Tropical Forest Soil | MRNRLDSRIPDTAPYKEWLGIVGSMLAAVAICGVLFAGGILT* |
| Ga0066388_1033945001 | 3300005332 | Tropical Forest Soil | MRDRFDSRIPDTAPYKEWLGIVGTMLAAVVICAFLFGGGVLT* |
| Ga0066388_1048000251 | 3300005332 | Tropical Forest Soil | MRNRLDSRIPDTAPYKEWLGIVGSMMAAVAICAVLFAGGLLT* |
| Ga0066388_1048158581 | 3300005332 | Tropical Forest Soil | MREIFEGEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066388_1076806791 | 3300005332 | Tropical Forest Soil | MRNRLDSRLPDTAPYKEWLGIVGSMLAAVAICGILFAGGLLT* |
| Ga0008090_100711732 | 3300005363 | Tropical Rainforest Soil | MRKRLDSRIPDTSAYKEWLGIVGSMMAAVAICAVLFAGGLLT* |
| Ga0008090_101568612 | 3300005363 | Tropical Rainforest Soil | MRDRFGSRIPDTAPYKEWLGIVGTMLAAVVICAFLFGGSVLI* |
| Ga0008090_102649862 | 3300005363 | Tropical Rainforest Soil | MRDRFDSRIPDTAPYKEWLGIVRTMLAAVVICAFLFGGGVLT* |
| Ga0070659_1016700291 | 3300005366 | Corn Rhizosphere | MGDAMRNRLDSRIPDTAPYKEWLGIVGSMLAAVAICGALFAGGFFT* |
| Ga0070709_100158172 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDAMRNRLDSRIPDTSPYKEWLGIVGSMMAAIAICAVLFAGGLLT* |
| Ga0070709_115156871 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRLDSRIPDTAPYKEWLGIVGSMLAAVAICGALFAGGFFT* |
| Ga0070713_1000531411 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDAMRNRLDSRIPDTAPYKEWLGIVGSMMAALVICAVLFAGGLLT* |
| Ga0066682_100681702 | 3300005450 | Soil | MRDSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILI* |
| Ga0066681_105877292 | 3300005451 | Soil | MGGVMRKTLESGIPDTAPYKEWLGLVCSMVAAVLICAVLFAGVS* |
| Ga0070707_1001916553 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICVVLFAGGVLT* |
| Ga0070699_10000192321 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MREILESEIPDTAPYKEWLGIVGSMLVAVLICAVLYAGGVLT* |
| Ga0066701_102289081 | 3300005552 | Soil | DSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILM* |
| Ga0066661_100740942 | 3300005554 | Soil | MRETLERGIPDTAPYKEWLGLVCSMVAAVLIYALLFAGVS* |
| Ga0066707_100311552 | 3300005556 | Soil | MRETLERGIPDTAAYKEWLGLVCSMVAAVLICAVLFAGVS* |
| Ga0066704_101293462 | 3300005557 | Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGG |
| Ga0066698_101991412 | 3300005558 | Soil | MGGAMRKTLESGIPDTAPYKEWLGLVCSMVAAVLICAVLFAGVS* |
| Ga0066703_107931711 | 3300005568 | Soil | MRDSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIIFI* |
| Ga0066654_101711402 | 3300005587 | Soil | MGGAMRETLESGIPDTAPYKEWLGLVCSMVAAVLICAVLFAGVS* |
| Ga0066905_1000232353 | 3300005713 | Tropical Forest Soil | MRDGFDYEIPDTTACKEWLGIVGSIVAAVAICAFLFGGSIFT* |
| Ga0066905_1000546071 | 3300005713 | Tropical Forest Soil | HRTGGAMREIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066905_1001350432 | 3300005713 | Tropical Forest Soil | MRKTVEHGIPDTAPYKEWLGIVGTIAVAVLICAVLFASSIPT* |
| Ga0066905_1002948492 | 3300005713 | Tropical Forest Soil | MREIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066905_1005090662 | 3300005713 | Tropical Forest Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAALFAGGVLT* |
| Ga0066905_1005389902 | 3300005713 | Tropical Forest Soil | AMRNRLDRRIPDTTPYKEWLGIVGSMVAAVAICAVLFAGGLLT* |
| Ga0066905_1006426602 | 3300005713 | Tropical Forest Soil | MREIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFASGVLT* |
| Ga0066905_1007588702 | 3300005713 | Tropical Forest Soil | MRDGFDFEIPDTTACKEWLGIVGSMVAAVAICAFLFGGSIFT* |
| Ga0066905_1008557671 | 3300005713 | Tropical Forest Soil | MKHSLDGAMRETLENGTPDTAPYKEWLGIAGSMVVAVLICGVLLAGGVPT* |
| Ga0066905_1008922382 | 3300005713 | Tropical Forest Soil | MRDILESEIPDPAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066905_1012898852 | 3300005713 | Tropical Forest Soil | MANKRGKAMRDSFDYEIPDTTACKEWLGVVGSMMAAVAICAVLFAGGILT* |
| Ga0066903_1014487682 | 3300005764 | Tropical Forest Soil | MRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066903_1021523441 | 3300005764 | Tropical Forest Soil | MRDSFESEIPDTAPYKEWLGVVGSLMVAALICAVLFAGGILS* |
| Ga0066903_1048064741 | 3300005764 | Tropical Forest Soil | EIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066903_1048314851 | 3300005764 | Tropical Forest Soil | RNRLDSRLPDTAPYKEWLGIVGSMLAAVAICGVLFAGGLLT* |
| Ga0066903_1063972411 | 3300005764 | Tropical Forest Soil | MRNRLDSRLPDTAPYKEWLGIVGSMLAAVAICGVLFAGGFFT* |
| Ga0066903_1069661172 | 3300005764 | Tropical Forest Soil | MRDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGVLT* |
| Ga0066903_1072539182 | 3300005764 | Tropical Forest Soil | FDYDIPDTSACKEWLGVVGSMMVAVAICAVLYAGGILT* |
| Ga0066903_1074875541 | 3300005764 | Tropical Forest Soil | RRRHNDHRRGGAMRDIFESEIPDTTPYKEWLGIVSSMLVAVLICAVLFAGGVLT* |
| Ga0066903_1078253541 | 3300005764 | Tropical Forest Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVIICAVLFAGGILT* |
| Ga0066903_1079741402 | 3300005764 | Tropical Forest Soil | RRRGGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0081455_100016637 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRDSLQRGIPDTAPYKEWLGVVGSMVAAVLICAVLFSAGFLT* |
| Ga0081455_101408651 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MREILESEIPDTAPYKEWLGIVGSMGVAVLICAVLLAGG |
| Ga0081540_10796512 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MRNKLDSRIPDTSPYKEWLGIVGSMVAALAICAVLFAGG |
| Ga0070717_102290641 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRLDSRIPDTAPYKEWLGIVGSMMAALVICAVLFAGGLLT* |
| Ga0066651_103214711 | 3300006031 | Soil | MRNRLASRLPDTAPSKEWLGIVGAILAAVAICGVLVAGGLLT* |
| Ga0066652_1011204742 | 3300006046 | Soil | SGIPDTAPYKEWLGLVCSMVAAVLICAVLFAGVS* |
| Ga0075417_101267202 | 3300006049 | Populus Rhizosphere | MGDAMRDTLDKRIPDTAPYKEWLGIVGSMMAAVLICAVLFSAGVLT* |
| Ga0075028_1009941611 | 3300006050 | Watersheds | MRKTVENGIPDTAPYKEWLGIVGTMAVAVLICAVLFASSVPT* |
| Ga0079222_123413332 | 3300006755 | Agricultural Soil | MRDIFESEVPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066653_101015213 | 3300006791 | Soil | MGGVMRKTLESGIPDTAPYKEWLGLVCSMVAAVLIYALLFAGVS* |
| Ga0066658_102916652 | 3300006794 | Soil | MRNRLDSRLPDTAPYKEWLGIVGSMLAAVAICGVWFAGGLLT* |
| Ga0066665_113472642 | 3300006796 | Soil | GAMRDIFESEIPDTAPYKEWLGIVGSMLVAVLICVVLFAGGVLT* |
| Ga0066665_115135522 | 3300006796 | Soil | RDSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILM* |
| Ga0066659_118352031 | 3300006797 | Soil | SGIPDTAPYKEWLGLVCSMVAAVLICAVLFAGAS* |
| Ga0066660_114667061 | 3300006800 | Soil | CQTGDAMRNRLDSRLPDTAPYKEWLGIVGSMLAAVAICGVLFAGGLLT* |
| Ga0079220_106880491 | 3300006806 | Agricultural Soil | MGDVMRNRLDSRIPDTAPYKEWLGIVGSMLAAVAICGALFAGGFFT* |
| Ga0075428_1000660814 | 3300006844 | Populus Rhizosphere | MGDAMRDTLDKRIPDTAPYKEWLGIVGSMMAAVLICAVLFSAGVRT* |
| Ga0075425_1004470043 | 3300006854 | Populus Rhizosphere | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFASGVLT* |
| Ga0075434_1005996192 | 3300006871 | Populus Rhizosphere | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGSVLT* |
| Ga0075434_1015748692 | 3300006871 | Populus Rhizosphere | MRKTAENGIPDTAPYKEWLGIVGTMAVAVLICAVLFASSIPT* |
| Ga0074063_100431131 | 3300006953 | Soil | MRDIFESEIPDTGPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0066710_1028194112 | 3300009012 | Grasslands Soil | MRDDFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIIFI |
| Ga0066710_1032740582 | 3300009012 | Grasslands Soil | TLESGIPDTAPYKEWLGLVCSMVAAVLICALLFAGVS |
| Ga0066709_1005084884 | 3300009137 | Grasslands Soil | MRKTVENGIPDTAPYKEWLGIVGTMAVAVLICAVLFASSVQT* |
| Ga0066709_1018928301 | 3300009137 | Grasslands Soil | MRKTVEKRIPDTAPYKEWLGIVGTMALAVLICAVLFAGAVPT* |
| Ga0066709_1024718251 | 3300009137 | Grasslands Soil | MRDDFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILI* |
| Ga0066709_1029724301 | 3300009137 | Grasslands Soil | SGIPDTAPYKEWLGLVCSMVAAVLICALLFAGVS* |
| Ga0099792_108525342 | 3300009143 | Vadose Zone Soil | MRNRLDSRIPDTAPYKEWLGIVGSMMAAVAICAVLFAGGFLT* |
| Ga0126374_101185572 | 3300009792 | Tropical Forest Soil | MGDAVRNRLDRRIPDTTPYKEWLGIVGSMVAAVAICAVLFAGGLRT* |
| Ga0126374_102098353 | 3300009792 | Tropical Forest Soil | GAMRDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGVLT* |
| Ga0126374_109532021 | 3300009792 | Tropical Forest Soil | MRDILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0126312_108070231 | 3300010041 | Serpentine Soil | MRDNLQRGIPDTAPYKEWLGVVRSMMAAVAICAVLFSAGFLT* |
| Ga0126380_118582011 | 3300010043 | Tropical Forest Soil | MRDRFDSRIPDTAPYKEWLGIVGTMLAAVVICAFLFG |
| Ga0126384_101097994 | 3300010046 | Tropical Forest Soil | NDHRRGGAMRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0126384_115934802 | 3300010046 | Tropical Forest Soil | MREIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFA |
| Ga0126382_100084057 | 3300010047 | Tropical Forest Soil | MREILESEIPDTAPYKEWLGIVGSMGVVVLICAVLFAGGVLT* |
| Ga0126382_105803732 | 3300010047 | Tropical Forest Soil | MRDSFDYEIPDTTACKEWLGVVGSMMAAVAICAVLFAGGILT* |
| Ga0126373_131970321 | 3300010048 | Tropical Forest Soil | ILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFEGGVLT* |
| Ga0099796_102820531 | 3300010159 | Vadose Zone Soil | MRNRLDSRIPDTTPYKEWLGIVGSMMAALVICAVLFAGGLLT* |
| Ga0134080_100954262 | 3300010333 | Grasslands Soil | MRDNFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIIFI* |
| Ga0126370_108280411 | 3300010358 | Tropical Forest Soil | MRDIFEKEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0126370_119073712 | 3300010358 | Tropical Forest Soil | AMRKTLEGGIPDTAPYKEWLGLVATMAVAVLICAVLFAASVPA* |
| Ga0126370_119124702 | 3300010358 | Tropical Forest Soil | MRNRLDSRIPDTAPYKEWLGIVGSMLAAVAICGVLFAGGLLT* |
| Ga0126376_105963092 | 3300010359 | Tropical Forest Soil | MRNRLDSRIPDTAPYKEWLGIVGSMMAAVASGAVLFAGGLLT* |
| Ga0126372_101357304 | 3300010360 | Tropical Forest Soil | RRGGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0126378_107112252 | 3300010361 | Tropical Forest Soil | MREIFESEIPDTAPYKERLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0126378_132949551 | 3300010361 | Tropical Forest Soil | LDSRIPDTSAYKEWLGIVGSMMAAVAICAVLFAGGLLT* |
| Ga0126377_127164172 | 3300010362 | Tropical Forest Soil | MREILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFA |
| Ga0126379_102312431 | 3300010366 | Tropical Forest Soil | IFEKEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0126379_115186051 | 3300010366 | Tropical Forest Soil | ITDHRTGGAMREILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0134125_117145211 | 3300010371 | Terrestrial Soil | MGDAMRNRLDSRIPDTAPYQEWLGIVGSMMAAIAICAVLFAGGLLT* |
| Ga0126381_1000927342 | 3300010376 | Tropical Forest Soil | MRDRFDSRIPDTAPYKEWLGIVGTMLAAVVICAFLFGSGVLT* |
| Ga0126381_1011247071 | 3300010376 | Tropical Forest Soil | AMRKTLEGGIPDTAPYKEWLGLVATMAVAVLICAVLFAASVPT* |
| Ga0126381_1026766631 | 3300010376 | Tropical Forest Soil | DRRRGGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0126383_108957011 | 3300010398 | Tropical Forest Soil | HRTGGAMRDILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0126383_114592721 | 3300010398 | Tropical Forest Soil | ESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0124844_11067141 | 3300010868 | Tropical Forest Soil | MREIFESEIPDTAPYKEWLGIVGSMLVAVLICAVL |
| Ga0124844_11329272 | 3300010868 | Tropical Forest Soil | MREIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVL |
| Ga0137388_100316497 | 3300012189 | Vadose Zone Soil | ESKIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0137364_100153095 | 3300012198 | Vadose Zone Soil | MRETLESGIADTAPYKEWLGLVASMMVPVLICALLFAGGIPT* |
| Ga0137364_103185232 | 3300012198 | Vadose Zone Soil | MRNRLDRGIPDTAPYKEWLGIVGSMMAAVAICAVLFAGGFLT* |
| Ga0137383_107497792 | 3300012199 | Vadose Zone Soil | MGGAMRDTLDKRIPDTAPYKEWLGVVGSMMAAVAVCAVLFSAGILT* |
| Ga0137382_105599911 | 3300012200 | Vadose Zone Soil | SVVEWGVAMRETLESGIPDTAPYKEWLGIVGTMALAVLICAVLFAGGVPT* |
| Ga0137382_113008601 | 3300012200 | Vadose Zone Soil | MRDSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGILT* |
| Ga0137363_100947322 | 3300012202 | Vadose Zone Soil | MREALEFETFDIAPYKEWLGVVGSLILAALICAVLFAG* |
| Ga0137363_111667032 | 3300012202 | Vadose Zone Soil | MRDNFASGIPDTAPYKEWLGVVGSMMAAVAICAVLYAGGILT* |
| Ga0137374_100143518 | 3300012204 | Vadose Zone Soil | MGGAMRDTLDKRIPDTAPYKEWLGVVGSMMAAVAICAVLFSAGILT* |
| Ga0137374_107833892 | 3300012204 | Vadose Zone Soil | MGDAMRDTLDKRIPDTAPYKEWLGIVGSMMAAVAICAVLFSAGVLT* |
| Ga0137380_111207672 | 3300012206 | Vadose Zone Soil | MRDNFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILM* |
| Ga0137376_104325872 | 3300012208 | Vadose Zone Soil | MGDAMRNRLDRGIPDTAPYKEWLGIVGSMMAAVAICAVLFAGGFLT* |
| Ga0137376_115524052 | 3300012208 | Vadose Zone Soil | MRDSFENQIPDTTAYKEWLGVVGSMMVVVAICAVLFAGGIILM* |
| Ga0137379_107562082 | 3300012209 | Vadose Zone Soil | MRDNFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILI* |
| Ga0137378_107837651 | 3300012210 | Vadose Zone Soil | MGDAMRDTLDKRIPDTAPYKEWLGIVGSMMAAVAICAVL |
| Ga0137370_102086631 | 3300012285 | Vadose Zone Soil | MGGAMRDTLDKRIPDTAPYKEWRGVVGSMMAAVAVCAVLFSAGIPT* |
| Ga0137372_104436782 | 3300012350 | Vadose Zone Soil | MGDAMRDTLDKRIPDTAPYKEWLGIVGSMMAAVAICAVLFSAGILT* |
| Ga0137371_106390521 | 3300012356 | Vadose Zone Soil | SMGGAMRDTLDKRIPDTAPYKEWLGVVGSMMAAVAVCAVLFSAGILT* |
| Ga0137371_111455681 | 3300012356 | Vadose Zone Soil | MRETLESGIPDTAPYKEWLGIVGTMALAVLICAVLFAGGVPT* |
| Ga0137385_110911171 | 3300012359 | Vadose Zone Soil | MGGAMRETLESGIAVTAPYKEWLGLVASMMVPVLICALLFAGGIPT* |
| Ga0137360_113530491 | 3300012361 | Vadose Zone Soil | MRDNFASGIPDTAPYKEWLGVVGSMMATVAICAVLYAGGILT* |
| Ga0137360_116183811 | 3300012361 | Vadose Zone Soil | RTGGAMREILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0137358_101089662 | 3300012582 | Vadose Zone Soil | MRNRLDSRIPDTTPYEEWLGIVGSMMAALVICAVLFAGGLLT* |
| Ga0126375_105220063 | 3300012948 | Tropical Forest Soil | VHRRGGAMREIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0126375_105416881 | 3300012948 | Tropical Forest Soil | MRDRFDSRIPDTAPYKEWLGIVGTMLAAVVICAFLFGGSVLT* |
| Ga0126375_115722331 | 3300012948 | Tropical Forest Soil | MRDILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLS* |
| Ga0164298_103766911 | 3300012955 | Soil | MRNRLDSRVPVTAPYEEWLGIVGSMMAALVICAVLFAGGLLT* |
| Ga0164303_105487022 | 3300012957 | Soil | LDSRIPDTAPYKEWLGIVGSMLAAVAICGALFAGGFFT* |
| Ga0164299_112353741 | 3300012958 | Soil | MRDIFESDIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT* |
| Ga0126369_103589452 | 3300012971 | Tropical Forest Soil | MRKRLDSRIPDTAPYKEWLGIVGSMMAAVAICAVLFAGGLLT* |
| Ga0126369_122954762 | 3300012971 | Tropical Forest Soil | MREILESEIPDTAPYKEWLGVVGSMLVAVLICAVLFVG |
| Ga0163162_115303492 | 3300013306 | Switchgrass Rhizosphere | MRNRLDSRVPDTTPYKEWLGIVGSMMAALVICAVLFAGGLLT* |
| Ga0157372_134644151 | 3300013307 | Corn Rhizosphere | SRIPDTAPYKEWLGIVGSMLAAVAICGALFAGGFFT* |
| Ga0120188_10315542 | 3300013760 | Terrestrial | STGDAMRDTLDKGIPDTAPYKEWLGIVGSMMAAVAICAVLFSAGFLT* |
| Ga0134078_102737901 | 3300014157 | Grasslands Soil | VTRDSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILM* |
| Ga0134078_103143591 | 3300014157 | Grasslands Soil | MRDIFENEIPDTAPYKEWLGVVGSMMAAVAVCAVLFSAGILT* |
| Ga0132256_1004418672 | 3300015372 | Arabidopsis Rhizosphere | MGDVMRNRLDSRIPDTAPYKEWLGIVGSMLAAVAICGALFAGGFF |
| Ga0182036_104663911 | 3300016270 | Soil | LEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0182036_109149202 | 3300016270 | Soil | RGGAMRDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGVLT |
| Ga0182041_100391132 | 3300016294 | Soil | MRDIFENEIPDTAPYKEWLGTVGSMLVAVLICAVLFAGGVLT |
| Ga0182041_117634761 | 3300016294 | Soil | MRETFDRGIPDTAPYTEWLGVVGSILVAALICAVLFAGGVPS |
| Ga0182035_103151621 | 3300016341 | Soil | DRRRGGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0182039_122147013 | 3300016422 | Soil | LGGGIPDTAPYKEWLGLVGTMAVAVLICAVLFAGAVPT |
| Ga0134083_104836292 | 3300017659 | Grasslands Soil | MRDDFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILI |
| Ga0184612_100377532 | 3300018078 | Groundwater Sediment | MRESLESEIPDTAPYKEWLAIVGSIAVAVLIFVVLFSNGVVVT |
| Ga0066655_101190461 | 3300018431 | Grasslands Soil | MRDIFENEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0066667_100827732 | 3300018433 | Grasslands Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICVVLFAGGVLT |
| Ga0066667_106134951 | 3300018433 | Grasslands Soil | MRDTLQRGVPDTAPYKEWLGIVGSMVAAVAICAVLFAGGFLT |
| Ga0066667_113373911 | 3300018433 | Grasslands Soil | SRLPDTAPYKEWLGIVGSMLAAVAICGVLFAGGLLT |
| Ga0066662_108937361 | 3300018468 | Grasslands Soil | MRDSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILI |
| Ga0066662_115895682 | 3300018468 | Grasslands Soil | MRDHFDSGIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGILT |
| Ga0066669_100602881 | 3300018482 | Grasslands Soil | MRDSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILM |
| Ga0066669_103989882 | 3300018482 | Grasslands Soil | MRDIFENEIPDTAPYKEWLGIVGSMLVAVLICVVLFAGGVLT |
| Ga0066669_106633562 | 3300018482 | Grasslands Soil | MRNRLDSRLPDTAPYKEWLGIVGSMLAAVAICGVLFAGGLLT |
| Ga0066669_118583231 | 3300018482 | Grasslands Soil | MRETLESGIPDTAPYKEWLGIVGTMALAVLICAVLFAGAVPT |
| Ga0137408_10649762 | 3300019789 | Vadose Zone Soil | MGGAMRDTLDKRIPDTAPYKEWLGVVGSMMAAVAVCAVLFSAGILT |
| Ga0210403_105043271 | 3300020580 | Soil | MRNRLDSRVPDTAPYEEWLGIVGSMMAALVICAVLFAGGLLT |
| Ga0210406_106775111 | 3300021168 | Soil | MRDIFESDIPDTAPYKEWLGIVGSMLVAVLICAVLF |
| Ga0210408_108679352 | 3300021178 | Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAACSRAAS |
| Ga0210408_112661681 | 3300021178 | Soil | ENGIPDTAPYKEWLGIVGTMAVAVLICAVLFASSVPT |
| Ga0213872_100193773 | 3300021361 | Rhizosphere | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFGGGVLT |
| Ga0210387_107512332 | 3300021405 | Soil | MRDIFESDIPDTAPYKEWLGIVGSMLVAVLICAACSRAA |
| Ga0210384_102690182 | 3300021432 | Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVIICAVLFAGGVLT |
| Ga0126371_105459721 | 3300021560 | Tropical Forest Soil | SEIPDTAPYKEWLGIVGSMLVAVIICAVLFAGGILT |
| Ga0126371_112083522 | 3300021560 | Tropical Forest Soil | MRDRFDSRIPDTAPYKEWLSIVGTMLAAVVICAFLFGGSVLT |
| Ga0126371_113205472 | 3300021560 | Tropical Forest Soil | MRDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGVLT |
| Ga0126371_135969672 | 3300021560 | Tropical Forest Soil | MRDIFEKEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0207692_102124362 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRLDSRIPDTAPYKEWLGIVGSMMAALVICAVLFAGGLLT |
| Ga0207692_105320592 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SRIPDTAPYKEWLGIVGSMLAAVAICGALFAGGFFT |
| Ga0207685_102032272 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SRIPDTSPYKAWLGIVGSMMAAIAICAVLFAGGLLT |
| Ga0207665_111475711 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRLDSRVPDTTPYKEWLGIVGSMMAALVICAVLFAGGLLT |
| Ga0207675_1025926651 | 3300026118 | Switchgrass Rhizosphere | MRNRLDSRIPDTAPYKEWLGAVAICGALFAGGFFT |
| Ga0209240_10056436 | 3300026304 | Grasslands Soil | MRDIFESKIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0209474_100493431 | 3300026550 | Soil | VTRDSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILM |
| Ga0209577_102718201 | 3300026552 | Soil | TNNGGEVMRDSFENQIPDTTAYKEWLGVVGSMMAAVAICAVLFAGGIILM |
| Ga0209466_10057632 | 3300027646 | Tropical Forest Soil | MREILESEIPDTAPYKEWLGIAGSMVVAVLICGVLLAGGVPT |
| Ga0209382_101924523 | 3300027909 | Populus Rhizosphere | MGDAMRDTLDKRIPDTAPYKEWLGIVGSMMAAVLICAVLFSAGVRT |
| Ga0307319_103215301 | 3300028722 | Soil | MRNRLDSRIPDTSPYKEWLGIVGSMMAALVICAVLFAGGLLT |
| Ga0307278_101231662 | 3300028878 | Soil | MRETLESGLPDTAPYKEWLGIVGSMVVAVLICAVLFAGGVLT |
| Ga0307277_100001193 | 3300028881 | Soil | MRNRLDSRIPDTSPYKEWLGIVGSMMAAIAICAVLFAGGLLT |
| Ga0222749_106791581 | 3300029636 | Soil | MRNRLDSRVPDTAPYEEWLGIVGSMMAALVICAVLFAGG |
| Ga0318516_102957713 | 3300031543 | Soil | RDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318534_100536134 | 3300031544 | Soil | MRDIFESEIPDTAPYKEWLCIVGSMLVAVLICAVLFAGGVLT |
| Ga0318541_103390022 | 3300031545 | Soil | MRETFDRGIPDTAPYTDWLGVVGSILVAALICAVLFAGGVPS |
| Ga0318538_103321581 | 3300031546 | Soil | RRRHNDRRRGGAMRDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGVLT |
| Ga0318571_101742402 | 3300031549 | Soil | MRDIFESEIPDTAPYKEWLSIVGSMLVAVLICAVLFAGGVLT |
| Ga0318555_103674471 | 3300031640 | Soil | GGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318555_104987401 | 3300031640 | Soil | IFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318542_101228581 | 3300031668 | Soil | NDRRRGGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318542_105925832 | 3300031668 | Soil | MRETLEGGIPDTAPYKEWLGLVGTMAVAVLICAILFAAGVPA |
| Ga0318560_103853911 | 3300031682 | Soil | MRDRFDSRIPDTAPYKEWLGIVGTMLAAVVICAFL |
| Ga0306917_105977621 | 3300031719 | Soil | RGGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0306917_107734482 | 3300031719 | Soil | MRDIFESEIPDTAPYKKWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318500_100647562 | 3300031724 | Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLF |
| Ga0318501_106755122 | 3300031736 | Soil | MRETLEGGIPDTAPYKEWLGFVGTMAVAVLICAVLFAAGVPI |
| Ga0306918_101482304 | 3300031744 | Soil | AMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318535_104053902 | 3300031764 | Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFA |
| Ga0318547_100361135 | 3300031781 | Soil | MRDIFESEIPDTAPYKEWLGIVGSMLVAVLIWAVLFAGGVLT |
| Ga0318547_100595114 | 3300031781 | Soil | TDHRTGGAMRDILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318552_100475851 | 3300031782 | Soil | MRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLA |
| Ga0318552_106421982 | 3300031782 | Soil | GAMRDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGGLT |
| Ga0318548_103329081 | 3300031793 | Soil | RRRHNDHRRGGAMRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318503_101092181 | 3300031794 | Soil | GAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318550_101320481 | 3300031797 | Soil | RRGGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318550_104449072 | 3300031797 | Soil | HNDRRRGGAMRDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGGLT |
| Ga0318497_106050101 | 3300031805 | Soil | AMRKTLEGGIPDTAPYKEWLGLVATMAVAVLICAVLFAAGVPV |
| Ga0307473_102837471 | 3300031820 | Hardwood Forest Soil | NRLDSRIPDTSPYKEWLGIVGSMMAAIAICAVLFAGGLLT |
| Ga0318564_101222572 | 3300031831 | Soil | ITVHRTGGAMRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0310917_101472141 | 3300031833 | Soil | AMRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0310917_102256273 | 3300031833 | Soil | RRRGGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318517_103406332 | 3300031835 | Soil | MRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVL |
| Ga0306919_105581362 | 3300031879 | Soil | MVNEGVAMRKTLKDGIPDTAPYKEWLGFVGTMVVAVLICAVLFAGAVPT |
| Ga0306919_107352752 | 3300031879 | Soil | MRETLEGGIPDTAPYKEWLGFVGTMAVAVLICAVLFAAGVPV |
| Ga0318522_100308774 | 3300031894 | Soil | FESEIPDTAPYKEWLCIVGSMLVAVLICAVLFAGGVLT |
| Ga0318551_100458835 | 3300031896 | Soil | FESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318551_101023244 | 3300031896 | Soil | RDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGVLT |
| Ga0318551_106426622 | 3300031896 | Soil | NDHRRGGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0306923_101938512 | 3300031910 | Soil | MRKTLEGGIPDTAPYKEWLGLVATMAVAVLICAVLFAAGVPV |
| Ga0310912_110684041 | 3300031941 | Soil | TGGAMRDILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0310916_101738501 | 3300031942 | Soil | EIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGVLT |
| Ga0318530_100999723 | 3300031959 | Soil | RRGGAMRDIFESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318531_104008752 | 3300031981 | Soil | MVNEGVAMRKTLKDGIPDTAPYKEWLGFVGTMVVAVLICAVLF |
| Ga0318569_100866791 | 3300032010 | Soil | MRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLF |
| Ga0318569_104557891 | 3300032010 | Soil | RHNDHRRGGAMRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318556_100923791 | 3300032043 | Soil | DSRIPDTAPYKEWLGIVGTMLAAVVICAFLFGGGVLT |
| Ga0318570_103453042 | 3300032054 | Soil | GAMRDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGVLT |
| Ga0318533_107846652 | 3300032059 | Soil | HQTQDKRSRMGGVAMRKTLEGGIPDTAPYKEWLGLVATMAVAVLICAVLFAAGVPV |
| Ga0318533_110301691 | 3300032059 | Soil | MRDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGG |
| Ga0318505_100116141 | 3300032060 | Soil | MRDILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAG |
| Ga0318505_102389112 | 3300032060 | Soil | MRDSLEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318514_105087911 | 3300032066 | Soil | MVNEGVAMRKTLKDGIPDTAPYKEWLGFVGTMVVAVLICAVLFAG |
| Ga0318514_106576932 | 3300032066 | Soil | MRDILEREIPDTAPYKEWLGIVGSMLVAVLICAVLFAG |
| Ga0318518_100415635 | 3300032090 | Soil | ILESEIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0318577_100597394 | 3300032091 | Soil | EIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0307470_119287381 | 3300032174 | Hardwood Forest Soil | TTAECQMGDAMRNRLDSRIPDTSPYKEWLGIVGSMMAAIAICAVLFAGGLLT |
| Ga0307471_1038685221 | 3300032180 | Hardwood Forest Soil | EIPDTAPYKEWLGIVGSMLVAVIICAVLFAGGVLT |
| Ga0307472_1001688193 | 3300032205 | Hardwood Forest Soil | MRDIFESDIPDTAPYKEWLGIVGSMLVAVLICAVLFAGGVLT |
| Ga0307472_1026152931 | 3300032205 | Hardwood Forest Soil | AFDYEIPDTTACKEWLGIVGSMVAAVAICAFLFGGSIFT |
| Ga0306920_1011438131 | 3300032261 | Soil | MRETLESEIPDTAPYKEWLGLMGTMALAVLICAVLFAGAVPT |
| Ga0310914_107571363 | 3300033289 | Soil | ILEREIPDTAPYKEWLGIVGTMAVAVLICAVLFAGGVLT |
| Ga0318519_100186146 | 3300033290 | Soil | MRDILEREIPDTAPYKEWLGIVGSMAVAVLICAVLFAGGGLT |
| ⦗Top⦘ |