


| Basic Information | |
|---|---|
| Family ID | F012237 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 282 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 275 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 36.79 % |
| % of genes near scaffold ends (potentially truncated) | 62.77 % |
| % of genes from short scaffolds (< 2000 bps) | 68.44 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.674 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (44.326 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.241 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.801 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.40% β-sheet: 0.00% Coil/Unstructured: 74.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 275 Family Scaffolds |
|---|---|---|
| PF14534 | DUF4440 | 2.91 |
| PF00903 | Glyoxalase | 1.82 |
| PF15580 | Imm53 | 1.82 |
| PF10077 | DUF2314 | 1.45 |
| PF03544 | TonB_C | 1.09 |
| PF04229 | GrpB | 1.09 |
| PF01872 | RibD_C | 1.09 |
| PF08734 | GYD | 1.09 |
| PF13474 | SnoaL_3 | 0.73 |
| PF12680 | SnoaL_2 | 0.73 |
| PF15631 | Imm-NTF2-2 | 0.73 |
| PF13476 | AAA_23 | 0.73 |
| PF13620 | CarboxypepD_reg | 0.73 |
| PF09346 | SMI1_KNR4 | 0.73 |
| PF04072 | LCM | 0.73 |
| PF09720 | Unstab_antitox | 0.73 |
| PF10387 | DUF2442 | 0.73 |
| PF13711 | DUF4160 | 0.73 |
| PF07927 | HicA_toxin | 0.73 |
| PF13924 | Lipocalin_5 | 0.73 |
| PF15589 | Imm21 | 0.73 |
| PF11066 | DUF2867 | 0.36 |
| PF04365 | BrnT_toxin | 0.36 |
| PF06877 | RraB | 0.36 |
| PF14119 | DUF4288 | 0.36 |
| PF11008 | DUF2846 | 0.36 |
| PF05117 | DUF695 | 0.36 |
| PF04993 | TfoX_N | 0.36 |
| PF14526 | Cass2 | 0.36 |
| PF05016 | ParE_toxin | 0.36 |
| PF12158 | DUF3592 | 0.36 |
| PF04343 | DUF488 | 0.36 |
| PF07859 | Abhydrolase_3 | 0.36 |
| PF13472 | Lipase_GDSL_2 | 0.36 |
| PF13011 | LZ_Tnp_IS481 | 0.36 |
| PF07681 | DoxX | 0.36 |
| PF12796 | Ank_2 | 0.36 |
| PF13207 | AAA_17 | 0.36 |
| PF08818 | DUF1801 | 0.36 |
| PF13826 | DUF4188 | 0.36 |
| PF13333 | rve_2 | 0.36 |
| PF13565 | HTH_32 | 0.36 |
| PF00589 | Phage_integrase | 0.36 |
| PF06271 | RDD | 0.36 |
| PF05694 | SBP56 | 0.36 |
| PF14300 | DUF4375 | 0.36 |
| PF07110 | EthD | 0.36 |
| PF00005 | ABC_tran | 0.36 |
| PF11622 | DUF3251 | 0.36 |
| PF00144 | Beta-lactamase | 0.36 |
| PF06348 | DUF1059 | 0.36 |
| PF13551 | HTH_29 | 0.36 |
| PF13414 | TPR_11 | 0.36 |
| PF00248 | Aldo_ket_red | 0.36 |
| PF09413 | DUF2007 | 0.36 |
| PF13787 | HXXEE | 0.36 |
| PF09932 | DUF2164 | 0.36 |
| PF05076 | SUFU | 0.36 |
| PF13455 | MUG113 | 0.36 |
| PF14499 | DUF4437 | 0.36 |
| PF08592 | Anthrone_oxy | 0.36 |
| PF12681 | Glyoxalase_2 | 0.36 |
| PF10012 | DUF2255 | 0.36 |
| PF13936 | HTH_38 | 0.36 |
| PF13683 | rve_3 | 0.36 |
| PF08974 | DUF1877 | 0.36 |
| PF06197 | DUF998 | 0.36 |
| PF00069 | Pkinase | 0.36 |
| PF07883 | Cupin_2 | 0.36 |
| PF08240 | ADH_N | 0.36 |
| PF04402 | SIMPL | 0.36 |
| PF13184 | KH_5 | 0.36 |
| PF06283 | ThuA | 0.36 |
| PF13365 | Trypsin_2 | 0.36 |
| PF01844 | HNH | 0.36 |
| PF00717 | Peptidase_S24 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 275 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.45 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.09 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.09 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.09 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 1.09 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.09 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.73 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.73 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.36 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.36 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.36 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.36 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.36 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.36 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.36 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.36 |
| COG3076 | Regulator of RNase E activity RraB | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.36 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.36 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.36 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.36 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.36 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.36 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.38 % |
| Unclassified | root | N/A | 43.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002911|JGI25390J43892_10122962 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005176|Ga0066679_10657176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4 | 682 | Open in IMG/M |
| 3300005180|Ga0066685_10689225 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber | 701 | Open in IMG/M |
| 3300005446|Ga0066686_10296281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300005447|Ga0066689_10353561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300005555|Ga0066692_10379869 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300005557|Ga0066704_10121362 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300005559|Ga0066700_10042572 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
| 3300005559|Ga0066700_10124749 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300005561|Ga0066699_10189590 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1426 | Open in IMG/M |
| 3300005568|Ga0066703_10505817 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005569|Ga0066705_10004038 | All Organisms → cellular organisms → Bacteria | 6125 | Open in IMG/M |
| 3300005569|Ga0066705_10008148 | All Organisms → cellular organisms → Bacteria | 4802 | Open in IMG/M |
| 3300005575|Ga0066702_10527754 | Not Available | 716 | Open in IMG/M |
| 3300005575|Ga0066702_10549107 | Not Available | 698 | Open in IMG/M |
| 3300005586|Ga0066691_10190807 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300005586|Ga0066691_10195644 | Not Available | 1176 | Open in IMG/M |
| 3300005598|Ga0066706_10076923 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
| 3300005833|Ga0074472_10832079 | Not Available | 539 | Open in IMG/M |
| 3300005875|Ga0075293_1079727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 500 | Open in IMG/M |
| 3300005876|Ga0075300_1074015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 517 | Open in IMG/M |
| 3300005886|Ga0075286_1012971 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300006032|Ga0066696_11114059 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006046|Ga0066652_100816071 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300006049|Ga0075417_10027313 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
| 3300006049|Ga0075417_10107768 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300006049|Ga0075417_10221995 | Not Available | 900 | Open in IMG/M |
| 3300006049|Ga0075417_10228890 | Not Available | 887 | Open in IMG/M |
| 3300006049|Ga0075417_10228890 | Not Available | 887 | Open in IMG/M |
| 3300006049|Ga0075417_10386140 | Not Available | 691 | Open in IMG/M |
| 3300006049|Ga0075417_10540025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2 | 589 | Open in IMG/M |
| 3300006194|Ga0075427_10104803 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006577|Ga0074050_11288055 | Not Available | 584 | Open in IMG/M |
| 3300006794|Ga0066658_10430762 | Not Available | 718 | Open in IMG/M |
| 3300006796|Ga0066665_10057744 | All Organisms → cellular organisms → Bacteria | 2702 | Open in IMG/M |
| 3300006796|Ga0066665_10134766 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300006797|Ga0066659_11082113 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006797|Ga0066659_11185294 | Not Available | 638 | Open in IMG/M |
| 3300006800|Ga0066660_10279038 | Not Available | 1323 | Open in IMG/M |
| 3300006800|Ga0066660_10413309 | Not Available | 1117 | Open in IMG/M |
| 3300006800|Ga0066660_10452636 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300006844|Ga0075428_100173156 | All Organisms → cellular organisms → Bacteria | 2339 | Open in IMG/M |
| 3300006844|Ga0075428_100261748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1862 | Open in IMG/M |
| 3300006844|Ga0075428_100298734 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica | 1731 | Open in IMG/M |
| 3300006844|Ga0075428_100613611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 1161 | Open in IMG/M |
| 3300006844|Ga0075428_100920790 | Not Available | 927 | Open in IMG/M |
| 3300006844|Ga0075428_101022340 | Not Available | 874 | Open in IMG/M |
| 3300006844|Ga0075428_102287349 | Not Available | 556 | Open in IMG/M |
| 3300006844|Ga0075428_102420983 | Not Available | 539 | Open in IMG/M |
| 3300006845|Ga0075421_100046642 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5491 | Open in IMG/M |
| 3300006845|Ga0075421_100094669 | All Organisms → cellular organisms → Bacteria | 3761 | Open in IMG/M |
| 3300006845|Ga0075421_100094669 | All Organisms → cellular organisms → Bacteria | 3761 | Open in IMG/M |
| 3300006845|Ga0075421_100163152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2780 | Open in IMG/M |
| 3300006845|Ga0075421_100177218 | Not Available | 2652 | Open in IMG/M |
| 3300006845|Ga0075421_100201349 | All Organisms → cellular organisms → Bacteria → FCB group | 2464 | Open in IMG/M |
| 3300006845|Ga0075421_100670324 | Not Available | 1209 | Open in IMG/M |
| 3300006845|Ga0075421_100729368 | Not Available | 1149 | Open in IMG/M |
| 3300006845|Ga0075421_101071684 | Not Available | 907 | Open in IMG/M |
| 3300006845|Ga0075421_101244374 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300006846|Ga0075430_100801788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
| 3300006847|Ga0075431_100051413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4249 | Open in IMG/M |
| 3300006847|Ga0075431_100081948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3331 | Open in IMG/M |
| 3300006847|Ga0075431_100129646 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
| 3300006847|Ga0075431_100190083 | Not Available | 2104 | Open in IMG/M |
| 3300006847|Ga0075431_100929302 | Not Available | 839 | Open in IMG/M |
| 3300006847|Ga0075431_101266834 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300006847|Ga0075431_101878623 | Not Available | 555 | Open in IMG/M |
| 3300006852|Ga0075433_10085998 | All Organisms → cellular organisms → Bacteria | 2776 | Open in IMG/M |
| 3300006852|Ga0075433_10116883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260 | 2366 | Open in IMG/M |
| 3300006852|Ga0075433_10160358 | Not Available | 2001 | Open in IMG/M |
| 3300006852|Ga0075433_10188693 | Not Available | 1834 | Open in IMG/M |
| 3300006852|Ga0075433_10365809 | Not Available | 1274 | Open in IMG/M |
| 3300006852|Ga0075433_10449190 | Not Available | 1136 | Open in IMG/M |
| 3300006852|Ga0075433_10483710 | Not Available | 1090 | Open in IMG/M |
| 3300006852|Ga0075433_11508734 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006852|Ga0075433_11915523 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006854|Ga0075425_100367586 | Not Available | 1656 | Open in IMG/M |
| 3300006871|Ga0075434_100023960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5959 | Open in IMG/M |
| 3300006871|Ga0075434_100050888 | Not Available | 4115 | Open in IMG/M |
| 3300006871|Ga0075434_100062617 | All Organisms → cellular organisms → Bacteria | 3703 | Open in IMG/M |
| 3300006871|Ga0075434_100090536 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3060 | Open in IMG/M |
| 3300006871|Ga0075434_100113995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2716 | Open in IMG/M |
| 3300006871|Ga0075434_100148581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 2363 | Open in IMG/M |
| 3300006871|Ga0075434_100181770 | Not Available | 2123 | Open in IMG/M |
| 3300006871|Ga0075434_100200488 | Not Available | 2015 | Open in IMG/M |
| 3300006871|Ga0075434_100240006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1832 | Open in IMG/M |
| 3300006871|Ga0075434_100481270 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300006871|Ga0075434_101241947 | Not Available | 757 | Open in IMG/M |
| 3300006880|Ga0075429_100051664 | Not Available | 3576 | Open in IMG/M |
| 3300006880|Ga0075429_100051664 | Not Available | 3576 | Open in IMG/M |
| 3300006880|Ga0075429_100078980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4 | 2868 | Open in IMG/M |
| 3300006880|Ga0075429_100107861 | Not Available | 2433 | Open in IMG/M |
| 3300006880|Ga0075429_100133657 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae | 2170 | Open in IMG/M |
| 3300006880|Ga0075429_100395835 | Not Available | 1209 | Open in IMG/M |
| 3300006880|Ga0075429_100592070 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 972 | Open in IMG/M |
| 3300006880|Ga0075429_100717851 | Not Available | 875 | Open in IMG/M |
| 3300006880|Ga0075429_101202323 | Not Available | 662 | Open in IMG/M |
| 3300006904|Ga0075424_100053346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4225 | Open in IMG/M |
| 3300006904|Ga0075424_100053346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4225 | Open in IMG/M |
| 3300006904|Ga0075424_102511631 | Not Available | 539 | Open in IMG/M |
| 3300006969|Ga0075419_10099154 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300006969|Ga0075419_10396688 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300006969|Ga0075419_10588820 | Not Available | 780 | Open in IMG/M |
| 3300006969|Ga0075419_11010500 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300007255|Ga0099791_10570397 | Not Available | 552 | Open in IMG/M |
| 3300009012|Ga0066710_100033270 | All Organisms → cellular organisms → Bacteria | 6055 | Open in IMG/M |
| 3300009012|Ga0066710_100462698 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1904 | Open in IMG/M |
| 3300009012|Ga0066710_101028265 | Not Available | 1272 | Open in IMG/M |
| 3300009090|Ga0099827_10414821 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300009100|Ga0075418_10745125 | Not Available | 1057 | Open in IMG/M |
| 3300009100|Ga0075418_11485625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1 | 735 | Open in IMG/M |
| 3300009100|Ga0075418_12472100 | Not Available | 567 | Open in IMG/M |
| 3300009137|Ga0066709_100583086 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300009137|Ga0066709_102982133 | Not Available | 622 | Open in IMG/M |
| 3300009147|Ga0114129_10078153 | All Organisms → cellular organisms → Bacteria | 4603 | Open in IMG/M |
| 3300009147|Ga0114129_10143751 | All Organisms → cellular organisms → Bacteria | 3268 | Open in IMG/M |
| 3300009147|Ga0114129_10154594 | All Organisms → cellular organisms → Bacteria | 3138 | Open in IMG/M |
| 3300009147|Ga0114129_10172029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2952 | Open in IMG/M |
| 3300009147|Ga0114129_10199878 | Not Available | 2708 | Open in IMG/M |
| 3300009147|Ga0114129_10274392 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300009147|Ga0114129_10287012 | Not Available | 2197 | Open in IMG/M |
| 3300009147|Ga0114129_10298283 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
| 3300009147|Ga0114129_10374651 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300009147|Ga0114129_10434076 | Not Available | 1725 | Open in IMG/M |
| 3300009147|Ga0114129_10515699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1559 | Open in IMG/M |
| 3300009147|Ga0114129_10554029 | Not Available | 1495 | Open in IMG/M |
| 3300009147|Ga0114129_10633661 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300009147|Ga0114129_10676228 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300009147|Ga0114129_10677983 | Not Available | 1327 | Open in IMG/M |
| 3300009147|Ga0114129_10948057 | Not Available | 1087 | Open in IMG/M |
| 3300009147|Ga0114129_11031866 | Not Available | 1034 | Open in IMG/M |
| 3300009147|Ga0114129_11210275 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 940 | Open in IMG/M |
| 3300009147|Ga0114129_11234543 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300009147|Ga0114129_11716202 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300009147|Ga0114129_11791493 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300009147|Ga0114129_12152490 | Not Available | 672 | Open in IMG/M |
| 3300009147|Ga0114129_12153925 | Not Available | 672 | Open in IMG/M |
| 3300009147|Ga0114129_12883113 | Not Available | 569 | Open in IMG/M |
| 3300009147|Ga0114129_12921796 | Not Available | 564 | Open in IMG/M |
| 3300009147|Ga0114129_12934866 | Not Available | 563 | Open in IMG/M |
| 3300009147|Ga0114129_13018254 | Not Available | 553 | Open in IMG/M |
| 3300009162|Ga0075423_10035053 | All Organisms → cellular organisms → Bacteria | 5106 | Open in IMG/M |
| 3300009162|Ga0075423_10055431 | Not Available | 4091 | Open in IMG/M |
| 3300009162|Ga0075423_10094819 | All Organisms → cellular organisms → Bacteria | 3119 | Open in IMG/M |
| 3300009162|Ga0075423_10367162 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300009162|Ga0075423_12707317 | Not Available | 543 | Open in IMG/M |
| 3300010046|Ga0126384_12343845 | Not Available | 516 | Open in IMG/M |
| 3300010336|Ga0134071_10124830 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300010362|Ga0126377_11208772 | Not Available | 826 | Open in IMG/M |
| 3300010403|Ga0134123_11631852 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300011271|Ga0137393_11739481 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300011444|Ga0137463_1115418 | Not Available | 1010 | Open in IMG/M |
| 3300012199|Ga0137383_10126010 | Not Available | 1869 | Open in IMG/M |
| 3300012200|Ga0137382_10097321 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
| 3300012201|Ga0137365_10232612 | Not Available | 1373 | Open in IMG/M |
| 3300012203|Ga0137399_10554683 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 965 | Open in IMG/M |
| 3300012204|Ga0137374_10012363 | All Organisms → cellular organisms → Bacteria | 9948 | Open in IMG/M |
| 3300012204|Ga0137374_10109657 | Not Available | 2574 | Open in IMG/M |
| 3300012204|Ga0137374_10303302 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5 | 1309 | Open in IMG/M |
| 3300012204|Ga0137374_10303302 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5 | 1309 | Open in IMG/M |
| 3300012205|Ga0137362_10355339 | Not Available | 1269 | Open in IMG/M |
| 3300012206|Ga0137380_10031472 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4891 | Open in IMG/M |
| 3300012207|Ga0137381_10085995 | All Organisms → cellular organisms → Bacteria | 2648 | Open in IMG/M |
| 3300012207|Ga0137381_10101702 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300012207|Ga0137381_10721780 | Not Available | 866 | Open in IMG/M |
| 3300012210|Ga0137378_10488692 | Not Available | 1137 | Open in IMG/M |
| 3300012225|Ga0137434_1025231 | Not Available | 806 | Open in IMG/M |
| 3300012349|Ga0137387_10149780 | Not Available | 1660 | Open in IMG/M |
| 3300012350|Ga0137372_10398996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1042 | Open in IMG/M |
| 3300012353|Ga0137367_10094788 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5 | 2202 | Open in IMG/M |
| 3300012353|Ga0137367_11215450 | Not Available | 503 | Open in IMG/M |
| 3300012355|Ga0137369_10678332 | Not Available | 710 | Open in IMG/M |
| 3300012360|Ga0137375_10355887 | Not Available | 1297 | Open in IMG/M |
| 3300012363|Ga0137390_10114377 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2671 | Open in IMG/M |
| 3300012532|Ga0137373_10064348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3342 | Open in IMG/M |
| 3300012532|Ga0137373_10223337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1536 | Open in IMG/M |
| 3300012685|Ga0137397_11088949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300012923|Ga0137359_11651414 | Not Available | 528 | Open in IMG/M |
| 3300012929|Ga0137404_12010731 | Not Available | 539 | Open in IMG/M |
| 3300012931|Ga0153915_10254020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1949 | Open in IMG/M |
| 3300012931|Ga0153915_12811837 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012931|Ga0153915_13104927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300012972|Ga0134077_10378770 | Not Available | 608 | Open in IMG/M |
| 3300014873|Ga0180066_1006131 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni | 1923 | Open in IMG/M |
| 3300015241|Ga0137418_10039775 | All Organisms → cellular organisms → Bacteria | 4337 | Open in IMG/M |
| 3300017656|Ga0134112_10281283 | Not Available | 665 | Open in IMG/M |
| 3300017659|Ga0134083_10015944 | All Organisms → cellular organisms → Bacteria | 2595 | Open in IMG/M |
| 3300018053|Ga0184626_10288883 | Not Available | 682 | Open in IMG/M |
| 3300018068|Ga0184636_1211325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300018079|Ga0184627_10392996 | Not Available | 723 | Open in IMG/M |
| 3300018079|Ga0184627_10586564 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 562 | Open in IMG/M |
| 3300018082|Ga0184639_10484789 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300018084|Ga0184629_10607685 | Not Available | 557 | Open in IMG/M |
| 3300018084|Ga0184629_10705192 | Not Available | 508 | Open in IMG/M |
| 3300018431|Ga0066655_10011455 | All Organisms → cellular organisms → Bacteria | 3861 | Open in IMG/M |
| 3300018433|Ga0066667_11386532 | Not Available | 617 | Open in IMG/M |
| 3300018468|Ga0066662_10070444 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
| 3300018482|Ga0066669_10222788 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1466 | Open in IMG/M |
| 3300019360|Ga0187894_10501355 | Not Available | 526 | Open in IMG/M |
| 3300019458|Ga0187892_10245878 | Not Available | 922 | Open in IMG/M |
| 3300019458|Ga0187892_10329187 | Not Available | 750 | Open in IMG/M |
| 3300019458|Ga0187892_10390793 | Not Available | 665 | Open in IMG/M |
| 3300020022|Ga0193733_1067029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1009 | Open in IMG/M |
| 3300021081|Ga0210379_10259813 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 755 | Open in IMG/M |
| 3300025922|Ga0207646_11246572 | Not Available | 651 | Open in IMG/M |
| 3300026295|Ga0209234_1014562 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
| 3300026309|Ga0209055_1002512 | All Organisms → cellular organisms → Bacteria | 11557 | Open in IMG/M |
| 3300026309|Ga0209055_1025051 | All Organisms → cellular organisms → Bacteria | 2805 | Open in IMG/M |
| 3300026312|Ga0209153_1085481 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300026318|Ga0209471_1004019 | All Organisms → cellular organisms → Bacteria | 8196 | Open in IMG/M |
| 3300026318|Ga0209471_1263810 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300026328|Ga0209802_1134035 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1070 | Open in IMG/M |
| 3300026333|Ga0209158_1282583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300026343|Ga0209159_1135487 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300026532|Ga0209160_1220160 | Not Available | 669 | Open in IMG/M |
| 3300026538|Ga0209056_10008251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 10682 | Open in IMG/M |
| 3300026550|Ga0209474_10079518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2256 | Open in IMG/M |
| 3300026552|Ga0209577_10252122 | Not Available | 1331 | Open in IMG/M |
| 3300027187|Ga0209869_1013187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 909 | Open in IMG/M |
| 3300027846|Ga0209180_10013312 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4286 | Open in IMG/M |
| 3300027873|Ga0209814_10024261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2477 | Open in IMG/M |
| 3300027873|Ga0209814_10031317 | Not Available | 2190 | Open in IMG/M |
| 3300027873|Ga0209814_10032980 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2137 | Open in IMG/M |
| 3300027873|Ga0209814_10122695 | Not Available | 1108 | Open in IMG/M |
| 3300027873|Ga0209814_10189769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 887 | Open in IMG/M |
| 3300027873|Ga0209814_10445545 | Not Available | 571 | Open in IMG/M |
| 3300027875|Ga0209283_10633953 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300027880|Ga0209481_10075137 | Not Available | 1603 | Open in IMG/M |
| 3300027880|Ga0209481_10111433 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300027880|Ga0209481_10379945 | Not Available | 723 | Open in IMG/M |
| 3300027880|Ga0209481_10442261 | Not Available | 669 | Open in IMG/M |
| 3300027880|Ga0209481_10688195 | Not Available | 531 | Open in IMG/M |
| 3300027882|Ga0209590_10221241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1202 | Open in IMG/M |
| 3300027903|Ga0209488_10452336 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300027909|Ga0209382_10019267 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 8302 | Open in IMG/M |
| 3300027909|Ga0209382_10085229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3718 | Open in IMG/M |
| 3300027909|Ga0209382_10111940 | All Organisms → cellular organisms → Bacteria | 3189 | Open in IMG/M |
| 3300027909|Ga0209382_10151088 | Not Available | 2690 | Open in IMG/M |
| 3300027909|Ga0209382_10171997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4 | 2498 | Open in IMG/M |
| 3300027909|Ga0209382_10506872 | All Organisms → cellular organisms → Bacteria → FCB group | 1328 | Open in IMG/M |
| 3300027909|Ga0209382_11277101 | Not Available | 746 | Open in IMG/M |
| 3300028536|Ga0137415_10070273 | All Organisms → cellular organisms → Bacteria | 3363 | Open in IMG/M |
| 3300028536|Ga0137415_11362548 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis → Cadophora → unclassified Cadophora → Cadophora sp. M221 | 530 | Open in IMG/M |
| 3300028803|Ga0307281_10433640 | Not Available | 506 | Open in IMG/M |
| 3300031949|Ga0214473_10993118 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni | 887 | Open in IMG/M |
| 3300032770|Ga0335085_10035904 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 6843 | Open in IMG/M |
| 3300032770|Ga0335085_10035904 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 6843 | Open in IMG/M |
| 3300032770|Ga0335085_10141816 | Not Available | 3029 | Open in IMG/M |
| 3300032770|Ga0335085_10152671 | All Organisms → cellular organisms → Bacteria | 2894 | Open in IMG/M |
| 3300032770|Ga0335085_10193472 | Not Available | 2499 | Open in IMG/M |
| 3300032770|Ga0335085_10615893 | Not Available | 1219 | Open in IMG/M |
| 3300032770|Ga0335085_10624958 | Not Available | 1208 | Open in IMG/M |
| 3300032770|Ga0335085_12281985 | Not Available | 542 | Open in IMG/M |
| 3300032782|Ga0335082_10330345 | Not Available | 1394 | Open in IMG/M |
| 3300032782|Ga0335082_10374147 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300032782|Ga0335082_10947587 | Not Available | 724 | Open in IMG/M |
| 3300032782|Ga0335082_11087506 | Not Available | 665 | Open in IMG/M |
| 3300032782|Ga0335082_11551141 | Not Available | 534 | Open in IMG/M |
| 3300033412|Ga0310810_11414198 | Not Available | 529 | Open in IMG/M |
| 3300033412|Ga0310810_11414198 | Not Available | 529 | Open in IMG/M |
| 3300033433|Ga0326726_10009306 | All Organisms → cellular organisms → Bacteria | 8712 | Open in IMG/M |
| 3300033433|Ga0326726_10065187 | All Organisms → cellular organisms → Bacteria | 3208 | Open in IMG/M |
| 3300033433|Ga0326726_10363720 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300033433|Ga0326726_10742337 | Not Available | 948 | Open in IMG/M |
| 3300033433|Ga0326726_11293898 | Not Available | 709 | Open in IMG/M |
| 3300033433|Ga0326726_11705762 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300033500|Ga0326730_1012288 | Not Available | 1865 | Open in IMG/M |
| 3300033513|Ga0316628_101718877 | Not Available | 835 | Open in IMG/M |
| 3300033811|Ga0364924_004058 | All Organisms → cellular organisms → Bacteria | 2559 | Open in IMG/M |
| 3300033811|Ga0364924_007166 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2005 | Open in IMG/M |
| 3300033812|Ga0364926_140997 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300034090|Ga0326723_0010760 | All Organisms → cellular organisms → Bacteria | 3593 | Open in IMG/M |
| 3300034090|Ga0326723_0014398 | All Organisms → cellular organisms → Bacteria | 3165 | Open in IMG/M |
| 3300034090|Ga0326723_0155540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300034090|Ga0326723_0284453 | Not Available | 740 | Open in IMG/M |
| 3300034090|Ga0326723_0434491 | Not Available | 598 | Open in IMG/M |
| 3300034165|Ga0364942_0125895 | All Organisms → cellular organisms → Bacteria → FCB group | 833 | Open in IMG/M |
| 3300034773|Ga0364936_001106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3665 | Open in IMG/M |
| 3300034773|Ga0364936_120481 | Not Available | 527 | Open in IMG/M |
| 3300034817|Ga0373948_0053954 | Not Available | 869 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 44.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 4.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.48% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.42% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.06% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.06% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.06% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 1.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.71% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.35% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.35% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.35% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.35% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.35% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027187 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034773 | Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25390J43892_101229621 | 3300002911 | Grasslands Soil | STGGARVRNHRGLNCALPNQRLKLAARGGRMIGKGSVLIAAAAARSLSAIR* |
| Ga0066679_106571762 | 3300005176 | Soil | VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR* |
| Ga0066685_106892252 | 3300005180 | Soil | AHIDLAPSNMRMKLSARGGRLIGNSSNLSAAAAGRSLCAIR* |
| Ga0066686_102962812 | 3300005446 | Soil | MSQVPPNMRLKLSARGGRLIGKGSILIAAAAGRSLGAIR* |
| Ga0066689_103535611 | 3300005447 | Soil | LNCALPNQRLKLPARGGRVIGKGSVLIAAAAGRSLSAIR* |
| Ga0066692_103798692 | 3300005555 | Soil | VRNHCGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR* |
| Ga0066704_101213622 | 3300005557 | Soil | VRNHCGLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR* |
| Ga0066700_100425724 | 3300005559 | Soil | VRSHRGLNCALPHQRLKPPARGGRVIGKGSVLIAAAAGRSLSAIR* |
| Ga0066700_101247493 | 3300005559 | Soil | ALPNKRLKLAACGGRLKRNGSVLSAAAAGRSLSAIR* |
| Ga0066699_101895904 | 3300005561 | Soil | CALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR* |
| Ga0066703_105058171 | 3300005568 | Soil | VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGHSLSAIRYAAPQKDAL* |
| Ga0066705_100040382 | 3300005569 | Soil | VRNHRGLNCALPSQRLKLSACGGRMIGKDSVLIAAAAGRSLSAIR* |
| Ga0066705_100081484 | 3300005569 | Soil | VRNHRGLKCALPNQRLKLSARGGRVIGKGSVLIAAAVGRSLSAIR* |
| Ga0066702_105277541 | 3300005575 | Soil | TGGARVRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR* |
| Ga0066702_105491071 | 3300005575 | Soil | EHSVLPNMRLKLAARGGRLIEKASFLIAAAAGRSLSAIR* |
| Ga0066691_101908074 | 3300005586 | Soil | GLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR* |
| Ga0066691_101956443 | 3300005586 | Soil | LSTVAPNQRLKLSARGGRVVGNWINLSAAAAGRSLSAIR* |
| Ga0066706_100769235 | 3300005598 | Soil | VRNHRGLNCALPSQRLKLSARGGRMIGKDSVLIAAAAGRSLSAIR* |
| Ga0074472_108320792 | 3300005833 | Sediment (Intertidal) | MYPVCTKLLPNQRWKLSARGGRLGGNGSVLSAAAAGR |
| Ga0075293_10797271 | 3300005875 | Rice Paddy Soil | GLPNQRLKLSARGGHICKKKSVLSVAAAGRSLSATR* |
| Ga0075300_10740151 | 3300005876 | Rice Paddy Soil | SIERLGVRPNQRLKLSARGGHICKKKSVLSVAAAGRSLSATR* |
| Ga0075286_10129713 | 3300005886 | Rice Paddy Soil | RQMPNPRLKLSARGGRSVGKGSILIAAAAGRSLSAIR* |
| Ga0066696_111140591 | 3300006032 | Soil | MMARPNKRLKLSACGGRSIGNWFILSAAAAGRSLSAIR* |
| Ga0066652_1008160712 | 3300006046 | Soil | MCSESTWQMRAPPNQRLKLTARGGRSIRELSFLSAAAAGRSLS |
| Ga0075417_100273135 | 3300006049 | Populus Rhizosphere | MSLLPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR* |
| Ga0075417_101077681 | 3300006049 | Populus Rhizosphere | SGGLPNQRLKLTARGGRLIGKGSVLIAAAAGRTLSAIR* |
| Ga0075417_102219951 | 3300006049 | Populus Rhizosphere | MVREMPLPNQRLKLSARGGRVVGNGSLLIAAAAGRSLSAIR* |
| Ga0075417_102288902 | 3300006049 | Populus Rhizosphere | MALSNKRLKLAARGGRLIGKESLLVAAAAGRSLSAIR* |
| Ga0075417_102288904 | 3300006049 | Populus Rhizosphere | PNQRLKLTARGGRVRGNGSIFSAAAAGRSLSAIR* |
| Ga0075417_103861401 | 3300006049 | Populus Rhizosphere | PNMRLKLTARGGRVLGNESVLSAAAAGRSLSAIR* |
| Ga0075417_105400251 | 3300006049 | Populus Rhizosphere | MLPNLRLKLPARGGRLIGKKSVLIAAAAGRSLSAIR* |
| Ga0075427_101048032 | 3300006194 | Populus Rhizosphere | MLIAMPPANQRLKLTARGGRLMRNSSVLSAAAAGRSLS |
| Ga0074050_112880552 | 3300006577 | Soil | LKLSARGGRPVGNGSVLSAAAGGRSFSAVRYAHR* |
| Ga0066658_104307621 | 3300006794 | Soil | SNLRLKLPARGGRSVENRSVLIAAAAGRSLSAIR* |
| Ga0066665_100577443 | 3300006796 | Soil | LAPNQRLKLTARGGRSVGNGSVLIAAAAGRSLSAIR* |
| Ga0066665_101347664 | 3300006796 | Soil | VVAWAQPNPRLKLSARGGRVIGSGSVLSAAAAGRSLSAIR* |
| Ga0066659_110821132 | 3300006797 | Soil | ARVRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGHSLSAIRYAAPQKDAL* |
| Ga0066659_111852941 | 3300006797 | Soil | ARVRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR* |
| Ga0066660_102790384 | 3300006800 | Soil | LNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR* |
| Ga0066660_104133093 | 3300006800 | Soil | NCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR* |
| Ga0066660_104526363 | 3300006800 | Soil | SEHSVLPNMRLKLAARGGRLIEKASFLIAAAAGRSLSAIR* |
| Ga0075428_1001731562 | 3300006844 | Populus Rhizosphere | MSIGCTKVPPNQRLKLSARGGRVIGKWSVLSAAAAGRSLSAIR* |
| Ga0075428_1002617482 | 3300006844 | Populus Rhizosphere | MASICVDMLPNLRLKLPARGGRLIGKKSVLIAAAAGRSLSAIR* |
| Ga0075428_1002987344 | 3300006844 | Populus Rhizosphere | MVRGLPRQPNMRLKLTARGGRVLGNESVLSAAAAGRSLSAIR* |
| Ga0075428_1006136111 | 3300006844 | Populus Rhizosphere | MRHGRNGKWLAPNMRLKLLARGGRSIGKWSVLIAAAAGRNLSAIR* |
| Ga0075428_1009207904 | 3300006844 | Populus Rhizosphere | PNQRLKLTARGGRVIGNRYVLSAAVAGRSLSAIR* |
| Ga0075428_1010223402 | 3300006844 | Populus Rhizosphere | GALPNQRLKLSARGGRLVGNGSILIAAAAGRSLSAIR* |
| Ga0075428_1022873491 | 3300006844 | Populus Rhizosphere | MASMCVDMLPNQRLKLTARGGRLIGKRSVLSAAAAGRSL |
| Ga0075428_1024209832 | 3300006844 | Populus Rhizosphere | MSPLPNQRLKLTARGGRSRGKESVLIAAAAGRSLS |
| Ga0075421_1000466422 | 3300006845 | Populus Rhizosphere | VTCLSELPNQRLKLTARGGRLIGKGSVLSAAATGRSLSAIR* |
| Ga0075421_10009466910 | 3300006845 | Populus Rhizosphere | VRGRRGLTYALPNQRLKLTARGGRLIGKRSILSAAAAGRSLSAIR* |
| Ga0075421_1000946692 | 3300006845 | Populus Rhizosphere | MGLPNMRLKLTARGGRLIGNRSVLSAAAAGRSLSAIR* |
| Ga0075421_1001631521 | 3300006845 | Populus Rhizosphere | MLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR* |
| Ga0075421_1001772186 | 3300006845 | Populus Rhizosphere | MWRPNQRLKLTARGGRLVRYGSVLMAAATGRSLSAIR* |
| Ga0075421_1002013495 | 3300006845 | Populus Rhizosphere | ARAPANMRLKLTARGRRLVGNGSVFSAAAAGRSLSAIR* |
| Ga0075421_1006703242 | 3300006845 | Populus Rhizosphere | VSKPPSNQRLKLTSRGGRLKGKRSILIAAAAGRSLSAIR* |
| Ga0075421_1007293682 | 3300006845 | Populus Rhizosphere | MASMCVDMLPNQRLKLTARGGRLIGKRSVLSAAAAGRSLSAIR* |
| Ga0075421_1010716841 | 3300006845 | Populus Rhizosphere | PIMLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR* |
| Ga0075421_1012443741 | 3300006845 | Populus Rhizosphere | MSLPNQRLKLTARGGRLRGNRLLLSAAAAGRSLSAIR* |
| Ga0075430_1008017881 | 3300006846 | Populus Rhizosphere | VAQAPPNQRMKLAARGGRSVGNNVFLIAAAAGRSLCAIR* |
| Ga0075431_10005141310 | 3300006847 | Populus Rhizosphere | MGGEPPNQRLKLPARGGRLVGHKSFLSTAAAGRSLSAIR* |
| Ga0075431_1000819482 | 3300006847 | Populus Rhizosphere | MVQDDSCCGKVPPNQRLKLTARGGRLKGKVPVLSAAAAGRSLSAIR* |
| Ga0075431_1001296463 | 3300006847 | Populus Rhizosphere | VLRPNQRLKLTACGGRVVGKRSILIAAAPGRSLSAIR* |
| Ga0075431_1001900834 | 3300006847 | Populus Rhizosphere | MIAKPPNQRLKLSARGGRLIGKGSVLIAAAAGRSLSAIR* |
| Ga0075431_1009293021 | 3300006847 | Populus Rhizosphere | PNQRLKLPARGGRLRGNESILIAAAAGRSLSAIR* |
| Ga0075431_1012668342 | 3300006847 | Populus Rhizosphere | PNMRLKLTARGGRLIGNWLFLSAAAAGRSLSAIR* |
| Ga0075431_1018786232 | 3300006847 | Populus Rhizosphere | PNQRLKLTARGGRLVGNGVVLPAAAAGRSLSAIR* |
| Ga0075433_100859982 | 3300006852 | Populus Rhizosphere | MKARLLPNMRLKLSARGGRLIGKVFILIAAAAGRSLSAIR* |
| Ga0075433_101168836 | 3300006852 | Populus Rhizosphere | PMGLPNMRLKLTARGGRLRGNRLFLSAAAAGRSLSAIR* |
| Ga0075433_101603584 | 3300006852 | Populus Rhizosphere | QPPNQRLKLSARGGRLRGNWSILSAAAAGRSLSAIR* |
| Ga0075433_101886932 | 3300006852 | Populus Rhizosphere | VYLNMLPNMRLKLTARGGRLVGDGSVLMAAAAGRSLSAIR* |
| Ga0075433_103658094 | 3300006852 | Populus Rhizosphere | MNKLAPNQRLKLTARGGRLMGNRSILSAAAAGRSLSAIR* |
| Ga0075433_104491902 | 3300006852 | Populus Rhizosphere | VDMLPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR* |
| Ga0075433_104837101 | 3300006852 | Populus Rhizosphere | MASICVDMLPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR* |
| Ga0075433_115087341 | 3300006852 | Populus Rhizosphere | LPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR* |
| Ga0075433_119155232 | 3300006852 | Populus Rhizosphere | MLPNQRLKLTARGGRLTGNESVLSAAAAGRSLSAIR* |
| Ga0075425_1003675862 | 3300006854 | Populus Rhizosphere | MSLPNQRLKLSARGGHNCRKESVLSVAAAGRSLSAIR* |
| Ga0075434_1000239605 | 3300006871 | Populus Rhizosphere | MIQAHLPNQRLKLSARGGRVVGNGSVLSAAAAGRSLSAIR* |
| Ga0075434_1000508882 | 3300006871 | Populus Rhizosphere | MGAPPNQRLKLTARGGRLVRNGSVLSAAAAGRSLSAIR* |
| Ga0075434_1000626174 | 3300006871 | Populus Rhizosphere | VPQQPNQRLKLTARGGRLKGKKSILIAAAAGRSLRAIR* |
| Ga0075434_1000905361 | 3300006871 | Populus Rhizosphere | VRPNQRLKLSARGGRLVEKGFVLSAAAAGRSLSAIR* |
| Ga0075434_1001139957 | 3300006871 | Populus Rhizosphere | MMQPPNMRLKLTARGGRLIGNRSVLSAAAAGRSLSAIR* |
| Ga0075434_1001485818 | 3300006871 | Populus Rhizosphere | PNQRLKLTARGGRLRGNVSILSAAAAGRSLSAIR* |
| Ga0075434_1001817704 | 3300006871 | Populus Rhizosphere | MTQQPNMRLKLTARGGRVKGKESILIAAAAGRSLSAIR* |
| Ga0075434_1002004885 | 3300006871 | Populus Rhizosphere | MGLPNMRLKLTARGGRLRGNRLFLSAAAAGRSLSAIR |
| Ga0075434_1002400064 | 3300006871 | Populus Rhizosphere | GRLLPNQRLKLTTRGGRLIEKESVLIAAAAGRSLSAIR* |
| Ga0075434_1004812702 | 3300006871 | Populus Rhizosphere | MASICVDTLPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR* |
| Ga0075434_1012419471 | 3300006871 | Populus Rhizosphere | MVQDDSCCGKVPPNQRLKLTARGGRSVRNESILIAAAAGRSLSAIR* |
| Ga0075429_1000516643 | 3300006880 | Populus Rhizosphere | VIVGLPNQRLKLTARGGRVIGNWSILCAAATGRSLSAIR* |
| Ga0075429_1000516648 | 3300006880 | Populus Rhizosphere | VPLPNQRLKLTARGGRLVGKELVLSAAAAGRSLSAIR* |
| Ga0075429_1000789806 | 3300006880 | Populus Rhizosphere | MRGLPPNQRLKLTARGGRLIGNESVLSAAAAGRSLSAIR* |
| Ga0075429_1001078611 | 3300006880 | Populus Rhizosphere | LPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR* |
| Ga0075429_1001336572 | 3300006880 | Populus Rhizosphere | MTGLSNQRLKLSARGGRLVGSASVLSAAAAGRSLSAIR* |
| Ga0075429_1003958351 | 3300006880 | Populus Rhizosphere | SNQRLKLTARGGRSIGNGSVLMAAAAGRSLSAIR* |
| Ga0075429_1005920704 | 3300006880 | Populus Rhizosphere | PNMRLKLTARGGRVVGNRSILIAAAAGRSLSAIR* |
| Ga0075429_1007178511 | 3300006880 | Populus Rhizosphere | RSRLPNMRLKLPARGGRLIGKGSILLAAAAGRSLSAIR* |
| Ga0075429_1012023232 | 3300006880 | Populus Rhizosphere | PNQRLKLPARGGRLRGKGSVLIAAAAGRSLSAIR* |
| Ga0075424_1000533462 | 3300006904 | Populus Rhizosphere | VTPRRAPPNQRLKLSARGGRVAGNRSVLSAAAAGRSLSAIR* |
| Ga0075424_1000533465 | 3300006904 | Populus Rhizosphere | VSKPPSNQRLKLTARGGRLVGNGSVLIAAAAGRSLSAIR* |
| Ga0075424_1025116311 | 3300006904 | Populus Rhizosphere | GGTLPNQRLKLSARGGRLRGNGSVLSAAAAGRSLSAFR* |
| Ga0075419_100991541 | 3300006969 | Populus Rhizosphere | RPNQRLKLTARGGRLMGNGSILSAAAAGCSLSAIR* |
| Ga0075419_103966881 | 3300006969 | Populus Rhizosphere | PPNQRLKLTARGGRLREKRSILLAAAAGRSLSAIR* |
| Ga0075419_105888202 | 3300006969 | Populus Rhizosphere | PPNQRLKLTARGGRLRAKGSILMAAAAGRSLSAIR* |
| Ga0075419_110105003 | 3300006969 | Populus Rhizosphere | ALPNQRLKLTARGGRPKGKRSILIAAAAGRSLSAIR* |
| Ga0099791_105703971 | 3300007255 | Vadose Zone Soil | SICVDMLPNQRLKLTARGGRVVGNGSVLIAAAAGRSLSAIR* |
| Ga0066710_10003327012 | 3300009012 | Grasslands Soil | TLVVAWAQPNPRLKLSARGGRVIGSGSVLSAAAAGRSLSAIR |
| Ga0066710_1004626982 | 3300009012 | Grasslands Soil | MTLRPNQRMNLSASGGRFWRNRSIFSAAAAGRSLCAIR |
| Ga0066710_1010282651 | 3300009012 | Grasslands Soil | MGAIPRQDRLPNQRLKLSACGGRLIRNWSVLSAAAAGRSLSA |
| Ga0099827_104148211 | 3300009090 | Vadose Zone Soil | LPNQRLKLSARGGRLVENNVFLPTAAAGRSLSAIR* |
| Ga0075418_107451253 | 3300009100 | Populus Rhizosphere | PLPNQRLKLTARGGRLVGKELVLSAAAAGRSLSAIR* |
| Ga0075418_114856251 | 3300009100 | Populus Rhizosphere | RQPNMRLKLTARGSRLIGKRSVLIAAATGRSLSAIR* |
| Ga0075418_124721002 | 3300009100 | Populus Rhizosphere | VPSNMRLKLTARAGRLVGHGTVLSAAAAGGSLREIR* |
| Ga0066709_1005830864 | 3300009137 | Grasslands Soil | GGARVRNHRGLNCALPNQRLKLSARGGRMIGKGSFLIAAAASRSLSAIR* |
| Ga0066709_1029821332 | 3300009137 | Grasslands Soil | SNMRMKLSARGGRLIGNWSKLSAAAAGRSLCAPR* |
| Ga0114129_100781539 | 3300009147 | Populus Rhizosphere | MTPNMRLKLTARGGRLVANSSVLIAAAAGRSLSAIR* |
| Ga0114129_101437511 | 3300009147 | Populus Rhizosphere | MPLPNQRLKLTARGGRLRGKRSILIAAAAGRSLSAIR* |
| Ga0114129_101545946 | 3300009147 | Populus Rhizosphere | MRARPNQRLKLTARGGRLIGKWFTLIAAAAGRSLSAIR* |
| Ga0114129_101720292 | 3300009147 | Populus Rhizosphere | MAGALPNQRLKLTACGGRLVGNRSLLSAAAAGRCLSAIR* |
| Ga0114129_101998785 | 3300009147 | Populus Rhizosphere | CSAGQPNQRLKLSARGARLVRNRSILSAGAAGRSLSAIR* |
| Ga0114129_102743925 | 3300009147 | Populus Rhizosphere | VALPNQRLKLSARGGRLVGNGSVLIAAAAGRSLSAIR* |
| Ga0114129_102870124 | 3300009147 | Populus Rhizosphere | RPNQRLKLTTRGGRLLRNGSILSAAAAGRSLSAIR* |
| Ga0114129_102982831 | 3300009147 | Populus Rhizosphere | LARAPANMRLKLTARGRRLVGNGSVFSAAAAGRSLSAIR* |
| Ga0114129_103746516 | 3300009147 | Populus Rhizosphere | LPVLRPNQRLKLTACGGRVVGKRSILIAAAPGRSLSAIR* |
| Ga0114129_104340761 | 3300009147 | Populus Rhizosphere | SRSRLPNMRLKLPARGGRLIGKGSILLAAAAGRSLSAIR* |
| Ga0114129_105156994 | 3300009147 | Populus Rhizosphere | WPIMLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR* |
| Ga0114129_105540291 | 3300009147 | Populus Rhizosphere | TLLSVSTQPNQRLKLTARGGRLRGNGSVLSAAAAGRSLSAIR* |
| Ga0114129_106336614 | 3300009147 | Populus Rhizosphere | DVFTDPQPPNKRLKLTARGGRQVGNLSILSAAAAGRSLSAIR* |
| Ga0114129_106762281 | 3300009147 | Populus Rhizosphere | CSGGLPNQRLKLTARGGRLIGKGSVLIAAAAGRTLSAIR* |
| Ga0114129_106779831 | 3300009147 | Populus Rhizosphere | MKGLPPNQRLKLTARGGRLIGNRSILSAAAAGRSLSAI |
| Ga0114129_109480573 | 3300009147 | Populus Rhizosphere | VSKPPSNQRLKLPARGDRVVRSRSVLSAAAAGRSLSAIR* |
| Ga0114129_110318663 | 3300009147 | Populus Rhizosphere | RSFVRLSRLPNMRLKLTARGGRVIGNRFVLSAADAGRSLSAIR* |
| Ga0114129_112102751 | 3300009147 | Populus Rhizosphere | MVTLGPAPNIRLKLSARGGRVVGKGSILSAAAAGCSLSAIR |
| Ga0114129_112345431 | 3300009147 | Populus Rhizosphere | EPPNMRLKLAARGGRLRGKGSILIAAAAGRSLSAIR* |
| Ga0114129_117162021 | 3300009147 | Populus Rhizosphere | PNQRLKLSARGGRLVGNGSVLIAAATGRSLSAIR* |
| Ga0114129_117914932 | 3300009147 | Populus Rhizosphere | MVLPNQRLKLTARGGRLIAKESVLLAAAAGRSLSAIR* |
| Ga0114129_121524901 | 3300009147 | Populus Rhizosphere | VLPNQRLKLSARGGRVIGKGFVLSAAAAGRSLSAIR* |
| Ga0114129_121539251 | 3300009147 | Populus Rhizosphere | PMSLLPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR* |
| Ga0114129_128831131 | 3300009147 | Populus Rhizosphere | MPLPNQRMKLSARGGHTCRLNSILSVAAAGRSLCALR |
| Ga0114129_129217961 | 3300009147 | Populus Rhizosphere | PNQRLKLSARGGRLVGKGSILIAAAAGRSLSAIR* |
| Ga0114129_129348661 | 3300009147 | Populus Rhizosphere | PNQRLKLTARGGRLIGNRSILIAAAAGRSLSAIR* |
| Ga0114129_130182541 | 3300009147 | Populus Rhizosphere | LKQDAVLPNQRLKLTARGGRLIVKGSILIAAAAGRSLSSIR |
| Ga0075423_100350531 | 3300009162 | Populus Rhizosphere | LTCDLKLTARGGRLIGKRTVLSAAAAGRSLSAFR* |
| Ga0075423_100554311 | 3300009162 | Populus Rhizosphere | PPMGLPNMRLKLTARGGRLRGNRLFLSAAAAGRSLSAIR* |
| Ga0075423_100948191 | 3300009162 | Populus Rhizosphere | PNQRLKLTTRGGRLIEKESVLIAAAAGRSLSAIR* |
| Ga0075423_103671625 | 3300009162 | Populus Rhizosphere | GQAPNQRLKLTARGGRLIGNRLFLSAAAAGRSLSAIR* |
| Ga0075423_127073172 | 3300009162 | Populus Rhizosphere | MLPNQRLKLSGCGGRLKGNGSALIAAAATRSLSAIR* |
| Ga0126384_123438451 | 3300010046 | Tropical Forest Soil | AGRVLANQRMKLTARGGRLIGNGLIFCAAAAGRSLCAIR* |
| Ga0134071_101248303 | 3300010336 | Grasslands Soil | RYPPPNQRMKLTACRGHIWRNRSLLIVAAAGRSLSAIR* |
| Ga0126377_112087721 | 3300010362 | Tropical Forest Soil | MKDLDNAPSNMRMKLSTRGGRVIGKGLLLSAAAAGRSLCAIR* |
| Ga0134123_116318521 | 3300010403 | Terrestrial Soil | RVRGLCGLNCAQPNQRVKLSARGGHNGRKESVLSVAAAGRSLSAIR* |
| Ga0137393_117394811 | 3300011271 | Vadose Zone Soil | GGARVRSHRGLNCALPNQRLKLMARGGRVIGKGSVLIAAAAGRGLSAIR* |
| Ga0137463_11154182 | 3300011444 | Soil | SKVLPNQRLKLSARGGRLVGSSFVLSAAAAGRSLSAIR* |
| Ga0137383_101260103 | 3300012199 | Vadose Zone Soil | MTLRPNMRLKLSARGGRLIGKGSVLLAAAAGRSLSAIR* |
| Ga0137382_100973213 | 3300012200 | Vadose Zone Soil | MTLRPNQRMKLSASGGRFWRNRSIFSAAAAGRSLCAIR* |
| Ga0137365_102326121 | 3300012201 | Vadose Zone Soil | PNMRLKLSARGGRLIGKGSVLLAAATGRSLSAIR* |
| Ga0137399_105546832 | 3300012203 | Vadose Zone Soil | MAWICVDMLPNQRLKLTARGGRVVGDGSVLIAAAAGRSLSAIR* |
| Ga0137374_100123635 | 3300012204 | Vadose Zone Soil | MRVLPNQRLKLSARGGRLRGKGSILIVAAAPHSLSAIR* |
| Ga0137374_101096572 | 3300012204 | Vadose Zone Soil | MGRVRPNQRLKLSARGGRLIGKGSILIAAAAGRSLSASR* |
| Ga0137374_101585266 | 3300012204 | Vadose Zone Soil | MYPVCTGMLPNQRMKLTARGGHIRRNRVTLSVAAAGRSLCAIR* |
| Ga0137374_103033021 | 3300012204 | Vadose Zone Soil | TKRLPNQRMKLPACGGRLRGKGFVLIAAAAGRSLCAVR* |
| Ga0137374_103033023 | 3300012204 | Vadose Zone Soil | MRVLLPNMRMKLAARGGRMMGNEFVLSAAAAGRSLCAIR* |
| Ga0137362_103553391 | 3300012205 | Vadose Zone Soil | CALPNQRLKLSARGGRMIGKGSVLIAAAARRSLSAIR* |
| Ga0137380_100314724 | 3300012206 | Vadose Zone Soil | VWLRAVRALPNERLNLTGLGGRLRGKGSILIVAAARRSLSAIR* |
| Ga0137381_100859951 | 3300012207 | Vadose Zone Soil | MLLPPNQRLKLSARGGRLVGNEFVLSAAAAGRSLSA |
| Ga0137381_101017021 | 3300012207 | Vadose Zone Soil | EVVVPRMSPPNQRMKLTARGGRVKRKKSFWSAAATGCSLCAIR* |
| Ga0137381_107217801 | 3300012207 | Vadose Zone Soil | FRVSMLLPPNQRLKLSARGGRLVGNEFVLSAAAAGRSLSAIR* |
| Ga0137378_104886922 | 3300012210 | Vadose Zone Soil | MTLRPNQRMKLSARGGRFWRNRSILSAAAAGRSLCAIR* |
| Ga0137434_10252311 | 3300012225 | Soil | MLLPNRRINLSARGGRVAGNGSVLSAAAAGRSLCAI |
| Ga0137387_101497802 | 3300012349 | Vadose Zone Soil | MTLRPNQRMNLSASGGRFWRNRSIFSAAAAGRSLCAIR* |
| Ga0137372_103989962 | 3300012350 | Vadose Zone Soil | MSLDWRRPNKRLKLTARGGRLVGKASFLIAAGAGRSLSAIR* |
| Ga0137367_100947883 | 3300012353 | Vadose Zone Soil | VTKRLPNQRMKLPACGGRLRGKGFVLIAAAAGRSLCAVR* |
| Ga0137367_112154501 | 3300012353 | Vadose Zone Soil | IASLANQRLKLTARGGRLKGNWSVLSAAAAGRSLSAIR* |
| Ga0137369_106783322 | 3300012355 | Vadose Zone Soil | GPVPSSPSNQRLKLTARGGRLRGKGSILIAAAAGRSLSAIC* |
| Ga0137375_103558874 | 3300012360 | Vadose Zone Soil | RSGPRPVRPNQRLKLSARGGRLVGNGSVLLAAAAGRSLSAIR* |
| Ga0137390_101143774 | 3300012363 | Vadose Zone Soil | MTALLTHPPNQRLKLSASGGRSKGNGFVLIAAAAGRSLSAIR* |
| Ga0137373_100643481 | 3300012532 | Vadose Zone Soil | VAQPNQRLKLSARGGHTCWNRFILSVAAAGRSLSAIH* |
| Ga0137373_102233373 | 3300012532 | Vadose Zone Soil | MAPNMRMKLTARGGRLKGNGLFLSAAAAGRSLCAIR* |
| Ga0137397_110889491 | 3300012685 | Vadose Zone Soil | ALPNQRLNLTARGGRVIGKGSVLIAAPAGRSLSAIR* |
| Ga0137359_116514142 | 3300012923 | Vadose Zone Soil | MASICVDMLPNQRLKLTARGGRVVGNGSVLIAAAAGRSLSAIR* |
| Ga0137404_120107313 | 3300012929 | Vadose Zone Soil | LPNQRLKLTARGGRVVGNGSVLIAAAAGRSLSAIR* |
| Ga0153915_102540201 | 3300012931 | Freshwater Wetlands | MLLPNQRLKLSARGGRLIGKGSLLIAAAAGRSLSAFR* |
| Ga0153915_128118372 | 3300012931 | Freshwater Wetlands | RRPSNQRLKLAARGGRGKEKGFVLLAAAAGRSLSAIR* |
| Ga0153915_131049271 | 3300012931 | Freshwater Wetlands | KWLPNLRLKLSARGGRLARNWSVLSAAAAGRSLSAIR* |
| Ga0134077_103787701 | 3300012972 | Grasslands Soil | MRVQPNKRLKLSARGGRSTRERSFLSAAAAGRSLSAFR |
| Ga0180066_10061311 | 3300014873 | Soil | MLPRVPNKRMKLAARGGRMVGIRSVLIAAAAGRSLSAIR* |
| Ga0137418_100397751 | 3300015241 | Vadose Zone Soil | RGLNCALPNQRLKLSARGGRMIGKGSVLIAAAARRSLSAIR* |
| Ga0134112_102812831 | 3300017656 | Grasslands Soil | TPSSERRVLPNMRLKLSARGGRLVGNGFVLSAAAAGRSLSAIR |
| Ga0134083_100159442 | 3300017659 | Grasslands Soil | MSRSEPPNQRLKLSARGGRLVGNKVFLIAAAAGRSLSAIR |
| Ga0184626_102888831 | 3300018053 | Groundwater Sediment | DVTPNQRLKLAARGGRLVGNGSVSSAAAAGRSLSAIR |
| Ga0184636_12113251 | 3300018068 | Groundwater Sediment | MLRKLAPNQRLKLSARGGRLVGNESVLSAAAAGRSLSA |
| Ga0184627_103929962 | 3300018079 | Groundwater Sediment | RHPNMRLKLSARGGRLIENGFVLSAAAAGRSLSAIR |
| Ga0184627_105865641 | 3300018079 | Groundwater Sediment | HAVGVLPNQRMKLAARGGRVIGNSLFLSAAAAGRSLCAIR |
| Ga0184639_104847892 | 3300018082 | Groundwater Sediment | AREQPPPNKRMKLSARGGHTCRTKSVLSVAAAGRSLCANR |
| Ga0184629_106076852 | 3300018084 | Groundwater Sediment | LPNQRLKLSARGGRVVGNGSVLSAAAAGRSLSASR |
| Ga0184629_107051923 | 3300018084 | Groundwater Sediment | VGASLGRVMPNQRLKLSACGGRSAGKGSVLSAAATG |
| Ga0066655_100114554 | 3300018431 | Grasslands Soil | MPLNQRLKVLALGGRLIGNKVFLSAASAGRSLSAIR |
| Ga0066667_113865321 | 3300018433 | Grasslands Soil | PRRRNMRVKLAAWGGRSVGKESLLIAAAPGRSLSAIR |
| Ga0066662_100704444 | 3300018468 | Grasslands Soil | VVAWAQPNPRLKLSARGGRVIGSGSVLSAAAAGRSLSAIR |
| Ga0066669_102227881 | 3300018482 | Grasslands Soil | RGLNCALPNQRLKLSARGGRMIGKGSILIAAAAGRSLSAIR |
| Ga0187894_105013551 | 3300019360 | Microbial Mat On Rocks | LIRLRPNQRMKLTARGGRVKRNRSFVAAAATGCSLCAF |
| Ga0187892_102458782 | 3300019458 | Bio-Ooze | PKSSRPNQRMKLSARGGRLRGMGFVMIAAAAGRSLCAVR |
| Ga0187892_103291871 | 3300019458 | Bio-Ooze | MAKRPNQRMKLSARGGRVKRKQSFLSAAATGCSLCAIR |
| Ga0187892_103907931 | 3300019458 | Bio-Ooze | MCWAVLPNQRMKLSARGGRVKRHPSFLAAAATGCSL |
| Ga0193733_10670293 | 3300020022 | Soil | SHRGLNCALPNQRLKLTARGGRVIGKGSVLIAAAAGRSLSAIR |
| Ga0210379_102598132 | 3300021081 | Groundwater Sediment | MDTLPNQRLKLSARGGRLIGKKSVLIAAAAGRSLSAIR |
| Ga0207646_112465722 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LCGLNCALPNRRLKLSARGGHNCRKESILSVAAAGRSLSAIR |
| Ga0209234_10145626 | 3300026295 | Grasslands Soil | VRNHRGLNRALPNQRLKLSARDGRMIGKSSVFIAAAAGCSLSAIR |
| Ga0209055_100251221 | 3300026309 | Soil | VRSHRGLNCALPHQRLKPPARGGRVIGKGSVLIAAAAGRSLSASR |
| Ga0209055_10250513 | 3300026309 | Soil | VRNHRGLNCALPSQRLKLSACGGRMIGKDSVLIAAAAGRSLCAIR |
| Ga0209153_10854812 | 3300026312 | Soil | VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR |
| Ga0209471_10040192 | 3300026318 | Soil | VRNHRGLNCALPSQRLKLSACGGRMIGKDSVLIAAAAGRSLSAIR |
| Ga0209471_12638102 | 3300026318 | Soil | SSEHSVLPNMRLKLAARGGRLIEKASFLIAAAAGRSLSAIR |
| Ga0209802_11340353 | 3300026328 | Soil | PLNQRLKLSARGGRLVGNGSVLSAAAAGRSLSAIR |
| Ga0209158_12825833 | 3300026333 | Soil | STGGARVRNHCGLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR |
| Ga0209159_11354872 | 3300026343 | Soil | VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAPAAGRSLSAIR |
| Ga0209160_12201601 | 3300026532 | Soil | MYPVCTGLLPNPPMKLSARGGRSVRNRSVLSAAAAGRSLW |
| Ga0209056_100082519 | 3300026538 | Soil | MGAIPRQDRLPNQRLKLSACGGRLIRNWSVLSAAAAGRSLSAIR |
| Ga0209474_100795184 | 3300026550 | Soil | PGLYRVAPNLRMKLSARGGRLVRNWSFLSAAAAGRSLCAIR |
| Ga0209577_102521223 | 3300026552 | Soil | GLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR |
| Ga0209869_10131872 | 3300027187 | Groundwater Sand | RVPDLLTMCKLPNQRLKLSGGGGRPKGNGSLLIAAAAPRSLSAIR |
| Ga0209180_100133123 | 3300027846 | Vadose Zone Soil | VRSHRGLNCALPNQRLKLMARGGRVIGKGSVLIAAAAGRGLSAIR |
| Ga0209814_100242612 | 3300027873 | Populus Rhizosphere | MSIGCTKVPPNQRLKLSARGGRVIGKWSVLSAAAAGRSLSAIR |
| Ga0209814_100313175 | 3300027873 | Populus Rhizosphere | VIAPSNQRLKLSARGGRLIGKGSILSAAAAGRSLSAIR |
| Ga0209814_100329804 | 3300027873 | Populus Rhizosphere | MGLPNMRLKLTARGGRLIGNRSVLSAAAAGRSLSAIR |
| Ga0209814_100829243 | 3300027873 | Populus Rhizosphere | LGGPLDQTRSGPSGPPNMRLKLTARGGRLRGKRSILIAAAAGRSLSAIR |
| Ga0209814_101226951 | 3300027873 | Populus Rhizosphere | ERPNQRLKLTARGGRLMGNGSILSAAAAGCSLSAIR |
| Ga0209814_101897691 | 3300027873 | Populus Rhizosphere | CDKVQPNMRLKLPARGGRLVGHKSFLSTAAAGRSLSAIR |
| Ga0209814_104455452 | 3300027873 | Populus Rhizosphere | MALSNKRLKLAARGGRLIGKESLLVAAAAGRSLSAIR |
| Ga0209283_106339532 | 3300027875 | Vadose Zone Soil | MYQGPPNQRLKLSARGGRPGGTESVLSAAAAGRSL |
| Ga0209481_100751371 | 3300027880 | Populus Rhizosphere | TYVLTNRLCSGGLPNQRLKLTARGGRLIGKGSVLIAAAAGRSLSAIR |
| Ga0209481_101114333 | 3300027880 | Populus Rhizosphere | MSLLPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR |
| Ga0209481_103799452 | 3300027880 | Populus Rhizosphere | LPVKQPPNQRMKLSARGGRLIGNWSILSAAAAGRSLCAIR |
| Ga0209481_104422612 | 3300027880 | Populus Rhizosphere | RMGGEPPNQRLKLPARGGRLVGHKSFLSTAAAGRSLSAIR |
| Ga0209481_106881951 | 3300027880 | Populus Rhizosphere | HRLRPNQRLKLTARSGRVVGKGSILSAAAAGRSLSAIR |
| Ga0209590_102212411 | 3300027882 | Vadose Zone Soil | RVSMLLPPNQRLKLSARGGRLVRNEFVLSAAAAGRSLSAIR |
| Ga0209488_104523363 | 3300027903 | Vadose Zone Soil | VRSHRGLNCALPNQGLKLMARGGRVIGKGSVLIAAAAGRGLSAIR |
| Ga0209382_1001926711 | 3300027909 | Populus Rhizosphere | MVRGLPRQPNMRLKLTARGGRVLGNESVLSAAAAGRSLSAIR |
| Ga0209382_100852296 | 3300027909 | Populus Rhizosphere | MLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR |
| Ga0209382_101119405 | 3300027909 | Populus Rhizosphere | MLIAMPPANQRLKLTARGGRLMRNSSVLSAAAAGRSLSAIR |
| Ga0209382_101510885 | 3300027909 | Populus Rhizosphere | VIVGLPNQRLKLTARGGRVIGNWSILCAAATGRSLSAIR |
| Ga0209382_101719977 | 3300027909 | Populus Rhizosphere | VRGRRGLTYALPNQRLKLTARGGRLIGKRSILSAAAAGRSLSAIR |
| Ga0209382_105068723 | 3300027909 | Populus Rhizosphere | ILARAPANMRLKLTARGRRLVGNGSVFSAAAAGRSLSAIR |
| Ga0209382_112771013 | 3300027909 | Populus Rhizosphere | RPNQRLKLTARGGRLIGNWSILIAAAAGRSLSAIR |
| Ga0137415_100702733 | 3300028536 | Vadose Zone Soil | VRSHRGLNCALPNQRLKLTARGGRVIGKGSVLIAAAAGRSLRAIR |
| Ga0137415_113625482 | 3300028536 | Vadose Zone Soil | MAWICVDMLPNQRLKLTARGGRVVGDGSVLIAAAAGRSLSAIR |
| Ga0307281_104336401 | 3300028803 | Soil | PAGKVLPNQRLKLSARGGRLVGNKSVLSAAAAGRSLSAIR |
| Ga0214473_109931181 | 3300031949 | Soil | MVPPNQRMKLSARGGRLVGNRSVLSAAAAGRSLCAIR |
| Ga0335085_100359047 | 3300032770 | Soil | MLPPNLRLKLSARGGRSIEERLFLSAAAAGRSLSASR |
| Ga0335085_100359049 | 3300032770 | Soil | MCCLKLPPNLRLKLSARGGRAIRERSFLSAAAAGRSLSAFR |
| Ga0335085_101418162 | 3300032770 | Soil | MPSVRLCLPPNLRLKLAARGGRAIKERSFLSAAAAGRSLSASR |
| Ga0335085_101526716 | 3300032770 | Soil | MPSLPVCLLPNLRLKLSARGGRSIKEWSFLSAAAAGRSLSAFR |
| Ga0335085_101934722 | 3300032770 | Soil | MMALPNLRLKLSARGGRSIKEVVFLIAAAAGRSLSASR |
| Ga0335085_106158933 | 3300032770 | Soil | TRNERPSNLRLKLSARGGRAITERFFLSAAAAGRSLSAFR |
| Ga0335085_106249582 | 3300032770 | Soil | MMAFARALPWQPNLRLKLSARGGRVGWNTFILSAAAAGRSLSASR |
| Ga0335085_122819852 | 3300032770 | Soil | LPNLRLKLSARGGRTIKELLLLIAAAAGRSLSASR |
| Ga0335082_103303453 | 3300032782 | Soil | MALPNLRLKLSARGGRTIKELLLLIAAAAGRSLSASR |
| Ga0335082_103741471 | 3300032782 | Soil | RPLTPPNWRLKLSARGGRLIRELIFLIAAAAGRSLSASR |
| Ga0335082_109475871 | 3300032782 | Soil | AAFLWLIAVRPNLRLKLPARGGRAIKERSFLSAAAAGRSLSAFR |
| Ga0335082_110875061 | 3300032782 | Soil | MVCHVLPNWRLKLAARGGRSIKERSFLIAAAAGRSLSASRYAA |
| Ga0335082_115511411 | 3300032782 | Soil | MPSLPVCLLPNLRLKLSARGGRSIKEWSFLSAAAAGRSLSASR |
| Ga0310810_114141981 | 3300033412 | Soil | VKRVPNLRLKLSARGGRLVGNGSVLSAAAAGRSLSA |
| Ga0310810_114141982 | 3300033412 | Soil | MPPPNQRLKLTARGGRLIGKWSILSAAAAGRSLSAIR |
| Ga0326726_100093061 | 3300033433 | Peat Soil | LPNLRLKLSARGGRLKGKGSVLIAAAAGRSLSAIR |
| Ga0326726_100651876 | 3300033433 | Peat Soil | MMAGEPPNQRLKLSARGGRLVGKGSVLIAAAAGRSLSAIR |
| Ga0326726_103637201 | 3300033433 | Peat Soil | TSSEAPPNQRLKLSARGGRVVGNGFILSAAAAGRSLSAIR |
| Ga0326726_107423371 | 3300033433 | Peat Soil | MLRPDLRLKLSARGGRLVENWFVLIAAAAGRSLSAIR |
| Ga0326726_112938981 | 3300033433 | Peat Soil | NALSSNTWLPNPRLKLSGCGGRLKGKGSVLIAAAAPRSLSAIR |
| Ga0326726_117057621 | 3300033433 | Peat Soil | VTKRLPNLRLKLSARGGRVVGNWIYLSAAAAGRSLSAIR |
| Ga0326730_10122885 | 3300033500 | Peat Soil | VPPNQRLKLSARGGRLKGKGSILIAAAAGRSLSAIR |
| Ga0316628_1017188771 | 3300033513 | Soil | VGQLAIGPPPNQRLKLAARGGRLVGNWSILSAAAAGRSLSAIR |
| Ga0364924_004058_292_414 | 3300033811 | Sediment | MVAWAQPDPRLKLAARGGHVVGNGSVLSAAAAGRSLCANR |
| Ga0364924_007166_1059_1169 | 3300033811 | Sediment | MPPNQRLKLSARGGRLIGKESLLIAAAAGRSLSATR |
| Ga0364926_140997_1_135 | 3300033812 | Sediment | RRGLSTQKVAAYQRMKLSARGGRLVGNSSFLSAAAAGRSLSAFR |
| Ga0326723_0010760_178_291 | 3300034090 | Peat Soil | MTLPNQRLKLSARGGHTCRKKSVLSVAAAGRSLSAIR |
| Ga0326723_0014398_2723_2836 | 3300034090 | Peat Soil | MALPNQRLKLSARGGRLKGKDSFLLAAAAGRSLSAIR |
| Ga0326723_0155540_1_117 | 3300034090 | Peat Soil | AGALPNQRLKLSVRGGRSVGNESVLIAAAAGRSLSAIR |
| Ga0326723_0284453_2_115 | 3300034090 | Peat Soil | ALTSNMRLKLSAWGGRLVGNGSLLIAAAPGRSLSATR |
| Ga0326723_0434491_1_117 | 3300034090 | Peat Soil | ARWLPNLRLKLSAGGGRLIAKGSVLIAAAAGRSLSAVR |
| Ga0364942_0125895_2_112 | 3300034165 | Sediment | WQSNQRLKLSARGGRVVGNRVFLSAAATGCSLCAFR |
| Ga0364936_001106_2_124 | 3300034773 | Sediment | VHGSEAPYQRMKLSARGGRLMRTWSVLIAAAAGRSLCAVR |
| Ga0364936_120481_393_527 | 3300034773 | Sediment | VTCGAQVRQLPSKGMKLAARGGRVGGNGFVLSAAAAGRSLSAIR |
| Ga0373948_0053954_761_868 | 3300034817 | Rhizosphere Soil | PPNQRLKLPARGGRVRGTGSILIAAATGRSLSAIR |
| ⦗Top⦘ |