


| Basic Information | |
|---|---|
| Family ID | F011897 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 286 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRRERALKVVLVVVGLLFTAMVYPLVLFVKQEPALAMMM |
| Number of Associated Samples | 212 |
| Number of Associated Scaffolds | 286 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.22 % |
| % of genes near scaffold ends (potentially truncated) | 86.36 % |
| % of genes from short scaffolds (< 2000 bps) | 80.07 % |
| Associated GOLD sequencing projects | 200 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.119 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.434 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.902 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 286 Family Scaffolds |
|---|---|---|
| PF04237 | YjbR | 11.19 |
| PF14329 | DUF4386 | 2.45 |
| PF00903 | Glyoxalase | 1.75 |
| PF12833 | HTH_18 | 1.75 |
| PF07676 | PD40 | 1.40 |
| PF00857 | Isochorismatase | 1.05 |
| PF13751 | DDE_Tnp_1_6 | 1.05 |
| PF04101 | Glyco_tran_28_C | 0.70 |
| PF01833 | TIG | 0.70 |
| PF07040 | DUF1326 | 0.70 |
| PF00561 | Abhydrolase_1 | 0.70 |
| PF03544 | TonB_C | 0.70 |
| PF14534 | DUF4440 | 0.70 |
| PF12867 | DinB_2 | 0.70 |
| PF13432 | TPR_16 | 0.70 |
| PF00583 | Acetyltransf_1 | 0.70 |
| PF01638 | HxlR | 0.70 |
| PF02661 | Fic | 0.70 |
| PF08238 | Sel1 | 0.35 |
| PF08401 | ArdcN | 0.35 |
| PF00196 | GerE | 0.35 |
| PF13561 | adh_short_C2 | 0.35 |
| PF01436 | NHL | 0.35 |
| PF05690 | ThiG | 0.35 |
| PF03795 | YCII | 0.35 |
| PF12680 | SnoaL_2 | 0.35 |
| PF01569 | PAP2 | 0.35 |
| PF04430 | DUF498 | 0.35 |
| PF11412 | DsbC | 0.35 |
| PF13602 | ADH_zinc_N_2 | 0.35 |
| PF01522 | Polysacc_deac_1 | 0.35 |
| PF05163 | DinB | 0.35 |
| PF03435 | Sacchrp_dh_NADP | 0.35 |
| PF05227 | CHASE3 | 0.35 |
| PF06348 | DUF1059 | 0.35 |
| PF00144 | Beta-lactamase | 0.35 |
| PF01336 | tRNA_anti-codon | 0.35 |
| PF04909 | Amidohydro_2 | 0.35 |
| PF07606 | DUF1569 | 0.35 |
| PF12762 | DDE_Tnp_IS1595 | 0.35 |
| PF12161 | HsdM_N | 0.35 |
| PF13520 | AA_permease_2 | 0.35 |
| PF02518 | HATPase_c | 0.35 |
| PF07166 | DUF1398 | 0.35 |
| PF01068 | DNA_ligase_A_M | 0.35 |
| PF01797 | Y1_Tnp | 0.35 |
| PF06441 | EHN | 0.35 |
| PF04055 | Radical_SAM | 0.35 |
| PF10014 | 2OG-Fe_Oxy_2 | 0.35 |
| PF01451 | LMWPc | 0.35 |
| PF02586 | SRAP | 0.35 |
| PF03176 | MMPL | 0.35 |
| PF13517 | FG-GAP_3 | 0.35 |
| PF06146 | PsiE | 0.35 |
| PF12697 | Abhydrolase_6 | 0.35 |
| PF08734 | GYD | 0.35 |
| PF14234 | DUF4336 | 0.35 |
| PF13519 | VWA_2 | 0.35 |
| PF08264 | Anticodon_1 | 0.35 |
| PF04273 | BLH_phosphatase | 0.35 |
| PF07228 | SpoIIE | 0.35 |
| PF13826 | DUF4188 | 0.35 |
| PF08031 | BBE | 0.35 |
| PF02777 | Sod_Fe_C | 0.35 |
| PF02683 | DsbD | 0.35 |
| PF13181 | TPR_8 | 0.35 |
| PF11604 | CusF_Ec | 0.35 |
| PF00753 | Lactamase_B | 0.35 |
| PF07883 | Cupin_2 | 0.35 |
| PF08240 | ADH_N | 0.35 |
| PF07690 | MFS_1 | 0.35 |
| PF04670 | Gtr1_RagA | 0.35 |
| PF00884 | Sulfatase | 0.35 |
| PF04185 | Phosphoesterase | 0.35 |
| PF09445 | Methyltransf_15 | 0.35 |
| PF13495 | Phage_int_SAM_4 | 0.35 |
| PF16925 | TetR_C_13 | 0.35 |
| PF00106 | adh_short | 0.35 |
| PF05402 | PqqD | 0.35 |
| PF14257 | DUF4349 | 0.35 |
| PF01042 | Ribonuc_L-PSP | 0.35 |
| PF08818 | DUF1801 | 0.35 |
| PF00665 | rve | 0.35 |
| PF01435 | Peptidase_M48 | 0.35 |
| PF13174 | TPR_6 | 0.35 |
| PF13449 | Phytase-like | 0.35 |
| PF13414 | TPR_11 | 0.35 |
| PF07884 | VKOR | 0.35 |
| PF00593 | TonB_dep_Rec | 0.35 |
| PF00069 | Pkinase | 0.35 |
| PF05649 | Peptidase_M13_N | 0.35 |
| PF00575 | S1 | 0.35 |
| COG ID | Name | Functional Category | % Frequency in 286 Family Scaffolds |
|---|---|---|---|
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 11.19 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.40 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.05 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.05 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.70 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.70 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.35 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.35 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.35 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.35 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.35 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.35 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.35 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.35 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.35 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.35 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.35 |
| COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.35 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.35 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.35 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.35 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.35 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.35 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.35 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.35 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.35 |
| COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 0.35 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.35 |
| COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 0.35 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.35 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.35 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.35 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.35 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.35 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.35 |
| COG5562 | Prophage-encoded protein YbcV, DUF1398 family | Mobilome: prophages, transposons [X] | 0.35 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.12 % |
| Unclassified | root | N/A | 18.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B01AEFSL | Not Available | 522 | Open in IMG/M |
| 3300000567|JGI12270J11330_10005773 | All Organisms → cellular organisms → Bacteria | 8656 | Open in IMG/M |
| 3300000567|JGI12270J11330_10062622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1907 | Open in IMG/M |
| 3300001089|JGI12683J13190_1005121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1505 | Open in IMG/M |
| 3300001131|JGI12631J13338_1029962 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300001867|JGI12627J18819_10017505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2899 | Open in IMG/M |
| 3300001867|JGI12627J18819_10388483 | Not Available | 567 | Open in IMG/M |
| 3300002907|JGI25613J43889_10006418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3210 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10089224 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300005330|Ga0070690_100526873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300005332|Ga0066388_101955141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1049 | Open in IMG/M |
| 3300005332|Ga0066388_106040404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300005435|Ga0070714_101762999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 605 | Open in IMG/M |
| 3300005438|Ga0070701_10473626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300005439|Ga0070711_100636038 | Not Available | 893 | Open in IMG/M |
| 3300005451|Ga0066681_10670218 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005536|Ga0070697_100584670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300005538|Ga0070731_10261598 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300005540|Ga0066697_10420482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 774 | Open in IMG/M |
| 3300005574|Ga0066694_10250103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 840 | Open in IMG/M |
| 3300005598|Ga0066706_10298602 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300005602|Ga0070762_11150234 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005610|Ga0070763_10026543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2611 | Open in IMG/M |
| 3300005712|Ga0070764_11050570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 515 | Open in IMG/M |
| 3300005713|Ga0066905_100446701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
| 3300005764|Ga0066903_102115919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1083 | Open in IMG/M |
| 3300005764|Ga0066903_104561557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 738 | Open in IMG/M |
| 3300005764|Ga0066903_106855539 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006028|Ga0070717_11223022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 683 | Open in IMG/M |
| 3300006028|Ga0070717_11638708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 583 | Open in IMG/M |
| 3300006046|Ga0066652_100295958 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300006050|Ga0075028_100491356 | Not Available | 715 | Open in IMG/M |
| 3300006052|Ga0075029_100637209 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300006052|Ga0075029_100851057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300006052|Ga0075029_101156410 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006057|Ga0075026_100050993 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300006163|Ga0070715_10388213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 773 | Open in IMG/M |
| 3300006174|Ga0075014_100738793 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006175|Ga0070712_101618417 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006797|Ga0066659_11748787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300006893|Ga0073928_10004578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 20289 | Open in IMG/M |
| 3300006893|Ga0073928_10021692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 6568 | Open in IMG/M |
| 3300006893|Ga0073928_10897122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 608 | Open in IMG/M |
| 3300006903|Ga0075426_10004531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9861 | Open in IMG/M |
| 3300006903|Ga0075426_10686285 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300006904|Ga0075424_101616730 | Not Available | 687 | Open in IMG/M |
| 3300009038|Ga0099829_10545775 | Not Available | 963 | Open in IMG/M |
| 3300009038|Ga0099829_10756060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300009088|Ga0099830_10264323 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300009143|Ga0099792_11133058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300009176|Ga0105242_12598878 | Not Available | 555 | Open in IMG/M |
| 3300009520|Ga0116214_1121637 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300009523|Ga0116221_1330285 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300009547|Ga0116136_1004919 | All Organisms → cellular organisms → Bacteria | 5578 | Open in IMG/M |
| 3300009616|Ga0116111_1036994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1510 | Open in IMG/M |
| 3300009618|Ga0116127_1026491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1813 | Open in IMG/M |
| 3300009618|Ga0116127_1057271 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300009623|Ga0116133_1004162 | All Organisms → cellular organisms → Bacteria | 3729 | Open in IMG/M |
| 3300009672|Ga0116215_1094125 | Not Available | 1343 | Open in IMG/M |
| 3300009824|Ga0116219_10124860 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300009839|Ga0116223_10276744 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300009839|Ga0116223_10481562 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300010048|Ga0126373_10043528 | All Organisms → cellular organisms → Bacteria | 3961 | Open in IMG/M |
| 3300010048|Ga0126373_12840458 | Not Available | 540 | Open in IMG/M |
| 3300010341|Ga0074045_10927621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300010343|Ga0074044_10008476 | All Organisms → cellular organisms → Bacteria | 8008 | Open in IMG/M |
| 3300010343|Ga0074044_10056312 | All Organisms → cellular organisms → Bacteria | 2685 | Open in IMG/M |
| 3300010358|Ga0126370_10779090 | Not Available | 850 | Open in IMG/M |
| 3300010358|Ga0126370_11974611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 569 | Open in IMG/M |
| 3300010359|Ga0126376_11827828 | Not Available | 646 | Open in IMG/M |
| 3300010360|Ga0126372_12700642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300010361|Ga0126378_10010395 | All Organisms → cellular organisms → Bacteria | 7576 | Open in IMG/M |
| 3300010361|Ga0126378_10679972 | Not Available | 1141 | Open in IMG/M |
| 3300010366|Ga0126379_12580618 | Not Available | 606 | Open in IMG/M |
| 3300010366|Ga0126379_13746233 | Not Available | 509 | Open in IMG/M |
| 3300010371|Ga0134125_12339071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300010376|Ga0126381_104319308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300010379|Ga0136449_100308412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 2879 | Open in IMG/M |
| 3300010379|Ga0136449_100476305 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
| 3300010379|Ga0136449_100723707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1663 | Open in IMG/M |
| 3300010937|Ga0137776_1726019 | Not Available | 1291 | Open in IMG/M |
| 3300011269|Ga0137392_10389008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| 3300011269|Ga0137392_11478689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300011270|Ga0137391_10080742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2803 | Open in IMG/M |
| 3300011271|Ga0137393_11703417 | Not Available | 519 | Open in IMG/M |
| 3300012189|Ga0137388_10421256 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300012189|Ga0137388_10671473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300012189|Ga0137388_11140024 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300012189|Ga0137388_11821405 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012189|Ga0137388_11829904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 539 | Open in IMG/M |
| 3300012199|Ga0137383_11221279 | Not Available | 539 | Open in IMG/M |
| 3300012202|Ga0137363_10040897 | All Organisms → cellular organisms → Bacteria | 3266 | Open in IMG/M |
| 3300012202|Ga0137363_10895653 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300012202|Ga0137363_11602666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012202|Ga0137363_11671479 | Not Available | 529 | Open in IMG/M |
| 3300012207|Ga0137381_10210609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1685 | Open in IMG/M |
| 3300012209|Ga0137379_10597771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
| 3300012209|Ga0137379_10684894 | Not Available | 931 | Open in IMG/M |
| 3300012209|Ga0137379_11504488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300012211|Ga0137377_11631752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300012285|Ga0137370_10259973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300012359|Ga0137385_10975796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 699 | Open in IMG/M |
| 3300012361|Ga0137360_10162844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1779 | Open in IMG/M |
| 3300012361|Ga0137360_10586875 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300012362|Ga0137361_10023468 | All Organisms → cellular organisms → Bacteria | 4749 | Open in IMG/M |
| 3300012362|Ga0137361_10868199 | Not Available | 819 | Open in IMG/M |
| 3300012922|Ga0137394_10939070 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012922|Ga0137394_11298403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 590 | Open in IMG/M |
| 3300012923|Ga0137359_11299187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300012924|Ga0137413_11226452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300012924|Ga0137413_11393060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300012927|Ga0137416_10197452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1612 | Open in IMG/M |
| 3300012929|Ga0137404_10186662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1748 | Open in IMG/M |
| 3300012929|Ga0137404_11535963 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300012930|Ga0137407_10369186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1324 | Open in IMG/M |
| 3300012944|Ga0137410_10053864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2875 | Open in IMG/M |
| 3300012960|Ga0164301_10027023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2675 | Open in IMG/M |
| 3300012960|Ga0164301_11532435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300012971|Ga0126369_10165983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2094 | Open in IMG/M |
| 3300012975|Ga0134110_10505458 | Not Available | 550 | Open in IMG/M |
| 3300012987|Ga0164307_10329635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
| 3300013314|Ga0175859_1125863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 2618 | Open in IMG/M |
| 3300014489|Ga0182018_10062656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2243 | Open in IMG/M |
| 3300014655|Ga0181516_10428059 | Not Available | 677 | Open in IMG/M |
| 3300015053|Ga0137405_1118712 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300015053|Ga0137405_1431161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2454 | Open in IMG/M |
| 3300015054|Ga0137420_1052152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300015371|Ga0132258_12012873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1453 | Open in IMG/M |
| 3300016270|Ga0182036_11304439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300016319|Ga0182033_10190994 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300016341|Ga0182035_10976706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 750 | Open in IMG/M |
| 3300016371|Ga0182034_11266343 | Not Available | 643 | Open in IMG/M |
| 3300017823|Ga0187818_10138530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1058 | Open in IMG/M |
| 3300017925|Ga0187856_1298431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 555 | Open in IMG/M |
| 3300017927|Ga0187824_10007056 | All Organisms → cellular organisms → Bacteria | 3170 | Open in IMG/M |
| 3300017930|Ga0187825_10149352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300017931|Ga0187877_1030368 | All Organisms → cellular organisms → Bacteria | 2703 | Open in IMG/M |
| 3300017932|Ga0187814_10376062 | Not Available | 551 | Open in IMG/M |
| 3300017937|Ga0187809_10052662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1315 | Open in IMG/M |
| 3300017937|Ga0187809_10420081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300017946|Ga0187879_10192437 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300017955|Ga0187817_10369993 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300017959|Ga0187779_10635010 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300017972|Ga0187781_10096952 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300017972|Ga0187781_10553991 | Not Available | 827 | Open in IMG/M |
| 3300017972|Ga0187781_10607162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300017972|Ga0187781_10798486 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300017975|Ga0187782_10474002 | Not Available | 955 | Open in IMG/M |
| 3300017993|Ga0187823_10268740 | Not Available | 583 | Open in IMG/M |
| 3300017999|Ga0187767_10365125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 512 | Open in IMG/M |
| 3300018005|Ga0187878_1039810 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300018012|Ga0187810_10110961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1083 | Open in IMG/M |
| 3300018012|Ga0187810_10253114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 723 | Open in IMG/M |
| 3300018012|Ga0187810_10272480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 697 | Open in IMG/M |
| 3300018062|Ga0187784_10126685 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300018062|Ga0187784_10881486 | Not Available | 712 | Open in IMG/M |
| 3300018085|Ga0187772_10988374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300018086|Ga0187769_10928834 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300018088|Ga0187771_10786622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300018433|Ga0066667_10929340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300019887|Ga0193729_1063552 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300020021|Ga0193726_1233963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 754 | Open in IMG/M |
| 3300020581|Ga0210399_11506393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 522 | Open in IMG/M |
| 3300020582|Ga0210395_10295276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1219 | Open in IMG/M |
| 3300020582|Ga0210395_11093559 | Not Available | 589 | Open in IMG/M |
| 3300020583|Ga0210401_10802520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300021046|Ga0215015_10642695 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1233 | Open in IMG/M |
| 3300021168|Ga0210406_10827920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300021180|Ga0210396_11365694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300021181|Ga0210388_10207865 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300021181|Ga0210388_10411259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 1189 | Open in IMG/M |
| 3300021181|Ga0210388_11027308 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300021401|Ga0210393_10694262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300021402|Ga0210385_10179248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1531 | Open in IMG/M |
| 3300021402|Ga0210385_10191537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1483 | Open in IMG/M |
| 3300021403|Ga0210397_10609526 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300021420|Ga0210394_10222898 | Not Available | 1647 | Open in IMG/M |
| 3300021420|Ga0210394_10988016 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300021420|Ga0210394_11847038 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300021420|Ga0210394_11859141 | Not Available | 501 | Open in IMG/M |
| 3300021432|Ga0210384_10293633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1463 | Open in IMG/M |
| 3300021432|Ga0210384_11243609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300021433|Ga0210391_10597490 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300021559|Ga0210409_10843256 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300021560|Ga0126371_10074033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3323 | Open in IMG/M |
| 3300021560|Ga0126371_10402636 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300021560|Ga0126371_11328720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300022557|Ga0212123_10006226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 20057 | Open in IMG/M |
| 3300022557|Ga0212123_10065429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3177 | Open in IMG/M |
| 3300022726|Ga0242654_10378915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 538 | Open in IMG/M |
| 3300023030|Ga0224561_1001173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1970 | Open in IMG/M |
| 3300024055|Ga0247794_10296402 | Not Available | 543 | Open in IMG/M |
| 3300024227|Ga0228598_1055576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300024271|Ga0224564_1000829 | All Organisms → cellular organisms → Bacteria | 4551 | Open in IMG/M |
| 3300025432|Ga0208821_1009567 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300025439|Ga0208323_1001387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8982 | Open in IMG/M |
| 3300025505|Ga0207929_1073638 | Not Available | 645 | Open in IMG/M |
| 3300025627|Ga0208220_1138170 | Not Available | 629 | Open in IMG/M |
| 3300025898|Ga0207692_10222915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1119 | Open in IMG/M |
| 3300025905|Ga0207685_10055420 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300025906|Ga0207699_10042233 | All Organisms → cellular organisms → Bacteria | 2640 | Open in IMG/M |
| 3300025906|Ga0207699_10101754 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300025906|Ga0207699_10414233 | Not Available | 961 | Open in IMG/M |
| 3300025917|Ga0207660_10074512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2477 | Open in IMG/M |
| 3300025929|Ga0207664_11962490 | Not Available | 508 | Open in IMG/M |
| 3300025986|Ga0207658_10022470 | All Organisms → cellular organisms → Bacteria | 4392 | Open in IMG/M |
| 3300026304|Ga0209240_1110381 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 964 | Open in IMG/M |
| 3300026305|Ga0209688_1088593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300026456|Ga0255351_1039490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300026467|Ga0257154_1009001 | Not Available | 1349 | Open in IMG/M |
| 3300026497|Ga0257164_1062018 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300027050|Ga0209325_1032215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 627 | Open in IMG/M |
| 3300027074|Ga0208092_110549 | Not Available | 576 | Open in IMG/M |
| 3300027297|Ga0208241_1034006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 790 | Open in IMG/M |
| 3300027330|Ga0207777_1020624 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300027516|Ga0207761_1032494 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300027591|Ga0209733_1148812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300027641|Ga0208827_1027648 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
| 3300027643|Ga0209076_1154665 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027663|Ga0208990_1048439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1283 | Open in IMG/M |
| 3300027701|Ga0209447_10177335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 585 | Open in IMG/M |
| 3300027745|Ga0209908_10158154 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300027854|Ga0209517_10015464 | All Organisms → cellular organisms → Bacteria | 7672 | Open in IMG/M |
| 3300027862|Ga0209701_10031511 | All Organisms → cellular organisms → Bacteria | 3442 | Open in IMG/M |
| 3300027879|Ga0209169_10502131 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300027882|Ga0209590_10657808 | Not Available | 672 | Open in IMG/M |
| 3300027905|Ga0209415_10835232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 636 | Open in IMG/M |
| 3300027908|Ga0209006_10063399 | All Organisms → cellular organisms → Bacteria | 3302 | Open in IMG/M |
| 3300027911|Ga0209698_10230135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1487 | Open in IMG/M |
| 3300027986|Ga0209168_10149277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300028047|Ga0209526_10157089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1591 | Open in IMG/M |
| 3300028536|Ga0137415_10202852 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300028536|Ga0137415_10381651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1213 | Open in IMG/M |
| 3300028906|Ga0308309_10914816 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300029889|Ga0246001_1008817 | All Organisms → cellular organisms → Bacteria | 3721 | Open in IMG/M |
| 3300029939|Ga0311328_10295805 | Not Available | 1201 | Open in IMG/M |
| 3300030007|Ga0311338_11496214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 623 | Open in IMG/M |
| 3300030509|Ga0302183_10417222 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300030659|Ga0316363_10041513 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300030746|Ga0302312_10087435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1298 | Open in IMG/M |
| 3300031546|Ga0318538_10441999 | Not Available | 704 | Open in IMG/M |
| 3300031573|Ga0310915_10096946 | Not Available | 1986 | Open in IMG/M |
| 3300031708|Ga0310686_109071456 | All Organisms → cellular organisms → Bacteria | 6323 | Open in IMG/M |
| 3300031715|Ga0307476_10294177 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300031718|Ga0307474_10120192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1972 | Open in IMG/M |
| 3300031718|Ga0307474_10290523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
| 3300031720|Ga0307469_10253310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1418 | Open in IMG/M |
| 3300031720|Ga0307469_11605130 | Not Available | 625 | Open in IMG/M |
| 3300031736|Ga0318501_10567069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300031740|Ga0307468_100237577 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300031753|Ga0307477_10379898 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300031753|Ga0307477_10434371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300031753|Ga0307477_10539321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300031754|Ga0307475_10199963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1597 | Open in IMG/M |
| 3300031763|Ga0318537_10289905 | Not Available | 606 | Open in IMG/M |
| 3300031768|Ga0318509_10356229 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300031793|Ga0318548_10306419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 780 | Open in IMG/M |
| 3300031820|Ga0307473_10192373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 1204 | Open in IMG/M |
| 3300031823|Ga0307478_11153800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300031890|Ga0306925_10775025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300031910|Ga0306923_10151836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2644 | Open in IMG/M |
| 3300031910|Ga0306923_10964273 | Not Available | 929 | Open in IMG/M |
| 3300031942|Ga0310916_11055781 | Not Available | 676 | Open in IMG/M |
| 3300031946|Ga0310910_10554102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300031946|Ga0310910_11221745 | Not Available | 582 | Open in IMG/M |
| 3300031947|Ga0310909_10027153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4203 | Open in IMG/M |
| 3300031962|Ga0307479_10046790 | All Organisms → cellular organisms → Bacteria | 4157 | Open in IMG/M |
| 3300031962|Ga0307479_10158965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2218 | Open in IMG/M |
| 3300031962|Ga0307479_10191531 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300031962|Ga0307479_10700512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300031962|Ga0307479_11682833 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032001|Ga0306922_10715831 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300032001|Ga0306922_11185498 | Not Available | 778 | Open in IMG/M |
| 3300032064|Ga0318510_10215620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 780 | Open in IMG/M |
| 3300032160|Ga0311301_12332593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 607 | Open in IMG/M |
| 3300032174|Ga0307470_10253683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1164 | Open in IMG/M |
| 3300032174|Ga0307470_10526314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 868 | Open in IMG/M |
| 3300032180|Ga0307471_100014737 | All Organisms → cellular organisms → Bacteria | 5449 | Open in IMG/M |
| 3300032205|Ga0307472_100074934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2224 | Open in IMG/M |
| 3300032205|Ga0307472_102493499 | Not Available | 526 | Open in IMG/M |
| 3300033405|Ga0326727_10679348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 830 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.39% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.24% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.45% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.05% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.05% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.05% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.05% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.70% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.70% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.70% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.35% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.35% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.35% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.35% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.35% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.35% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.35% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.35% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.35% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.35% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.35% |
| Moss Associated | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Moss Associated | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013314 | Moss microbial communities from three moss species from boreal forest in Fairbanks, Alaska, USA Reanalysis | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026456 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2 | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027074 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_10609120 | 2170459023 | Grass Soil | MNRERALKVVLVFVGLLFLALVYPLMMFVRQEPPLAMMLS |
| INPhiseqgaiiFebDRAFT_1057381451 | 3300000364 | Soil | MQRNRALKVVLVVVGLIFCGLVYPLIMFTRQEPALAMTLSVYVTLGVFPAAGSP |
| JGI12270J11330_100057733 | 3300000567 | Peatlands Soil | MRRERALKVVLVLVGLLFTAMVYPLVLFVKQEPALAMMLSI* |
| JGI12270J11330_100626221 | 3300000567 | Peatlands Soil | MHRERALKVVLVLVGLLFTAMVYPLVLFVKQEPAFGDDA* |
| JGI12683J13190_10051213 | 3300001089 | Forest Soil | MLRERALKVVLVLVGLLFLAGIYPLTMFFRSEAAVAM |
| JGI12631J13338_10299622 | 3300001131 | Forest Soil | MKQERALKIVLVVVGLLFCAGVYPLVLMAKQDPALAMMMSL* |
| JGI12627J18819_100175052 | 3300001867 | Forest Soil | VRLRFVLVLVGLLFCAAVYPLVLMAKQDPALAMMMSLYATLGVFLLLAV* |
| JGI12627J18819_103884832 | 3300001867 | Forest Soil | MRRERALKIALVVVGLLFAAGLYPLILMAKQDPALAM |
| JGI25613J43889_100064185 | 3300002907 | Grasslands Soil | MIQERALKVVLVLVGLIFFAGVYPLTMFFGRDPALXIDX* |
| JGIcombinedJ51221_100892241 | 3300003505 | Forest Soil | MRRERALKIVLMLVGLLFTAMIYPLVLFVKEEPALAMMISLYVTL |
| Ga0070690_1005268731 | 3300005330 | Switchgrass Rhizosphere | MSRERVLKIVLLVVGVIFSGLIYPLTMFVRQEPALAMMLSLY |
| Ga0066388_1019551414 | 3300005332 | Tropical Forest Soil | MKRERALKIVLVLVGLLFCAAVYPLMLMAKQDPALAMMMSL |
| Ga0066388_1060404042 | 3300005332 | Tropical Forest Soil | MRRERALKILLVLLGLLFCAAVYPLLLMAKEDPALAMMMSLYATLGIFLL |
| Ga0070714_1017629992 | 3300005435 | Agricultural Soil | MKRERVLKVVLVVLGLLFCAAVYPLMLMAKQDPALAMMMSLYATLGV |
| Ga0070701_104736263 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRERVLKIVLLVVGVIFSGLIYPLTMFVRQEPALAMMLSLYVTL |
| Ga0070711_1006360382 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRDRALKVVLIVVGLIFCALIYPLIMFTRQEPALAMMLIVYVTLGI |
| Ga0066681_106702181 | 3300005451 | Soil | MRRERALKVVLVVVGLLFSAAVYPLTTMVKQDPALAMMMTLYATL |
| Ga0070697_1005846701 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRERALKVVLFLVGLLFLALIYPLTMFFSSEAALAMMLSLYVTLG |
| Ga0070731_102615981 | 3300005538 | Surface Soil | MRRELALKVVLVVVGLIFSALVYPLTMFIRQDPALAMMMSLYVTLG |
| Ga0066697_104204822 | 3300005540 | Soil | MRRERSLKVVLVVVGLIFCGLVYPLTMFVRQEPALAMMLSV |
| Ga0066694_102501032 | 3300005574 | Soil | MRRERALKIVLVLVGLLFTAGVYPLMMMVKQDPALAMMMS |
| Ga0066706_102986021 | 3300005598 | Soil | VNRVRALKVVLVLVGWFFTAGVYPITMFLRHADPADYGDAMMLSL |
| Ga0070762_111502342 | 3300005602 | Soil | MRRERALKIVLVVVGLLFAAGLYPLVLMAKQDPALAMMMSL |
| Ga0070763_100265434 | 3300005610 | Soil | MKQERALKIVLAVVGSLFCAAVYPLILMVKQDRALAMMMSLYATLGVFLLLNIAS* |
| Ga0070764_110505701 | 3300005712 | Soil | MKRERALKVVLVLVGLIFVAGVYPLILMAKQDPALAMMMS |
| Ga0066905_1004467013 | 3300005713 | Tropical Forest Soil | MRRERALRVVLVVVGLLFCAAVYPLLLMAKEDPAL |
| Ga0066903_1021159193 | 3300005764 | Tropical Forest Soil | MRRERALKVVLVLLGLLFCAAVYPLLLMAKEDPALAMMMS |
| Ga0066903_1045615572 | 3300005764 | Tropical Forest Soil | MRRERALRIVLVLLGLLFCAAVYPLLLMVKQDPALAMMM |
| Ga0066903_1068555393 | 3300005764 | Tropical Forest Soil | MRRERILKVVLVVVGLLFCAAVYPLMLMAKQTLLWR* |
| Ga0070717_112230223 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRERALKIVLVVVGVLFCAALYPLVLMVKQDPALAMMMS |
| Ga0070717_116387081 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRERALKVVLVVVGLIFCGLAYPLMMFVKQEPALAMMLSVYVTLG |
| Ga0066652_1002959581 | 3300006046 | Soil | MRRERSLKVVLVVVGLIFCGLVYPLTMFVRQEPALAMMLSVYVTLGIFL |
| Ga0075028_1004913561 | 3300006050 | Watersheds | MWRERTLKVVLVLVGLVFLTLVYPLALYLRQEPALAMMLS |
| Ga0075029_1006372091 | 3300006052 | Watersheds | MRRERALKVVLVVVGLVFVAGVYPLMMFVRQEPALAMMLSL |
| Ga0075029_1008510571 | 3300006052 | Watersheds | MNRERALKVVLVVEELFLALLYPLKIFVKQAHTLAMMDQH |
| Ga0075029_1011564101 | 3300006052 | Watersheds | MKRERVLKIVLVLVGLVFSALIYPMTMFVRQAPALAMML |
| Ga0075026_1000509933 | 3300006057 | Watersheds | MSRERSLKVVLVLVGLIFLLGVYPLMMFLDRECVNACGC* |
| Ga0070715_103882132 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRERALKVVLVVVGLLFSAGVYPLMMFVRQDPAL |
| Ga0075014_1007387932 | 3300006174 | Watersheds | MRRERALKGVLLLVGLLFTAMVYPLVLFLKQEPALAMMMSLY |
| Ga0070712_1016184173 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRERALKFVLVLVGLLFCAAIYPLMLMAKQDPALAMMMSLY |
| Ga0066659_117487872 | 3300006797 | Soil | MRGERAMKVVLVVVGLLFVAAVYPLLMFVRQEPALAMMLSLYV |
| Ga0073928_100045784 | 3300006893 | Iron-Sulfur Acid Spring | MWRERTLKVVLVVVGLVFCALAYPLIMFVKQDLRWR* |
| Ga0073928_100216921 | 3300006893 | Iron-Sulfur Acid Spring | MRRERALKVVLVVVGLVFCALAYPLIMFVKQEPALAMQFSVYVTLGIFLLF |
| Ga0073928_108971221 | 3300006893 | Iron-Sulfur Acid Spring | MLRKRVLKVVLVLVGVIFTALAYPMIMFVKQAPALAMSFSVYV |
| Ga0075426_1000453120 | 3300006903 | Populus Rhizosphere | MNRARVLQVVLVISGLLFTAAAYPLVLFWRQQPSLAMML |
| Ga0075426_106862851 | 3300006903 | Populus Rhizosphere | MNRARVLQVLLVMSGLLFTAAAYPLVLFWRQQPSLAMMLSLYVPLGI |
| Ga0075424_1016167301 | 3300006904 | Populus Rhizosphere | MRRERTLKVVLVVVGLIFCGLVYPLTMFVRQEPALAMMLSVYVTLG |
| Ga0099829_105457751 | 3300009038 | Vadose Zone Soil | MIRERALKAVLILVGLLFSAGVYPLTMFLSREPALAMM |
| Ga0099829_107560601 | 3300009038 | Vadose Zone Soil | MVRERILKVVLVLLGLLFLAAAYPLVLFYAQEPALAMMLSLY |
| Ga0099830_102643233 | 3300009088 | Vadose Zone Soil | MRGERALKVVLVVVGLLFVAAVYPLLMFVMQQPAFAMMLVLYVT |
| Ga0099792_111330581 | 3300009143 | Vadose Zone Soil | VLKIVLFVVGLIFSCLVYPLTMFVRQEPALAMMLSVYVTLGIFLLF |
| Ga0105242_125988782 | 3300009176 | Miscanthus Rhizosphere | MLRERILKGLLIVVGLLFTAGIYPLFVFFSREPALAMMLSLYVTLG |
| Ga0116214_11216371 | 3300009520 | Peatlands Soil | MKRDRALKIVLVVVGLLFCAAVYPLILMVKQDPALAMM |
| Ga0116221_13302851 | 3300009523 | Peatlands Soil | MMHRERALKIVLMLVGLLFTAMIYPLVLFVKQEPALAMMMSLYVTLGIFL |
| Ga0116136_10049196 | 3300009547 | Peatland | MMRRERALKVVLVVVGLLFCGLVYPLVLFVKQEPALAMM |
| Ga0116111_10369943 | 3300009616 | Peatland | MRRKRALKVVLVVVGLLFCAAVYPLILMVKQDPALAMMMSLY |
| Ga0116127_10264913 | 3300009618 | Peatland | MKRERLLKVVLVVVGLLFCAGVYPLVLMAKQDPALR* |
| Ga0116127_10572713 | 3300009618 | Peatland | MMRRERALKVVLVVVGLLFCGLVYPLVLFVKQEPALAMMMSLY |
| Ga0116133_10041626 | 3300009623 | Peatland | MRRERALKVVLVLVGLLFAATVYPMVLFVKQEPALAMM |
| Ga0116215_10941251 | 3300009672 | Peatlands Soil | MNRDRALKVVLAVVGLLFSALVYPLVLFVRQDPPLSMM |
| Ga0116219_101248602 | 3300009824 | Peatlands Soil | MMHRERALKVVLVLVGLLFTAMVYPLVLFVKQEPAFGDDA* |
| Ga0116223_102767441 | 3300009839 | Peatlands Soil | MRRERALKIVLVVVGLLFSALIYPLMMFVRQEPALAMM |
| Ga0116223_104815621 | 3300009839 | Peatlands Soil | MSRERVLKVVLVVVGLLFTAMVYPLVLFVKQEPALAMM |
| Ga0126373_100435281 | 3300010048 | Tropical Forest Soil | MRRRALKIALVLVGLLFCAAVYPLILSMKQDPALAMMMSLYAT |
| Ga0126373_128404581 | 3300010048 | Tropical Forest Soil | MRRERALKIVLLLVGLLFCAAVYPLIMMVKQDPALAMML |
| Ga0074045_109276211 | 3300010341 | Bog Forest Soil | MLRKQALKVVLVFVGVIFTALIYPMIMFLKQEPALAMM |
| Ga0074044_100084766 | 3300010343 | Bog Forest Soil | MKRELALKVLLVVVGLVFVAGVYPLILMARQCKPWFV* |
| Ga0074044_100563121 | 3300010343 | Bog Forest Soil | MAAMRRERALKVVLVLVGLLFTALVYPLVLFVKQEP |
| Ga0126370_107790901 | 3300010358 | Tropical Forest Soil | VLQVVPVVEGLLFSAAVYPLILMVKQDPALAMRMSLYVTLGIFLLLA |
| Ga0126370_119746111 | 3300010358 | Tropical Forest Soil | MGRERALKIVLVLVGLLFMAGVYPLVVFAKQEPALAMMLSLYVTL |
| Ga0126376_118278281 | 3300010359 | Tropical Forest Soil | MGRERALKIVLVLVGLLFMAGVYPLVVFAKQEPALAMMLSLYVT |
| Ga0126372_127006421 | 3300010360 | Tropical Forest Soil | MRRERALRVVLVVVGLLFCAAVYPLLLMAKEVPALAMM |
| Ga0126378_100103951 | 3300010361 | Tropical Forest Soil | MSRERALKVVLVVLGLLFCAAVYPLLLMVKEDPALAMMMSLYATLGI |
| Ga0126378_106799722 | 3300010361 | Tropical Forest Soil | MRRERALKVVLVLVGLLFCAAIYPLVLMAKQDPALAMMMSLY |
| Ga0126379_125806181 | 3300010366 | Tropical Forest Soil | VRRERVLKVVLVLVGLLFCAGIYPLMLMVKQDPAL |
| Ga0126379_137462331 | 3300010366 | Tropical Forest Soil | MRRRALKIALVLVGLLFCAAVYPLILMMKQDPALAMMMSLYAT |
| Ga0134125_123390711 | 3300010371 | Terrestrial Soil | MSRERVLKVVLVLVGLLFCAATYPLMLLAKQEPALAM |
| Ga0126381_1043193082 | 3300010376 | Tropical Forest Soil | MRRARALKVVLLLLGLLFCAGVYPLVLMAKEEPALAMMMSLYVTL |
| Ga0136449_1003084122 | 3300010379 | Peatlands Soil | MRRERALKVVLVVVGLLFTAMVYPLVLFVKQEPALAMMMSLYATLR |
| Ga0136449_1004763052 | 3300010379 | Peatlands Soil | MKRERLLKVVLVAVGLLFCAGVYPLVLMAKQDPALR* |
| Ga0136449_1007237074 | 3300010379 | Peatlands Soil | MMHRERALKVVLVLVGLLFTAMVYPLVLFVKQEPALAMMLSL |
| Ga0137776_17260191 | 3300010937 | Sediment | MQRERALKVVLVVVGLIFCGLVYPMMMFVRQEPALAMMLSVY |
| Ga0137392_103890081 | 3300011269 | Vadose Zone Soil | MVRERILKVVLVLLGLLFLAAAYPLVLFYAQEPALAMMLSLYFTLGI |
| Ga0137392_114786891 | 3300011269 | Vadose Zone Soil | MIQERALKVVLVLVGLIFLAGVYPLTMFWGRDPALA |
| Ga0137391_100807426 | 3300011270 | Vadose Zone Soil | MIRERALKAVLVLLGLLFSAGVYPLTMFLSREPALAMMLSLYV |
| Ga0137393_117034171 | 3300011271 | Vadose Zone Soil | MRGERALKVVLVVVGLLFVAAVYPILMFLWQPHPADAALPMMLSLY |
| Ga0137388_104212561 | 3300012189 | Vadose Zone Soil | MRRERALKIVLVLVGLVFSALVYPLMMFVKQEPALAMMLSVY |
| Ga0137388_106714731 | 3300012189 | Vadose Zone Soil | MNRKRALKVVLVVVGLIFCGLVYPLTVFVRQEPALAM |
| Ga0137388_111400242 | 3300012189 | Vadose Zone Soil | MRGERALKVVLVAVGLFFVAAVYPLLMFVRQEPALAMMLSVYA |
| Ga0137388_118214051 | 3300012189 | Vadose Zone Soil | MSRERALKVVLVVVGLIFCGLVYPLTMFVRQEPALAMMLS |
| Ga0137388_118299041 | 3300012189 | Vadose Zone Soil | MWQERALKVVLVLVGLVFLALVYPLVIFLRQEPALAMMLSVYATLGIFLVL |
| Ga0137383_112212791 | 3300012199 | Vadose Zone Soil | MVRERMLKVVLVLLGLLFLAAAYPLVLFYAQEPALAMMLSLYFTLGI |
| Ga0137363_100408971 | 3300012202 | Vadose Zone Soil | VIRERALKAVLILVGLLFSAGVYPLTMFLSREPALAMMLSL |
| Ga0137363_108956531 | 3300012202 | Vadose Zone Soil | MRGERALKVVLVVVGLLFVATVYPLLLFVKQEPALAMML |
| Ga0137363_116026662 | 3300012202 | Vadose Zone Soil | MRGERALKVVLVVVGLLFVATVYPLLLFVKQEPALAMMLSLYVTL |
| Ga0137363_116714791 | 3300012202 | Vadose Zone Soil | MIQERALKAVLVLVGLIFLAGVYPLTMFFGRDPALAMML |
| Ga0137381_102106091 | 3300012207 | Vadose Zone Soil | MKRERVLKVVLVVLGLLFCAAVYPLMLMAKQDPALAMMMS |
| Ga0137379_105977712 | 3300012209 | Vadose Zone Soil | MRRERALKVVLVLVGLLFSAAVYPLMMMVKQDPALAMMMSLYA |
| Ga0137379_106848942 | 3300012209 | Vadose Zone Soil | MGRERVLKVVLVLVGLVFSAAVYPLIMFLSREPALAMML |
| Ga0137379_115044881 | 3300012209 | Vadose Zone Soil | MRRERALKVALVLVGLLFSAAIYPLVMFVKQEPALAMMLSL |
| Ga0137377_116317521 | 3300012211 | Vadose Zone Soil | MRGERAMKVVLVVVGLLFVAVVYPLLMFVRQEPALAMMLSLYVTLGIF |
| Ga0137370_102599731 | 3300012285 | Vadose Zone Soil | MRGERAMKVVLVVVGLLFVAAVYPLLMFVRQEPALAMMLS |
| Ga0137385_109757961 | 3300012359 | Vadose Zone Soil | MVRERMLKVVLVLLGLLFLAAAYPLVLFYAQEPALAMMLSLYFTLGIFLL |
| Ga0137360_101628442 | 3300012361 | Vadose Zone Soil | LGIQPEATVIRERALKVVLVLVGLLFTAAIYPLTIFFSREPALAMMLSL |
| Ga0137360_105868751 | 3300012361 | Vadose Zone Soil | MRGERALKVVLVVVGLLFVAGVYPLLMFVRQEPALAMM |
| Ga0137361_100234681 | 3300012362 | Vadose Zone Soil | MRRERALKVVLVVVGVIFCGLAYPLMMFVKQEPALAMM |
| Ga0137361_108681992 | 3300012362 | Vadose Zone Soil | MVRERMLKVVLVLLGLLFLAAAYPLVLFYAQEPALAMMLSLYFTLG |
| Ga0137394_109390702 | 3300012922 | Vadose Zone Soil | MHGERALKVVLVVVGLLFVAGVYPLLMFVRQEPALAMMLSLYV |
| Ga0137394_112984032 | 3300012922 | Vadose Zone Soil | MRGERALKVVLVVVGLLFVAGVYPLLMFVRQEPALAMMLSLYVTL |
| Ga0137359_112991872 | 3300012923 | Vadose Zone Soil | MNRERTLKVVLVVVGLIFFGLLYPLTMFVRQEPALAMMLSLYVTLG |
| Ga0137413_112264521 | 3300012924 | Vadose Zone Soil | MVRERIVKVVLVLLGLLFLAAAYPLVLFYAQEPALAMML |
| Ga0137413_113930602 | 3300012924 | Vadose Zone Soil | MNRERILKIVQMLVGLLFTAMIYPLMMFVWQERALAMMLSV |
| Ga0137416_101974521 | 3300012927 | Vadose Zone Soil | MRRERALKVVLVVVGLIFCGLVYPLTVFGRQEPALAMMLSVY |
| Ga0137404_101866623 | 3300012929 | Vadose Zone Soil | MRGERALKVVLVVVGLLFVAGVYPLLMFVRQEPALAMMLS |
| Ga0137404_115359631 | 3300012929 | Vadose Zone Soil | VVEQEGTMIRERALKVVLVLVGLLFLAGIYPLTMFFRSEAAVAMMLSLYVT |
| Ga0137407_103691862 | 3300012930 | Vadose Zone Soil | MSRERALKVVLVVVGLIFFGLVYPLTMFVRQEPALAMMLSLYVT |
| Ga0137410_100538643 | 3300012944 | Vadose Zone Soil | VRRERALKIVLASVGLLFSALVYPLMMFVRQAPALAM |
| Ga0164301_100270231 | 3300012960 | Soil | MVRQKALKIVLVMVGLSCLAGLYPLVLFAQKGPALAMM |
| Ga0164301_115324352 | 3300012960 | Soil | MIRERTLKVVLVVVGLLFSAGVYPFIMFVRQEPALAMMLSLYV |
| Ga0126369_101659831 | 3300012971 | Tropical Forest Soil | MRREPALKVVLVVVGLIFCGLVYPLMVFWRQDPALAMMLS |
| Ga0134110_105054581 | 3300012975 | Grasslands Soil | MRRERSLKVVLVVVGLIFCGLVYPLTMFVRQEPALAMMLSVYVTL |
| Ga0164307_103296351 | 3300012987 | Soil | MVRQKALKIVLVMVGLIFLAGLYPLVLFAQKEPAL |
| Ga0175859_11258634 | 3300013314 | Moss Associated | LALKITVVLVGLFFALAYPVVMFIRQERALFMMLSVYV |
| Ga0181531_101747571 | 3300014169 | Bog | MHRERALKVVLVVVGLIFCVLAYPLVLFVKQEPALAMMLSVYARYFLAAGSP* |
| Ga0182018_100626562 | 3300014489 | Palsa | MNRERALKVVLVVVGLIFCGLAFPLMMFVKQEPALG* |
| Ga0181516_104280591 | 3300014655 | Bog | VNRKRALKVVLVVVGMLFSALDYPMISFVRQEPAL |
| Ga0137405_11187122 | 3300015053 | Vadose Zone Soil | MRGERALKVVLVVVGLLFVAAVYPLLMFVKQEPALAMMLSLYVT |
| Ga0137405_14311612 | 3300015053 | Vadose Zone Soil | MRGEQALKVVLVVVGSLFVATVYPLLLFVKQAPALAMMLAFM* |
| Ga0137420_10521522 | 3300015054 | Vadose Zone Soil | MRRERALKIVLVLVGLLFSALVYPLMMFVRQEPALAM |
| Ga0132258_120128731 | 3300015371 | Arabidopsis Rhizosphere | MRRDRALKVVLVVVGLIFCALLYPLIMLTRQEPALAMMLSVYVTLGIF |
| Ga0182036_113044391 | 3300016270 | Soil | MRRERALKLVLVVLGLLFCAGVYPLVLMAKEEPALA |
| Ga0182033_101909944 | 3300016319 | Soil | MKRERILKVVLVVVGLLFCAAVYPLLLMVKEEPAL |
| Ga0182035_109767061 | 3300016341 | Soil | MRRDRALKVVLVVLGLLFCAGVYPLVLRAKEEPALAMMMS |
| Ga0182034_112663432 | 3300016371 | Soil | MGRERILKVVLVLVGLLFCAGLYPLLLMVKQDPALAMM |
| Ga0187818_101385301 | 3300017823 | Freshwater Sediment | MRRERALKVVLVVVGLLFTAMVYPLVLFVKQEPALAMMM |
| Ga0187856_12984311 | 3300017925 | Peatland | MKRERVLKVVVVIVGLLFCAAVYPLILMVKQDPALAMMMSL |
| Ga0187824_100070561 | 3300017927 | Freshwater Sediment | MWRERALKVVLVLVGLLFLAGLYPLTVFFRQDAALGMML |
| Ga0187825_101493523 | 3300017930 | Freshwater Sediment | MNRERALKIVLGLVGLLFSAAVYPLILVFQRDPALAMMLSVYATLGI |
| Ga0187877_10303681 | 3300017931 | Peatland | MRRERALKVVLVLVGLLFAATVYPMVLFVKQEPALAMMMSL |
| Ga0187814_103760621 | 3300017932 | Freshwater Sediment | MHRARALKALLVIVGLLFVAGVYPLLVFVRQEPALAM |
| Ga0187809_100526622 | 3300017937 | Freshwater Sediment | MKRERALKVVLVVVGLLFAATVYPMVLFVKQEPALAMMMSFMSRSAFS |
| Ga0187809_104200812 | 3300017937 | Freshwater Sediment | MRRERALKVVLVVVGLVFCALAYPLIMFVKQAPALA |
| Ga0187879_101924373 | 3300017946 | Peatland | MKQERALKIVLVVVGLLFCAGVYPLVLMAKQDPALAMMMSL |
| Ga0187817_103699933 | 3300017955 | Freshwater Sediment | MWRERTLKVVLVLVGLLFLALVYPLMMFVRQAPTLAMMLS |
| Ga0187779_106350101 | 3300017959 | Tropical Peatland | MRREQVRKVVLALVGLLFSALVYPLMMSVRQEPALAMMLSL |
| Ga0187781_100969524 | 3300017972 | Tropical Peatland | MRRERALKIVLVVLGLLFCAGVYPLVLKAKEEPALAMMMSL |
| Ga0187781_105539911 | 3300017972 | Tropical Peatland | MRRERVLKVVLVVLGLLFCAGVYPLVLKAKEEPALAMMMSLY |
| Ga0187781_106071622 | 3300017972 | Tropical Peatland | MHRERMLKAVLLLVGLLFTAMLYPLVLFVKQEPALAMMMSLYVTL |
| Ga0187781_107984862 | 3300017972 | Tropical Peatland | MHRERVLKLVLRLVGLLFVAMIYPLLLFVNQGPALAMMLSLYVTLG |
| Ga0187782_104740021 | 3300017975 | Tropical Peatland | MRRERVLKVVLVVVGLFFCAGVFPLVLMAKEEPALAYAVTIHK |
| Ga0187823_102687401 | 3300017993 | Freshwater Sediment | MKRERALKIVLALVGLLFCAAVYPLVLMAKQDPALAMMMSLYTTLGVFLLVAS |
| Ga0187767_103651251 | 3300017999 | Tropical Peatland | VLKVVLVVLGLLSCAGVYPLVLMAKQEPALAMRMILYVTLAIFLLL |
| Ga0187878_10398101 | 3300018005 | Peatland | MRRERALKVVLVLVGLLFAATVYPMVLFVKQEPALAMMMS |
| Ga0187810_101109611 | 3300018012 | Freshwater Sediment | MKRERALKVVLVLVGLLFSTLLYPLMIFLRQEPALAMMMSL |
| Ga0187810_102531141 | 3300018012 | Freshwater Sediment | MRRERALKVVLIVVGLLFVATIYPLVLFVKQEPALAMMMSLYAT |
| Ga0187810_102724802 | 3300018012 | Freshwater Sediment | MHRERALKVVLVVVGLLFAATVFPMVLFVKQEPALAMMMSFMSRSAFS |
| Ga0187765_100049132 | 3300018060 | Tropical Peatland | MSREQELRIVLGLVGLIFAAAVYPLILMAGQDPVLAMMMSLYGTLSVFLLLGSRPPRTAA |
| Ga0187784_101266851 | 3300018062 | Tropical Peatland | MIRERALKVVLVVVGLVFCAGIYPLAIFWRQEPALAMM |
| Ga0187784_108814861 | 3300018062 | Tropical Peatland | MRRERALKIVLVVVGLLFCAAVYPLVLMVKQDPAL |
| Ga0187772_109883741 | 3300018085 | Tropical Peatland | MRRERALKIVLVVLGLLFCAGVYPLVLKAKEEPALAM |
| Ga0187769_109288342 | 3300018086 | Tropical Peatland | MLRERALKVVLVVVGLLFIAMVYPLAMFVKQEPALAMMLSLY |
| Ga0187771_107866221 | 3300018088 | Tropical Peatland | MKRERALKVVLVLVGLIFSAAICPLTFFLRQDPALAMMMSLNYS |
| Ga0066667_109293402 | 3300018433 | Grasslands Soil | MRGERPMKVVLVVVGLLFVAAVYPLLMFVRQEPALAMMLSLYV |
| Ga0193729_10635521 | 3300019887 | Soil | VRRERALRVVLIVVGLIFCGLAYPLMMFVKQEPALAMMLSVHVT |
| Ga0193726_12339632 | 3300020021 | Soil | MHQELALKVVLVLWGLWFSAGVYPLMVFGKQDPALAKTRRWR |
| Ga0210399_115063932 | 3300020581 | Soil | MNRERALKIVLVVVGLLFTAMVYPSVLFLKQEPALAMMMILYATLGIFLI |
| Ga0210395_102952761 | 3300020582 | Soil | MRRELALKVVLVLVGLIFSALVYPLTMFFRQEPALAMMLSVYVT |
| Ga0210395_110935592 | 3300020582 | Soil | MRRERALKIVLVVVGLLFAAGLYPLVLMAKQDPALAMMMSLY |
| Ga0210401_108025202 | 3300020583 | Soil | MRRERALKVVLVVVGLIFTALVYPLTMFMRQDPALAMMMSLYVTL |
| Ga0215015_106426951 | 3300021046 | Soil | MNRERALKVVLVVVGLLFSAAVIPLMMMAKQDPALAMMMSLYVT |
| Ga0210406_108279201 | 3300021168 | Soil | MTREKALRIVLVLAGLVFTALVYPLMLFVRQDPALAMM |
| Ga0210396_113656941 | 3300021180 | Soil | MWRERTLKIVLVLVGLLFCAAVYPLMMMVKQDPAL |
| Ga0210388_102078654 | 3300021181 | Soil | MKQERALKIVLAVVGSLFCAAVYPLILMVKQDRALAMMMSLYATLGVFLLLNIAS |
| Ga0210388_104112591 | 3300021181 | Soil | MRGERALKVVLVVVGLLFVAAVYPLLLFVRQEPALAMMLCLYVML |
| Ga0210388_110273082 | 3300021181 | Soil | MLRKRVLKAVLVLIGVIFTALIYPMTVFFKQEPALAMMLSVYVTLGIFLLM |
| Ga0210393_106942622 | 3300021401 | Soil | MQRKQVLRGVLVLVGLIFTALVYPMVIFVRQEPALAMMLSVYATLGIFL |
| Ga0210385_101792481 | 3300021402 | Soil | MNRERALKIVLVVVGLIFSALLYPLTIFMRQAPALAMMLSL |
| Ga0210385_101915371 | 3300021402 | Soil | MQRKQVLRGVLVLVGLIFTALVYPMVIFVRQEPALAMMLSVYATLG |
| Ga0210397_106095262 | 3300021403 | Soil | MSRERALKVVLVVVGVIFLALVYPLTMFVRQEPALAMMFSL |
| Ga0210394_102228981 | 3300021420 | Soil | MRRERALKIVLMVVGLLFAAGLYPLVLMAKQDPALAMMMSLYV |
| Ga0210394_109880162 | 3300021420 | Soil | MSRERALKVVLVVVGLLFCAAVYPLILMVKQDPALAMMMSLYATLGI |
| Ga0210394_118470382 | 3300021420 | Soil | MSRERALKVVLVVVGLIFLALVYPLTMFVRQEPALAM |
| Ga0210394_118591411 | 3300021420 | Soil | MIRERALKVVLVLVGLLFVALVYPLKLFLAQDPSMAMMFSV |
| Ga0210384_102936332 | 3300021432 | Soil | MWRARALRIVLVIVGLLFSAAVYPLAMFFRQEPSLAMMFSLYVTLGLFLL |
| Ga0210384_112436092 | 3300021432 | Soil | MWRERAQKVVLVVVGLLFSALVYPLMMFVRQEPALAMMLRDR |
| Ga0210391_105974902 | 3300021433 | Soil | MKQERALKIVLAVVGSLFCAAVYPLILMVKQDRALAMMMSLYATLGVFLLLN |
| Ga0210409_108432561 | 3300021559 | Soil | MSRERALKVVLVVVGVIFLALVYPLTMFVRQEPALAM |
| Ga0126371_100740336 | 3300021560 | Tropical Forest Soil | MRRERALKVVLVVLGLLFCAGVYPLVLMAKEEPALAMMMSLYV |
| Ga0126371_104026362 | 3300021560 | Tropical Forest Soil | MRRERALKIALVLVGLLFCAAVYPLILMMKQDPALAM |
| Ga0126371_113287201 | 3300021560 | Tropical Forest Soil | MRRERILKVVLVVVGLLFCAAVYPLMLMAKQDPALA |
| Ga0212123_100062263 | 3300022557 | Iron-Sulfur Acid Spring | MWRERTLKVVLVVVGLVFCALAYPLIMFVKQDLRWR |
| Ga0212123_100654291 | 3300022557 | Iron-Sulfur Acid Spring | MRRELALKVVLVLVGLIFSGLVYPLTMFFRQEPALAMMLSVYVSLGLFLLL |
| Ga0242654_103789151 | 3300022726 | Soil | VSRERVLKVVLIVVGLIFSALVYPLTIFVRQEPALAMMLSLYVTLGIFFAAGIP |
| Ga0224561_10011733 | 3300023030 | Soil | MNQERALKIVLVVVGLLFTAMVYPSVLFVKQESALAMMMMSLYAT |
| Ga0247794_102964022 | 3300024055 | Soil | MSRERVLKIVLLVVGVIFSGLIYPLTMFVRQEPAL |
| Ga0228598_10555762 | 3300024227 | Rhizosphere | MRRERALKVVLFVVGLIFSALVYPLTMFMRQDPALAMMMSL |
| Ga0224564_10008296 | 3300024271 | Soil | MNQERALKIVLVVVGLLFTAMVYPSVLFVKQESALAMMMSLYATLGI |
| Ga0208821_10095671 | 3300025432 | Peatland | MRRERALKVVLVVVGLLFCGLVYPLVLFVKQEPALAMM |
| Ga0208323_10013872 | 3300025439 | Peatland | MKRERLLKVVLVAVGLLFCAGVYPLVLMAKQDPALR |
| Ga0207929_10736381 | 3300025505 | Arctic Peat Soil | MHRKRALKAVLVLVGVIFTALVYPMIMFVRQEPALAMMFS |
| Ga0208220_11381702 | 3300025627 | Arctic Peat Soil | MRERVLKVVLVLVGLVFTAAIYPLTMFLSREPALA |
| Ga0207692_102229152 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRDRALKVILTVVGLIFCALVYPMIMFTRQEPALAMMLSVYVTLGVFLLFA |
| Ga0207685_100554203 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRERALKVVLVVVGVIFCALAYPLIMFVKQEPALAMQFS |
| Ga0207699_100422334 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRNRALKVVLVVVGLIFCALIFPLIMFTRQEPALAMMLSVYVTLGIFL |
| Ga0207699_101017542 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRERVLKVVLVVVGLIFCALAYPLTVFGRQEPALAMML |
| Ga0207699_104142331 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRERALKVVLVVVGLIFCGLVYPLTMFVRQEPALAM |
| Ga0207660_100745121 | 3300025917 | Corn Rhizosphere | MSRERVLKIVLLVVGVIFSGLIYPLTMFVRQEPALAMMLSL |
| Ga0207664_119624901 | 3300025929 | Agricultural Soil | MHRNRALKVVLVVVGLIFCALIFPLIMFTRQEPALAMMLSVYVTHRGG |
| Ga0207658_100224707 | 3300025986 | Switchgrass Rhizosphere | MSRERVLKIVLLVVGVIFSGLIYPLTMFVRQEPALAMM |
| Ga0209240_11103812 | 3300026304 | Grasslands Soil | MIQERALKVVLVLVGLIFFAGVYPLTMFFGRDPALAMMLSL |
| Ga0209688_10885931 | 3300026305 | Soil | MWRERALRIVLVFVGLLFSALVYPLTMFFRRDPALAMM |
| Ga0255351_10394901 | 3300026456 | Soil | VNRERALKVVLVVVGLLFSALVYPMISFVRQEPALAMMLSVY |
| Ga0257154_10090013 | 3300026467 | Soil | MTRERTLKTVLIVVGLLFTAMIYPLMLFMKQEPALSMMMSLYVT |
| Ga0257164_10620181 | 3300026497 | Soil | MRGERALKVVLVVVGLLFVAAVYPLLMFVRQEPALAMMLSL |
| Ga0209325_10322152 | 3300027050 | Forest Soil | MNRERALKVVLVVVGVIFCALAYPLMMFVKQEPALAMMLSV |
| Ga0208092_1105493 | 3300027074 | Forest Soil | MRREGALKVVLVVVGLIFCGLVYPLTVFGRQDPAVA |
| Ga0208241_10340061 | 3300027297 | Forest Soil | MNRERALKIVLVVVGLLFTALVYPLVLFVKQEPALAM |
| Ga0207777_10206241 | 3300027330 | Tropical Forest Soil | MKREQLLKVLLVLVGLLFSALLYPCILFFRQEPAL |
| Ga0207761_10324943 | 3300027516 | Tropical Forest Soil | MRRERALKIVLVLVGLLFSALVYPLMLFAKQEPSL |
| Ga0209733_11488122 | 3300027591 | Forest Soil | MKRERALKIVLVVVGVLFCAALYPLVLMVKQDPALA |
| Ga0208827_10276482 | 3300027641 | Peatlands Soil | MWRERALKVVLVLVGLLFTAMVYPLVLFVKQEPALAMMLSI |
| Ga0209076_11546651 | 3300027643 | Vadose Zone Soil | MIQERALKVVLVLVGLIFLAGVYPLAMFFGRDPALAMMLSLY |
| Ga0208990_10484393 | 3300027663 | Forest Soil | MRRERALKIVLVLVGLLFLALVYPLIMFVRQEPALAM |
| Ga0209447_101773352 | 3300027701 | Bog Forest Soil | MRRERAPKVGQVSLGLLFSSGVCPLTVFVKQDPAL |
| Ga0209908_101581541 | 3300027745 | Thawing Permafrost | MWRERTLKIVLVLLGLLFTAMIYPLVLFVKQEPALR |
| Ga0209517_1001546413 | 3300027854 | Peatlands Soil | MRRERALKVVLVLVGLLFTAMVYPLVLFVKQEPALAMMLSI |
| Ga0209701_100315111 | 3300027862 | Vadose Zone Soil | MSRERALKVVLVVVGLIFIGLVYPLTMLVRQEPALAMM |
| Ga0209169_105021312 | 3300027879 | Soil | MKQERALKIVLAVVGLLFCAAVYQLILMVKQDPALAMMMSL |
| Ga0209590_106578081 | 3300027882 | Vadose Zone Soil | MSRERALKVVLVVVGLIFFGLVYPLTMFVRQEPALAM |
| Ga0209415_108352321 | 3300027905 | Peatlands Soil | MHRERALKVVLVLVGLLFTAMVYPLVLFVKQEPAFGD |
| Ga0209006_100633997 | 3300027908 | Forest Soil | MRRERALKVVLVVVGLVFCALAYPLIMFVKQEPALAMQFSVYVTLGIFLL |
| Ga0209698_102301351 | 3300027911 | Watersheds | MRRERVLKIVLVVLGLLFCAAVYPLMLMAKQDPALAMMMS |
| Ga0209168_101492772 | 3300027986 | Surface Soil | MNRERALKIVLGLVGLLFSAAVYPLILVFQRDPALAMML |
| Ga0209526_101570892 | 3300028047 | Forest Soil | MRRERALKIVLVLVGLLFLALVYPLIMFVRQEPAL |
| Ga0137415_102028523 | 3300028536 | Vadose Zone Soil | MSRERALKVVLVVVGLIFFGLVYPLTMFVRQEPAL |
| Ga0137415_103816512 | 3300028536 | Vadose Zone Soil | MTRERALKGVLVAVGLLFTAAIYPLTMFFRAEAALAMM |
| Ga0308309_109148161 | 3300028906 | Soil | MKQERALKIVLAVVGSLFCAAVYPLILMVKQDRAL |
| Ga0246001_10088171 | 3300029889 | Peat | MRRERALKVVLVLVGLLFAATVYPMVLFVKQEPALAMMMSLY |
| Ga0311328_102958051 | 3300029939 | Bog | VIRERALKVVLVLVGLIFSALVYPMIIFARQEPALAMML |
| Ga0311338_114962141 | 3300030007 | Palsa | MLKIVLGLTGLIFSALAIPMMMFMQQEPALAMMLSLYATL |
| Ga0302183_104172222 | 3300030509 | Palsa | MRRERALKVVLILAGLLFTAAVYPMLLFVKQEPALAM |
| Ga0316363_100415134 | 3300030659 | Peatlands Soil | MHRERALKVVLVLVGLLFTAMVYPLVLFVKQEPAFGDDA |
| Ga0302312_100874352 | 3300030746 | Palsa | MGRERALKIVLVLVGLLFAALVYPMLVFVKLESALAMMMCLYATLGVFL |
| Ga0318538_104419991 | 3300031546 | Soil | MRRERALKIALVLVGLVFCAAVYPLILMMKQDPALAM |
| Ga0310915_100969464 | 3300031573 | Soil | MKRERMLKVVLVLVGLLFLALVYPLVTFVRQEPALAMML |
| Ga0310686_1090714566 | 3300031708 | Soil | MRRERALKVVLVVVGLIFSALVYPLTMFMRQDPALAMMMSL |
| Ga0307476_1000218412 | 3300031715 | Hardwood Forest Soil | MRRERALKVVLVVVGLIFCGLAYPLMMFVKQEPALAMMLSVYDNPRHFPAAGSP |
| Ga0307476_102941771 | 3300031715 | Hardwood Forest Soil | MWRERTLKVVLVVVGLVFCALVYPLIMFVKQEPALAMQF |
| Ga0307474_101201923 | 3300031718 | Hardwood Forest Soil | MRRELALKVVLVLVGLIFSGLVYPWTMFYRQEHPLAMMIS |
| Ga0307474_102905233 | 3300031718 | Hardwood Forest Soil | MNRERALKVVLVVVGLIFCALAYPLIMFVKQAPALAMQFSVYVTL |
| Ga0307469_102533103 | 3300031720 | Hardwood Forest Soil | MHRNRALKVVLVVVGLIFCGLVYPLIMFTRQEPALAMALSVYVTLGVFPAAGSP |
| Ga0307469_116051302 | 3300031720 | Hardwood Forest Soil | MWREQALKIVLMSVGLLFTAMIYPLVLFVKQEPALAMMMSLY |
| Ga0318501_105670692 | 3300031736 | Soil | MRRERALKVVLVLLGLLFCAAVYPLLMMVKQDPALAMMMSLYAALGIFL |
| Ga0307468_1002375772 | 3300031740 | Hardwood Forest Soil | MGREHALKVVLVVVGLIFCCLVYPLTMFVRQEPALAMM |
| Ga0307477_103798982 | 3300031753 | Hardwood Forest Soil | MRRERALKVLLVLVGLLFFAGIYPLILMAKQDPALAMMMS |
| Ga0307477_104343711 | 3300031753 | Hardwood Forest Soil | MRRERALKVVLVVVGLIFCGLVYPLMMFVKQDPALAMMMSLYVTLGIF |
| Ga0307477_105393213 | 3300031753 | Hardwood Forest Soil | MNRERALKVVLVMVGLLFCAGVYPMILMTKQDPALAMMMS |
| Ga0307475_101999631 | 3300031754 | Hardwood Forest Soil | MWRERVLKIELVVVGLLFVALLYPLTMFFRQEPALAMMLSLYV |
| Ga0318537_102899052 | 3300031763 | Soil | MRRERALKIVLVLLGLLFCAGVYPLVLRAKEEPALAMMMSLY |
| Ga0318509_103562291 | 3300031768 | Soil | MRRERALRVVLVLLGLLFCAAVYPLLLMAKEEPALAMMMSL |
| Ga0318548_103064191 | 3300031793 | Soil | MKRERILKVVLVVVGLLFCAAVYPLMLMAKQDPALAM |
| Ga0307473_101923733 | 3300031820 | Hardwood Forest Soil | MRRERALKIVLMLVGLLFTAMIYPLVLFVKQEPAL |
| Ga0307478_111538002 | 3300031823 | Hardwood Forest Soil | MRRERALKVVMVVLGLLFSAGVYPLMVFVKQDPALAMMMSL |
| Ga0306925_107750253 | 3300031890 | Soil | MRRERALKIVLVLLGLLFCAGVYPLVLRAKEEPALAMM |
| Ga0306923_101518361 | 3300031910 | Soil | MRRDRALKVVLVVLGLLFCAGVYPLVLRAKEEPALAMMMSLYV |
| Ga0306923_109642732 | 3300031910 | Soil | MKREPILKVVLVVVGLLFCAAVYPLILMAKQDPAVAMMMSLYATLGI |
| Ga0310916_110557812 | 3300031942 | Soil | MRRERALKIALVLVGLVFCAAVYPLILMMKQDPALAMMMSLYATLGVFLLL |
| Ga0310910_105541021 | 3300031946 | Soil | MRRERALKLVLVVLGLLFCAGVYPLVLMAKEEPALAMMMSLY |
| Ga0310910_112217451 | 3300031946 | Soil | MKREPILKVVLVVVGLLFCAAVYPLILMAKQDPAVAMMMSL |
| Ga0310909_100271531 | 3300031947 | Soil | MRRERALKVVLVLLGLLFCAGVYPLVLRAKEEPALAMMMSLYTTLGV |
| Ga0307479_100277583 | 3300031962 | Hardwood Forest Soil | MFEKEGTMRRERALKVVLVVVGLIFCGLAYPLMMFVKQEPALAMMLSVYDNPRHFPAAGS |
| Ga0307479_100467904 | 3300031962 | Hardwood Forest Soil | MWRERALKVVLLVVGLLFSALVYPLIMFIKQEPALAMMLSVYR |
| Ga0307479_101589651 | 3300031962 | Hardwood Forest Soil | MWRERAQKVVLVVVGLLFSALVYPLMMFVRQEPALAMMLSVYVTLGVF |
| Ga0307479_101915312 | 3300031962 | Hardwood Forest Soil | MWRERALKIVLGLVGLLFSALVYPLMMFVKQEPALAMMLSVYVLT |
| Ga0307479_107005121 | 3300031962 | Hardwood Forest Soil | MRRERTLKIALVLVGLLFSAAVYPLMMMVKQDPALAMMMSL |
| Ga0307479_116828331 | 3300031962 | Hardwood Forest Soil | MRRERALKVVLVVVGLIFCGLAYPLMMFVKQEPALA |
| Ga0306922_107158311 | 3300032001 | Soil | MKRERILKVVLALVGLLFCAAVYPLLLMVKEDPALAMMMSLYATLGIFLLL |
| Ga0306922_111854981 | 3300032001 | Soil | MKREPILKVVLVVVGLLFCAAVYPLILMAKQDPAVAMMMSLY |
| Ga0318510_102156203 | 3300032064 | Soil | MKRERILKVVLVVVGLLFCAAVYPLMLMAKQDPALAMMMSLYA |
| Ga0311301_123325932 | 3300032160 | Peatlands Soil | MKRERVLKVVLVMVGLLLSALVYPMMMFVKQAPAL |
| Ga0307470_102536831 | 3300032174 | Hardwood Forest Soil | MRRERALKVVLIVVGLIFCGLAYPLMMFVKQEPALAKMLSVYVT |
| Ga0307470_105263142 | 3300032174 | Hardwood Forest Soil | MKRERVLKVVLVVLGLLFCAAVYPLILMAKQDPALAMMMSLYATL |
| Ga0307471_1000147378 | 3300032180 | Hardwood Forest Soil | MRRERALKVVLVLVGLLFTAMIYPLVVFVKQGPALAMG |
| Ga0307472_1000749343 | 3300032205 | Hardwood Forest Soil | MWRERALKIVLMSVGLLFTAMIYPLVLFVKQEPALAMMMSLYATLGIFL |
| Ga0307472_1024934991 | 3300032205 | Hardwood Forest Soil | MIRERALKVALVVVGLIFCGLVYPLMMFVQQEPALSMMLSLY |
| Ga0326727_106793482 | 3300033405 | Peat Soil | MKRERVLKVVLVVVGLLFAATVYPMVLFVKQEPALAMMMSL |
| ⦗Top⦘ |