


| Basic Information | |
|---|---|
| Family ID | F010766 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 299 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MRIKIIKFVVKALGYEWGGDNLNAPVWTVKAKKKK |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 299 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 91.30 % |
| % of genes near scaffold ends (potentially truncated) | 7.02 % |
| % of genes from short scaffolds (< 2000 bps) | 50.84 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (36.789 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (17.726 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.836 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.866 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.05% β-sheet: 9.52% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 299 Family Scaffolds |
|---|---|---|
| PF09834 | DUF2061 | 28.09 |
| PF09723 | Zn-ribbon_8 | 13.04 |
| PF05257 | CHAP | 8.36 |
| PF13640 | 2OG-FeII_Oxy_3 | 6.69 |
| PF00565 | SNase | 4.68 |
| PF16861 | Carbam_trans_C | 3.34 |
| PF01583 | APS_kinase | 3.34 |
| PF03567 | Sulfotransfer_2 | 2.68 |
| PF02467 | Whib | 2.68 |
| PF13692 | Glyco_trans_1_4 | 2.01 |
| PF00011 | HSP20 | 1.67 |
| PF00037 | Fer4 | 1.67 |
| PF01471 | PG_binding_1 | 1.34 |
| PF07235 | DUF1427 | 1.00 |
| PF00082 | Peptidase_S8 | 1.00 |
| PF00085 | Thioredoxin | 1.00 |
| PF05118 | Asp_Arg_Hydrox | 1.00 |
| PF08007 | JmjC_2 | 0.67 |
| PF04820 | Trp_halogenase | 0.67 |
| PF04860 | Phage_portal | 0.67 |
| PF06414 | Zeta_toxin | 0.67 |
| PF00590 | TP_methylase | 0.67 |
| PF11753 | DUF3310 | 0.67 |
| PF00089 | Trypsin | 0.67 |
| PF12849 | PBP_like_2 | 0.33 |
| PF07510 | DUF1524 | 0.33 |
| PF00685 | Sulfotransfer_1 | 0.33 |
| PF02543 | Carbam_trans_N | 0.33 |
| PF00141 | peroxidase | 0.33 |
| PF11397 | GlcNAc | 0.33 |
| PF11735 | CAP59_mtransfer | 0.33 |
| PF00255 | GSHPx | 0.33 |
| PF04577 | Glyco_transf_61 | 0.33 |
| PF03793 | PASTA | 0.33 |
| PF14579 | HHH_6 | 0.33 |
| PF06067 | DUF932 | 0.33 |
| PF01551 | Peptidase_M23 | 0.33 |
| PF00296 | Bac_luciferase | 0.33 |
| COG ID | Name | Functional Category | % Frequency in 299 Family Scaffolds |
|---|---|---|---|
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 3.34 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.67 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 1.00 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 0.33 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.33 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.33 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.33 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.21 % |
| Unclassified | root | N/A | 36.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10020130 | All Organisms → cellular organisms → Bacteria | 2447 | Open in IMG/M |
| 3300001968|GOS2236_1044813 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300002408|B570J29032_109316470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300002408|B570J29032_109645719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
| 3300002408|B570J29032_109882733 | All Organisms → Viruses → Predicted Viral | 1946 | Open in IMG/M |
| 3300002408|B570J29032_109935513 | All Organisms → cellular organisms → Bacteria | 3320 | Open in IMG/M |
| 3300002408|B570J29032_109950423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5125 | Open in IMG/M |
| 3300005517|Ga0070374_10001536 | Not Available | 10014 | Open in IMG/M |
| 3300005517|Ga0070374_10007632 | Not Available | 5168 | Open in IMG/M |
| 3300005517|Ga0070374_10017123 | All Organisms → Viruses → Predicted Viral | 3650 | Open in IMG/M |
| 3300005517|Ga0070374_10030874 | All Organisms → Viruses → Predicted Viral | 2764 | Open in IMG/M |
| 3300005517|Ga0070374_10091746 | All Organisms → Viruses → Predicted Viral | 1582 | Open in IMG/M |
| 3300005517|Ga0070374_10104208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1479 | Open in IMG/M |
| 3300005517|Ga0070374_10149615 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
| 3300005517|Ga0070374_10155127 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300005517|Ga0070374_10164156 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300005517|Ga0070374_10185231 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300005517|Ga0070374_10213663 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300005517|Ga0070374_10379893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 711 | Open in IMG/M |
| 3300005517|Ga0070374_10546105 | Not Available | 577 | Open in IMG/M |
| 3300005517|Ga0070374_10566562 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005527|Ga0068876_10008067 | Not Available | 7080 | Open in IMG/M |
| 3300005527|Ga0068876_10020612 | Not Available | 4173 | Open in IMG/M |
| 3300005527|Ga0068876_10096735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1764 | Open in IMG/M |
| 3300005527|Ga0068876_10168036 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300005527|Ga0068876_10368499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
| 3300005527|Ga0068876_10492505 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005528|Ga0068872_10003548 | Not Available | 11884 | Open in IMG/M |
| 3300005583|Ga0049085_10001416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9533 | Open in IMG/M |
| 3300005583|Ga0049085_10003114 | Not Available | 6623 | Open in IMG/M |
| 3300005583|Ga0049085_10195956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300005584|Ga0049082_10000129 | Not Available | 17982 | Open in IMG/M |
| 3300005662|Ga0078894_10002237 | Not Available | 14603 | Open in IMG/M |
| 3300005662|Ga0078894_10005605 | Not Available | 9683 | Open in IMG/M |
| 3300005662|Ga0078894_10038767 | All Organisms → Viruses → Predicted Viral | 3977 | Open in IMG/M |
| 3300005662|Ga0078894_10056371 | All Organisms → Viruses → Predicted Viral | 3347 | Open in IMG/M |
| 3300005662|Ga0078894_10071340 | All Organisms → Viruses → Predicted Viral | 3001 | Open in IMG/M |
| 3300005662|Ga0078894_10108347 | All Organisms → Viruses → Predicted Viral | 2460 | Open in IMG/M |
| 3300005662|Ga0078894_10128451 | All Organisms → Viruses → Predicted Viral | 2261 | Open in IMG/M |
| 3300005662|Ga0078894_10142654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2146 | Open in IMG/M |
| 3300005662|Ga0078894_10343917 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
| 3300005662|Ga0078894_10604851 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300005662|Ga0078894_10701714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300005662|Ga0078894_10979830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300005662|Ga0078894_11466622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300005805|Ga0079957_1003278 | All Organisms → cellular organisms → Bacteria | 13824 | Open in IMG/M |
| 3300005805|Ga0079957_1005727 | Not Available | 10061 | Open in IMG/M |
| 3300005805|Ga0079957_1008547 | All Organisms → cellular organisms → Bacteria | 7916 | Open in IMG/M |
| 3300005805|Ga0079957_1009148 | Not Available | 7608 | Open in IMG/M |
| 3300005941|Ga0070743_10003858 | Not Available | 5482 | Open in IMG/M |
| 3300005941|Ga0070743_10014640 | All Organisms → Viruses → Predicted Viral | 2749 | Open in IMG/M |
| 3300005941|Ga0070743_10111198 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300005941|Ga0070743_10136694 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300006030|Ga0075470_10000171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22842 | Open in IMG/M |
| 3300006030|Ga0075470_10189705 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300006484|Ga0070744_10003277 | All Organisms → Viruses → Predicted Viral | 4870 | Open in IMG/M |
| 3300006484|Ga0070744_10006070 | All Organisms → Viruses → Predicted Viral | 3627 | Open in IMG/M |
| 3300006484|Ga0070744_10007278 | All Organisms → Viruses → Predicted Viral | 3316 | Open in IMG/M |
| 3300006484|Ga0070744_10030260 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
| 3300006639|Ga0079301_1003923 | All Organisms → cellular organisms → Bacteria | 6255 | Open in IMG/M |
| 3300006639|Ga0079301_1014136 | All Organisms → Viruses → Predicted Viral | 2894 | Open in IMG/M |
| 3300006639|Ga0079301_1052758 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300007169|Ga0102976_1139121 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300007169|Ga0102976_1157675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1335 | Open in IMG/M |
| 3300007171|Ga0102977_1019794 | All Organisms → cellular organisms → Bacteria | 2848 | Open in IMG/M |
| 3300007171|Ga0102977_1213587 | Not Available | 2531 | Open in IMG/M |
| 3300007516|Ga0105050_10024553 | Not Available | 5217 | Open in IMG/M |
| 3300007541|Ga0099848_1262359 | Not Available | 601 | Open in IMG/M |
| 3300007545|Ga0102873_1192785 | Not Available | 612 | Open in IMG/M |
| 3300007547|Ga0102875_1136513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300007557|Ga0102821_1097380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300007559|Ga0102828_1123433 | Not Available | 639 | Open in IMG/M |
| 3300007590|Ga0102917_1072184 | Not Available | 1216 | Open in IMG/M |
| 3300007590|Ga0102917_1286682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300007620|Ga0102871_1225926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300007622|Ga0102863_1158113 | Not Available | 667 | Open in IMG/M |
| 3300007622|Ga0102863_1265978 | Not Available | 500 | Open in IMG/M |
| 3300007630|Ga0102903_1205050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 535 | Open in IMG/M |
| 3300007639|Ga0102865_1026807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1668 | Open in IMG/M |
| 3300007644|Ga0102902_1227861 | Not Available | 548 | Open in IMG/M |
| 3300008055|Ga0108970_10369099 | All Organisms → Viruses → Predicted Viral | 2941 | Open in IMG/M |
| 3300008055|Ga0108970_11281586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1159 | Open in IMG/M |
| 3300008107|Ga0114340_1000599 | Not Available | 62989 | Open in IMG/M |
| 3300008110|Ga0114343_1039656 | All Organisms → Viruses → Predicted Viral | 1894 | Open in IMG/M |
| 3300008113|Ga0114346_1014115 | All Organisms → Viruses → Predicted Viral | 4445 | Open in IMG/M |
| 3300008113|Ga0114346_1035294 | Not Available | 2595 | Open in IMG/M |
| 3300008113|Ga0114346_1036407 | All Organisms → Viruses → Predicted Viral | 2545 | Open in IMG/M |
| 3300008114|Ga0114347_1008779 | All Organisms → cellular organisms → Bacteria | 5223 | Open in IMG/M |
| 3300008114|Ga0114347_1098071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2571 | Open in IMG/M |
| 3300008116|Ga0114350_1000425 | Not Available | 29998 | Open in IMG/M |
| 3300008116|Ga0114350_1001400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18709 | Open in IMG/M |
| 3300008116|Ga0114350_1004137 | Not Available | 7424 | Open in IMG/M |
| 3300008116|Ga0114350_1023734 | All Organisms → cellular organisms → Bacteria | 3335 | Open in IMG/M |
| 3300008119|Ga0114354_1279187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300008120|Ga0114355_1005973 | Not Available | 13389 | Open in IMG/M |
| 3300008258|Ga0114840_1055191 | Not Available | 621 | Open in IMG/M |
| 3300008261|Ga0114336_1002460 | Not Available | 23190 | Open in IMG/M |
| 3300008264|Ga0114353_1397465 | Not Available | 512 | Open in IMG/M |
| 3300008962|Ga0104242_1088258 | Not Available | 514 | Open in IMG/M |
| 3300008996|Ga0102831_1011684 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
| 3300008996|Ga0102831_1124921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 855 | Open in IMG/M |
| 3300008996|Ga0102831_1330503 | Not Available | 504 | Open in IMG/M |
| 3300009059|Ga0102830_1257825 | Not Available | 509 | Open in IMG/M |
| 3300009068|Ga0114973_10000393 | Not Available | 32776 | Open in IMG/M |
| 3300009068|Ga0114973_10000603 | Not Available | 27189 | Open in IMG/M |
| 3300009080|Ga0102815_10249945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300009152|Ga0114980_10000356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33039 | Open in IMG/M |
| 3300009152|Ga0114980_10002895 | Not Available | 11929 | Open in IMG/M |
| 3300009152|Ga0114980_10011208 | Not Available | 5746 | Open in IMG/M |
| 3300009152|Ga0114980_10262130 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300009158|Ga0114977_10227976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1082 | Open in IMG/M |
| 3300009158|Ga0114977_10338459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
| 3300009159|Ga0114978_10000521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32711 | Open in IMG/M |
| 3300009160|Ga0114981_10000560 | Not Available | 24013 | Open in IMG/M |
| 3300009184|Ga0114976_10002003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12808 | Open in IMG/M |
| 3300009419|Ga0114982_1000472 | Not Available | 21651 | Open in IMG/M |
| 3300009419|Ga0114982_1050647 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
| 3300009466|Ga0126448_1001213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7490 | Open in IMG/M |
| 3300009466|Ga0126448_1027543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1347 | Open in IMG/M |
| 3300010354|Ga0129333_10003752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14251 | Open in IMG/M |
| 3300010354|Ga0129333_10004601 | Not Available | 12925 | Open in IMG/M |
| 3300010354|Ga0129333_10008623 | Not Available | 9641 | Open in IMG/M |
| 3300010354|Ga0129333_10014181 | Not Available | 7574 | Open in IMG/M |
| 3300010354|Ga0129333_10042849 | Not Available | 4255 | Open in IMG/M |
| 3300010354|Ga0129333_10047855 | Not Available | 4015 | Open in IMG/M |
| 3300010354|Ga0129333_10142067 | Not Available | 2205 | Open in IMG/M |
| 3300010354|Ga0129333_10169685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1996 | Open in IMG/M |
| 3300010354|Ga0129333_10240960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1633 | Open in IMG/M |
| 3300010354|Ga0129333_10273368 | Not Available | 1517 | Open in IMG/M |
| 3300010354|Ga0129333_10394102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1226 | Open in IMG/M |
| 3300010354|Ga0129333_10760581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 829 | Open in IMG/M |
| 3300010370|Ga0129336_10001652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13577 | Open in IMG/M |
| 3300010370|Ga0129336_10053730 | All Organisms → Viruses → Predicted Viral | 2404 | Open in IMG/M |
| 3300010370|Ga0129336_10219792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
| 3300010885|Ga0133913_10069977 | Not Available | 9416 | Open in IMG/M |
| 3300011268|Ga0151620_1008332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3748 | Open in IMG/M |
| 3300012286|Ga0157137_102880 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300012352|Ga0157138_1016475 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
| 3300012352|Ga0157138_1071667 | Not Available | 543 | Open in IMG/M |
| 3300012663|Ga0157203_1047923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300012665|Ga0157210_1025216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300012968|Ga0129337_1021667 | Not Available | 2849 | Open in IMG/M |
| 3300012970|Ga0129338_1300244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300012970|Ga0129338_1351823 | Not Available | 2641 | Open in IMG/M |
| 3300013004|Ga0164293_10000329 | Not Available | 36218 | Open in IMG/M |
| 3300013004|Ga0164293_10016363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6222 | Open in IMG/M |
| 3300013004|Ga0164293_10085919 | All Organisms → Viruses → Predicted Viral | 2444 | Open in IMG/M |
| 3300013005|Ga0164292_10931831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10017256 | Not Available | 7064 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10207852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1225 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10475797 | Not Available | 691 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10475798 | Not Available | 691 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10032512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4974 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10124547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2103 | Open in IMG/M |
| 3300013372|Ga0177922_10018881 | All Organisms → Viruses → Predicted Viral | 2329 | Open in IMG/M |
| 3300014819|Ga0119954_1000433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14897 | Open in IMG/M |
| 3300017788|Ga0169931_10062336 | All Organisms → cellular organisms → Bacteria | 3868 | Open in IMG/M |
| 3300017788|Ga0169931_10101500 | All Organisms → Viruses → Predicted Viral | 2760 | Open in IMG/M |
| 3300017788|Ga0169931_10229944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1540 | Open in IMG/M |
| 3300017788|Ga0169931_10490395 | Not Available | 871 | Open in IMG/M |
| 3300019146|Ga0188881_10027771 | Not Available | 703 | Open in IMG/M |
| 3300019784|Ga0181359_1000964 | Not Available | 7199 | Open in IMG/M |
| 3300019784|Ga0181359_1043100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1748 | Open in IMG/M |
| 3300019784|Ga0181359_1181348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300020048|Ga0207193_1032435 | Not Available | 5982 | Open in IMG/M |
| 3300020048|Ga0207193_1034661 | Not Available | 5701 | Open in IMG/M |
| 3300020074|Ga0194113_10200337 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300020074|Ga0194113_10375179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
| 3300020141|Ga0211732_1053829 | Not Available | 12828 | Open in IMG/M |
| 3300020141|Ga0211732_1172916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300020141|Ga0211732_1287381 | All Organisms → Viruses → Predicted Viral | 2699 | Open in IMG/M |
| 3300020141|Ga0211732_1525698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3561 | Open in IMG/M |
| 3300020151|Ga0211736_10053289 | All Organisms → Viruses → Predicted Viral | 2227 | Open in IMG/M |
| 3300020151|Ga0211736_10084738 | Not Available | 5183 | Open in IMG/M |
| 3300020151|Ga0211736_10321492 | All Organisms → cellular organisms → Bacteria | 2262 | Open in IMG/M |
| 3300020151|Ga0211736_10707038 | Not Available | 5530 | Open in IMG/M |
| 3300020151|Ga0211736_10962289 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300020151|Ga0211736_10995054 | Not Available | 865 | Open in IMG/M |
| 3300020159|Ga0211734_10033996 | All Organisms → Viruses → Predicted Viral | 4579 | Open in IMG/M |
| 3300020159|Ga0211734_10233620 | Not Available | 8724 | Open in IMG/M |
| 3300020159|Ga0211734_10756461 | All Organisms → cellular organisms → Bacteria | 3037 | Open in IMG/M |
| 3300020160|Ga0211733_11171679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300020161|Ga0211726_10091671 | Not Available | 997 | Open in IMG/M |
| 3300020162|Ga0211735_10976557 | Not Available | 690 | Open in IMG/M |
| 3300020204|Ga0194116_10063445 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
| 3300020205|Ga0211731_10391535 | Not Available | 741 | Open in IMG/M |
| 3300020482|Ga0208464_101981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1531 | Open in IMG/M |
| 3300020494|Ga0208326_101939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1849 | Open in IMG/M |
| 3300020498|Ga0208050_1026350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 587 | Open in IMG/M |
| 3300020505|Ga0208088_1033200 | Not Available | 642 | Open in IMG/M |
| 3300020515|Ga0208234_1006875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1495 | Open in IMG/M |
| 3300020519|Ga0208223_1001573 | All Organisms → Viruses → Predicted Viral | 4907 | Open in IMG/M |
| 3300020527|Ga0208232_1004079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2475 | Open in IMG/M |
| 3300020527|Ga0208232_1010213 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
| 3300020529|Ga0208233_1004395 | All Organisms → Viruses → Predicted Viral | 2333 | Open in IMG/M |
| 3300020529|Ga0208233_1029195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300020529|Ga0208233_1044175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300020531|Ga0208487_1033163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300020549|Ga0207942_1005258 | All Organisms → Viruses → Predicted Viral | 1877 | Open in IMG/M |
| 3300020558|Ga0208362_1000001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 111438 | Open in IMG/M |
| 3300020558|Ga0208362_1029504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300020572|Ga0207909_1010560 | All Organisms → Viruses → Predicted Viral | 1851 | Open in IMG/M |
| 3300020572|Ga0207909_1013427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1582 | Open in IMG/M |
| 3300021519|Ga0194048_10000570 | Not Available | 17976 | Open in IMG/M |
| 3300021961|Ga0222714_10043574 | All Organisms → Viruses → Predicted Viral | 3184 | Open in IMG/M |
| 3300021961|Ga0222714_10152316 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
| 3300021962|Ga0222713_10021176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5457 | Open in IMG/M |
| 3300021962|Ga0222713_10633835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300021963|Ga0222712_10072479 | All Organisms → Viruses → Predicted Viral | 2485 | Open in IMG/M |
| 3300021963|Ga0222712_10131597 | Not Available | 1711 | Open in IMG/M |
| 3300021963|Ga0222712_10519509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300021963|Ga0222712_10648464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300023174|Ga0214921_10000213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 115201 | Open in IMG/M |
| 3300023174|Ga0214921_10000295 | Not Available | 98310 | Open in IMG/M |
| 3300023174|Ga0214921_10003731 | Not Available | 23031 | Open in IMG/M |
| 3300023174|Ga0214921_10091300 | Not Available | 2340 | Open in IMG/M |
| 3300024239|Ga0247724_1000036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 43459 | Open in IMG/M |
| 3300024289|Ga0255147_1000246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19325 | Open in IMG/M |
| 3300024289|Ga0255147_1030318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
| 3300024306|Ga0255148_1039123 | Not Available | 861 | Open in IMG/M |
| 3300024343|Ga0244777_10636719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300024346|Ga0244775_10001832 | Not Available | 23992 | Open in IMG/M |
| 3300024346|Ga0244775_10001839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23899 | Open in IMG/M |
| 3300024346|Ga0244775_10003054 | Not Available | 17961 | Open in IMG/M |
| 3300024346|Ga0244775_10022094 | Not Available | 5773 | Open in IMG/M |
| 3300024346|Ga0244775_10027086 | Not Available | 5128 | Open in IMG/M |
| 3300024346|Ga0244775_10158941 | All Organisms → Viruses → Predicted Viral | 1905 | Open in IMG/M |
| 3300024346|Ga0244775_10200095 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300024346|Ga0244775_10296403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1341 | Open in IMG/M |
| 3300024346|Ga0244775_10419608 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300024346|Ga0244775_10576012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300024346|Ga0244775_11378229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300024352|Ga0255142_1051147 | Not Available | 636 | Open in IMG/M |
| 3300024572|Ga0255268_1146740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300025445|Ga0208424_1017355 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300025585|Ga0208546_1000026 | Not Available | 80003 | Open in IMG/M |
| 3300025585|Ga0208546_1143158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300026455|Ga0255155_1066431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300027114|Ga0208009_1001557 | Not Available | 6480 | Open in IMG/M |
| 3300027136|Ga0255107_1019698 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
| 3300027144|Ga0255102_1037396 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300027418|Ga0208022_1033500 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300027499|Ga0208788_1035876 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
| 3300027563|Ga0209552_1000273 | Not Available | 16393 | Open in IMG/M |
| 3300027563|Ga0209552_1063565 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300027586|Ga0208966_1000125 | Not Available | 24393 | Open in IMG/M |
| 3300027631|Ga0208133_1026127 | All Organisms → Viruses → Predicted Viral | 1480 | Open in IMG/M |
| 3300027656|Ga0209357_1069920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
| 3300027689|Ga0209551_1000504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14749 | Open in IMG/M |
| 3300027689|Ga0209551_1027772 | All Organisms → Viruses → Predicted Viral | 1906 | Open in IMG/M |
| 3300027689|Ga0209551_1257703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1011341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8106 | Open in IMG/M |
| 3300027734|Ga0209087_1000525 | Not Available | 24087 | Open in IMG/M |
| 3300027760|Ga0209598_10030888 | All Organisms → Viruses → Predicted Viral | 2963 | Open in IMG/M |
| 3300027769|Ga0209770_10001068 | Not Available | 14408 | Open in IMG/M |
| 3300027769|Ga0209770_10006770 | Not Available | 5369 | Open in IMG/M |
| 3300027769|Ga0209770_10227267 | Not Available | 729 | Open in IMG/M |
| 3300027782|Ga0209500_10438101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 517 | Open in IMG/M |
| 3300027793|Ga0209972_10002646 | Not Available | 14523 | Open in IMG/M |
| 3300027797|Ga0209107_10294110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300027804|Ga0209358_10224537 | Not Available | 959 | Open in IMG/M |
| 3300027805|Ga0209229_10087249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
| 3300027836|Ga0209230_10128902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1429 | Open in IMG/M |
| 3300027836|Ga0209230_10185381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
| 3300027892|Ga0209550_10232570 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
| 3300027892|Ga0209550_10402051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
| 3300027892|Ga0209550_10406488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300027892|Ga0209550_10425570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300027973|Ga0209298_10000218 | Not Available | 36992 | Open in IMG/M |
| 3300028025|Ga0247723_1000055 | Not Available | 64365 | Open in IMG/M |
| 3300028025|Ga0247723_1001832 | Not Available | 11984 | Open in IMG/M |
| 3300029930|Ga0119944_1034425 | Not Available | 643 | Open in IMG/M |
| 3300031758|Ga0315907_10001579 | Not Available | 30603 | Open in IMG/M |
| 3300031758|Ga0315907_10090572 | All Organisms → Viruses → Predicted Viral | 2630 | Open in IMG/M |
| 3300031758|Ga0315907_10154338 | Not Available | 1943 | Open in IMG/M |
| 3300031857|Ga0315909_10025117 | Not Available | 5899 | Open in IMG/M |
| 3300031951|Ga0315904_10003074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25038 | Open in IMG/M |
| 3300031951|Ga0315904_10013179 | Not Available | 10378 | Open in IMG/M |
| 3300031951|Ga0315904_10014480 | Not Available | 9816 | Open in IMG/M |
| 3300031951|Ga0315904_10601424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300031951|Ga0315904_11243404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300032092|Ga0315905_10005602 | Not Available | 12791 | Open in IMG/M |
| 3300032116|Ga0315903_10825044 | Not Available | 674 | Open in IMG/M |
| 3300033816|Ga0334980_0000095 | Not Available | 41955 | Open in IMG/M |
| 3300033996|Ga0334979_0000654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26125 | Open in IMG/M |
| 3300034013|Ga0334991_0425139 | Not Available | 505 | Open in IMG/M |
| 3300034018|Ga0334985_0768636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300034022|Ga0335005_0139568 | All Organisms → Viruses → Predicted Viral | 1548 | Open in IMG/M |
| 3300034066|Ga0335019_0000027 | Not Available | 86364 | Open in IMG/M |
| 3300034066|Ga0335019_0001030 | Not Available | 17874 | Open in IMG/M |
| 3300034066|Ga0335019_0062540 | All Organisms → Viruses → Predicted Viral | 2532 | Open in IMG/M |
| 3300034071|Ga0335028_0070094 | Not Available | 2340 | Open in IMG/M |
| 3300034072|Ga0310127_019398 | All Organisms → Viruses → Predicted Viral | 4237 | Open in IMG/M |
| 3300034073|Ga0310130_0000204 | Not Available | 49659 | Open in IMG/M |
| 3300034073|Ga0310130_0003909 | Not Available | 6226 | Open in IMG/M |
| 3300034096|Ga0335025_0002251 | Not Available | 15041 | Open in IMG/M |
| 3300034101|Ga0335027_0613770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300034106|Ga0335036_0316488 | Not Available | 1031 | Open in IMG/M |
| 3300034200|Ga0335065_0788095 | Not Available | 534 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.70% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.69% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 6.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.69% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.35% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.01% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.68% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.68% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.34% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.01% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.67% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.34% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.00% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.00% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.67% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.67% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.67% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.67% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.33% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.33% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.33% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.33% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012286 | Freshwater microbial communities from Ausable River, Ontario, Canada - S47 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019146 | Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020482 | Freshwater microbial communities from Lake Mendota, WI - 13SEPL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020531 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020558 | Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027136 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_100201302 | 3300001282 | Freshwater | MRIKIIKFVVKALGYEWGGDQLKAPVWTVKAKKK* |
| GOS2236_10448131 | 3300001968 | Marine | IMRIKIIKFVVKVLGYEWSGDELNLPVWQVKAKKKK* |
| B570J29032_1093164703 | 3300002408 | Freshwater | MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKNKK* |
| B570J29032_1096457191 | 3300002408 | Freshwater | MRIKIIRFVVKALGYEWSGDELKLPVWQVKAKQKKK* |
| B570J29032_1098827334 | 3300002408 | Freshwater | MRIKIIKFVVKALGYEWGGDSLKAPIWTVKEKKKK* |
| B570J29032_1099355139 | 3300002408 | Freshwater | MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKAKKKN* |
| B570J29032_1099504231 | 3300002408 | Freshwater | MRIKIIKFVVKALGYQWSGDDLKLPVWYVKEKKKVK* |
| Ga0070374_100015369 | 3300005517 | Freshwater Lake | MRIKIIKFVVKTLGYEWGGDKLNLPYWTVKAKKK* |
| Ga0070374_100076325 | 3300005517 | Freshwater Lake | MRIKVIRFVVKVLGYEWGGDALNVPVWTVKAKKKK* |
| Ga0070374_100171235 | 3300005517 | Freshwater Lake | MRIKIIRAMVKLLGYEWGGDNLNAPVWTVKAKKKK* |
| Ga0070374_100308746 | 3300005517 | Freshwater Lake | MRIKIIKFVVKALGYEWGGDNLNVPVWTVKAKKKK* |
| Ga0070374_100917463 | 3300005517 | Freshwater Lake | MRIKIIRFVVKALGYQWGGDALSAPVWTVKAKKKK* |
| Ga0070374_101042083 | 3300005517 | Freshwater Lake | MRIKIIRAVVKLLGYEWGGDSLNAPVWTVKAKKKK* |
| Ga0070374_101496153 | 3300005517 | Freshwater Lake | MRIKIIKFVVKALGYEWSGDELKLPIWYVKAKKKK* |
| Ga0070374_101551274 | 3300005517 | Freshwater Lake | MRIKIIRAVVKLLGYEWGGDALNAPIWTVKAKKKK* |
| Ga0070374_101641564 | 3300005517 | Freshwater Lake | MRIKFIRFVVKALGYDWGGDNLNAPVWTVKAKKKK* |
| Ga0070374_101852311 | 3300005517 | Freshwater Lake | QVMRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKSK* |
| Ga0070374_102136632 | 3300005517 | Freshwater Lake | MRIKIIKIVVKLLGYEWGGDNLNAPIWTVKAKKKK* |
| Ga0070374_103798932 | 3300005517 | Freshwater Lake | MRIKIIRFVVKALGYQWGGDALNAPIWTVKAKKKK* |
| Ga0070374_105461052 | 3300005517 | Freshwater Lake | MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKAKKKN* |
| Ga0070374_105665622 | 3300005517 | Freshwater Lake | MRIKIIRSVVKLLGYEWGGDSLNAPVWTVKAKKKK* |
| Ga0068876_100080676 | 3300005527 | Freshwater Lake | MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKSKKKS* |
| Ga0068876_100206125 | 3300005527 | Freshwater Lake | MRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKK* |
| Ga0068876_100967352 | 3300005527 | Freshwater Lake | MRIKIIKFVVKALGYEWSGDELKLPVWQVKAKTKKK* |
| Ga0068876_101680364 | 3300005527 | Freshwater Lake | MRIKIIKFVVKLLGYEWSGDNLNLPVWQVKAKKKGK* |
| Ga0068876_103684994 | 3300005527 | Freshwater Lake | MRIKIIKFIVKALGYEWSGDQLNLPVWQVKAKTKKK* |
| Ga0068876_104925053 | 3300005527 | Freshwater Lake | MRIKIIKAVVKLLGYEWSGDELKLPVWYVKEKKRNR* |
| Ga0068872_100035486 | 3300005528 | Freshwater Lake | MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKTKKK* |
| Ga0049085_1000141610 | 3300005583 | Freshwater Lentic | MRINIIKFVVKTLGYEWSEHPLKLPVWTIKKKKASSIFDQ* |
| Ga0049085_1000311413 | 3300005583 | Freshwater Lentic | MRIKIIRFVVKALGYEWGGDALNVPIWTVKAKKKK* |
| Ga0049085_101959562 | 3300005583 | Freshwater Lentic | MRIKIIRFVVKALGYEWGGDLLNVPIWTVKAKKKK* |
| Ga0049082_1000012911 | 3300005584 | Freshwater Lentic | MRIKIIRFVVKALGYEWGGDNLNLPYWTVKAKKKK* |
| Ga0078894_1000223730 | 3300005662 | Freshwater Lake | MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKKK* |
| Ga0078894_100056056 | 3300005662 | Freshwater Lake | MRIKIIKAVVKLLGYEWSGDELKLPVWYVKEKKKK* |
| Ga0078894_100387673 | 3300005662 | Freshwater Lake | MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKSK* |
| Ga0078894_100563712 | 3300005662 | Freshwater Lake | MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKKKK* |
| Ga0078894_100713402 | 3300005662 | Freshwater Lake | MRIKIIKFVVKALGYEWSGDELKLPVWYIKEKKKK* |
| Ga0078894_101083473 | 3300005662 | Freshwater Lake | MRIKIIKFVVKALGYEWSGDELRLPVWYVKEKKKK* |
| Ga0078894_101284513 | 3300005662 | Freshwater Lake | MRIKIIKFVVKALGYDWGGDSLKAPVWTVKAKKKK* |
| Ga0078894_101426544 | 3300005662 | Freshwater Lake | MRIRIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKK* |
| Ga0078894_103439171 | 3300005662 | Freshwater Lake | MRIKIIKFVVKALGYEWGGDNLNAPVWTVKAKKKK* |
| Ga0078894_106048513 | 3300005662 | Freshwater Lake | MRIKIIKFVVKILGYEWGGDNLHAPLWTVKAKKKK* |
| Ga0078894_107017143 | 3300005662 | Freshwater Lake | VRIKIIRAVVKILGYEWGGDSLKAPIWTVKEKKNKKQ* |
| Ga0078894_109798302 | 3300005662 | Freshwater Lake | MRIKIIRFVVKALGYEWSGDELKLPVWYVKEKKTKK* |
| Ga0078894_114666223 | 3300005662 | Freshwater Lake | MRIKIIKSVVKLLGYEWGGDSLKAPVWTVKAKKKK* |
| Ga0079957_10032785 | 3300005805 | Lake | VAKEDQVMRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKK* |
| Ga0079957_10057277 | 3300005805 | Lake | MRIKIIKFVVKVLGYEWSGDELKLPVWQVKAKQKKK* |
| Ga0079957_100854710 | 3300005805 | Lake | MRIKIIKAVVKLLGYEWSGDELKLPVWYVKEKKKSK* |
| Ga0079957_10091482 | 3300005805 | Lake | MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKNKKQK* |
| Ga0070743_100038587 | 3300005941 | Estuarine | MRINIIKFVVKALGYEWSGDELKLPVWYVKEKKKKK* |
| Ga0070743_100146402 | 3300005941 | Estuarine | MRIKIIRFVVKALGYDWGGDSLNAPVWTVKAKKKK* |
| Ga0070743_101111984 | 3300005941 | Estuarine | MRIKIIKFVVKALGYEWGGDSLNAPIWTVKAKKKK* |
| Ga0070743_101366942 | 3300005941 | Estuarine | MRIKIIKTVVRLLGYEWGGDNLNAPIWTVKAKKKK* |
| Ga0075470_100001719 | 3300006030 | Aqueous | MRIKIIKFVVKLLGYEWSGDNLNLPIWYVKAKKKK* |
| Ga0075470_101897053 | 3300006030 | Aqueous | MRLKIIKFVVKALGYEWSGDNVKIPVWYVKEKKKK* |
| Ga0070744_100032779 | 3300006484 | Estuarine | MRIKIIRFVVKALGYDWGGDNLNAPVWTVKAKKKK* |
| Ga0070744_100060704 | 3300006484 | Estuarine | MEIGVEMRIKIIKFVVKSLGYEWSGDELKLPVWYVKEKKKK* |
| Ga0070744_100072784 | 3300006484 | Estuarine | MRIKIIRFVVKALGYDWGGDALNVPVWTVKAKKKK* |
| Ga0070744_100302606 | 3300006484 | Estuarine | MRIKIIKFVVKSLGYEWSGDELKLPVWYVKEKKKK* |
| Ga0079301_10039236 | 3300006639 | Deep Subsurface | MRIRIIKTVVKLLGYEWSGDELKLPVWYVKEKKKK* |
| Ga0079301_10141364 | 3300006639 | Deep Subsurface | MRIKIIKFVVKLLGYEWRGDKLNLPVWTVRAKKK* |
| Ga0079301_10527581 | 3300006639 | Deep Subsurface | MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKEKKKSK* |
| Ga0102976_11391214 | 3300007169 | Freshwater Lake | MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKKKIK* |
| Ga0102976_11576752 | 3300007169 | Freshwater Lake | MRIKIIKFVVKLLGYEWSGDQLNLPVWQVKAKQKKK* |
| Ga0102977_10197945 | 3300007171 | Freshwater Lake | MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKKKTK* |
| Ga0102977_12135874 | 3300007171 | Freshwater Lake | VRIKIIKFVVKILGYEWSGDNINLPVWQVKAKKKKNR* |
| Ga0105050_100245532 | 3300007516 | Freshwater | MRIKIIRFVVKALGYEWSGDKLNLPVWYIKEKKK* |
| Ga0099848_12623593 | 3300007541 | Aqueous | MRIKIIKLVVRLLGYEWSGDNVNLPVWQVKEKRKNKK* |
| Ga0102873_11927853 | 3300007545 | Estuarine | MRIKIIRFVVKALGYEWGGDNLNAPVWTVKAKKKK* |
| Ga0102875_11365132 | 3300007547 | Estuarine | MRIKIIKTVVRLLGYEWGGDNLNAPVWTVKAKKKK* |
| Ga0102821_10973803 | 3300007557 | Estuarine | MRINIIKFVVKALGYEWSGDELKLPVWYVKEKKKK |
| Ga0102828_11234332 | 3300007559 | Estuarine | MRIRIIRFVVKALGYEWGGDALNVPIWTVKAKKKK* |
| Ga0102917_10721843 | 3300007590 | Estuarine | MRIKIIRFVVKALGYEWGGDKFNAPIWTVKAKKK* |
| Ga0102917_12866823 | 3300007590 | Estuarine | MRIKIIKFVVKALGYEWGGDSLNLPYWTVKEKKKK* |
| Ga0102871_12259262 | 3300007620 | Estuarine | MRIKIIRFVVKALGDDWGGDNLNAPVWTVKAKKKK* |
| Ga0102863_11581131 | 3300007622 | Estuarine | MRIKIIKFVVKALGYEWGGDNLKLPYWTVKAKKK* |
| Ga0102863_12659781 | 3300007622 | Estuarine | MRIKIIRFVVKALGYQWGGDLLNAPIWTVKAKKKK* |
| Ga0102903_12050501 | 3300007630 | Estuarine | VRIKIIKFVVKALGYDWSGDELKLPVWYVKEKKNKK* |
| Ga0102865_10268072 | 3300007639 | Estuarine | MKGKTMRIKIIRFVVKALGYQWGGDLLNAPIWTVKAKKKK* |
| Ga0102902_12278612 | 3300007644 | Estuarine | MRIRIIRFVVKALGYQWGGDLLNAPIWTVKAKKKK* |
| Ga0108970_103690995 | 3300008055 | Estuary | MRIRIIRAVVKLLGYEWGGDALKAPIWTVKEKKKK* |
| Ga0108970_112815863 | 3300008055 | Estuary | MRIKIIRFVVKALGYEWSGDELKLPVWYVKEKKKK* |
| Ga0114340_100059910 | 3300008107 | Freshwater, Plankton | MRIKIIRFVVKTLGYEWGGDNLNAPVWTVKAKKKK* |
| Ga0114343_10396565 | 3300008110 | Freshwater, Plankton | MRIKIIKAVVKLLGYEWSGDELKLPIWYVKEKKSKR* |
| Ga0114346_10141153 | 3300008113 | Freshwater, Plankton | MRIKIIRFVVKALGYEWGGDILKAPIWTVKAKKK* |
| Ga0114346_10352942 | 3300008113 | Freshwater, Plankton | MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKEKKKK* |
| Ga0114346_10364076 | 3300008113 | Freshwater, Plankton | MRIKIIKFVVKALGYEWSGDDLKLPVWYVKEKKKK* |
| Ga0114347_10087797 | 3300008114 | Freshwater, Plankton | MRIKIIKFVVKALGYEWSGDELKLPVWQVKAKQKKK* |
| Ga0114347_10980714 | 3300008114 | Freshwater, Plankton | MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKQKKK* |
| Ga0114350_100042516 | 3300008116 | Freshwater, Plankton | MRIKIIKFVVKFLGYEWSGDNVNLPVWQVKAKKKNK* |
| Ga0114350_100140026 | 3300008116 | Freshwater, Plankton | MRIKIIKFIVKTLGYEWGGDNLNAPIWTIKAKKKK* |
| Ga0114350_10041377 | 3300008116 | Freshwater, Plankton | MRIKIIKLVVKLLGYEWSGDNLNLPVWQVKAKKKGK* |
| Ga0114350_10237344 | 3300008116 | Freshwater, Plankton | MRIKIIKFVVKVLGYEWSGDNLNLPVWQVKAKKKGK* |
| Ga0114354_12791871 | 3300008119 | Freshwater, Plankton | QIMRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKK* |
| Ga0114355_100597329 | 3300008120 | Freshwater, Plankton | VVKENQIMRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKK* |
| Ga0114840_10551911 | 3300008258 | Freshwater, Plankton | VMRIKIIKFVVKFLGYEWSGDNVNLPVWQVKAKKKNK* |
| Ga0114336_100246024 | 3300008261 | Freshwater, Plankton | MRIKIIRFVVKALGYQWGGDSLNAPVWTVKAKKKK* |
| Ga0114353_13974651 | 3300008264 | Freshwater, Plankton | IMRIKIIKFVVKILGYEWSGDELKLPVWQVKAKQKKK* |
| Ga0104242_10882583 | 3300008962 | Freshwater | MRIKIIRFVVKALGYDWGGDNLNAPVWTVKAKKKKKK |
| Ga0102831_10116843 | 3300008996 | Estuarine | MRIKIIRFVVKALGYQWGGDNLNVPVWTVKAKKKK* |
| Ga0102831_11249212 | 3300008996 | Estuarine | MRIKIIRFIVKTLGYEWGGDNLNAPVWTVKAKKKK* |
| Ga0102831_13305033 | 3300008996 | Estuarine | MRIKIIRFVVKALGYEWGGDALKSPIWTVKAKKK* |
| Ga0102830_12578251 | 3300009059 | Estuarine | IMRIKIIKFVVKALGYEWGGDSLNAPIWTVKAKKKK* |
| Ga0114973_1000039314 | 3300009068 | Freshwater Lake | MRIKIIRFVVKALGYEWGGDKLNAPIWTVKAKKKN* |
| Ga0114973_1000060345 | 3300009068 | Freshwater Lake | MRIKIIKFVVKALGYEWGGDALKAPVWTVKAKKK* |
| Ga0102815_102499452 | 3300009080 | Estuarine | MRINIIKFVVKALGYEWSGDELKLPVWYVKEKKKK* |
| Ga0114980_1000035647 | 3300009152 | Freshwater Lake | MRIKIIKFVVKLLGYEWSGDNLKLPYWTVKAKKKK* |
| Ga0114980_100028958 | 3300009152 | Freshwater Lake | MRIKIIRFVVKALGYEWGGDALKAPVWTVKAKKK* |
| Ga0114980_100112084 | 3300009152 | Freshwater Lake | MRIKIIRFVVKALGYEWGGDNLNAPIWTVKAKKKK* |
| Ga0114980_102621302 | 3300009152 | Freshwater Lake | MRIKIIRFVVKALGYQWGGDKLNVPVWTVKAKKK* |
| Ga0114977_102279761 | 3300009158 | Freshwater Lake | MRIKIIRFVVKALGYEWGGDFLNAPIWTVKVKNKR* |
| Ga0114977_103384593 | 3300009158 | Freshwater Lake | MRIKIIKFIVKMFGYEWDKISLNAQIWTVKVKNKR* |
| Ga0114978_1000052152 | 3300009159 | Freshwater Lake | MRLKIIKFVVKLLGYEWSGDNLKLPIWYVKEKKKSE* |
| Ga0114981_1000056030 | 3300009160 | Freshwater Lake | MRIKIIRLVVKALGYEWGGDNLNAPIWTVKAKKKK* |
| Ga0114976_100020036 | 3300009184 | Freshwater Lake | MRIKIIRFVVKALGYEWGGDFLNAPIWTVKAKKKK* |
| Ga0114982_100047243 | 3300009419 | Deep Subsurface | MRIKIIKFVVKALGYEWGGDKLNLPYWTVKAKKK* |
| Ga0114982_10506471 | 3300009419 | Deep Subsurface | MRIRIIRFVVKALGYEWGGDKLNAPVWTVKAKKK* |
| Ga0126448_10012139 | 3300009466 | Meromictic Pond | MRIKIIRFVVKALGYEWGGDSLNLPYWTVKAKKKDK* |
| Ga0126448_10275433 | 3300009466 | Meromictic Pond | MRIKIIKFIVKLLGYDWGGDALKAKIWTVKAKKK* |
| Ga0129333_1000375214 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKIIKFVVKLLGYEWSGDQLNLPVWQVRAKKKK* |
| Ga0129333_1000460123 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKIIKFVVKLLGYEWSGDNLNLPVWQVKAKKKAK* |
| Ga0129333_1000862322 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKKKK* |
| Ga0129333_100141817 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKKKKN* |
| Ga0129333_100428493 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKIIKFVVKLLGYEWSGDNLKLPVWYVKEKKKVK* |
| Ga0129333_100478556 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKIIKFIVKALGYEWSGDELKLPVWQVKAKTKKK* |
| Ga0129333_101420677 | 3300010354 | Freshwater To Marine Saline Gradient | WQEGEIMRIKIIKFVVKILGYEWSGDELKLPVWQVKAKQKKK* |
| Ga0129333_101696855 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKIIRFVVKILGYEWSGDQLKLPVWQVKEKTKKK* |
| Ga0129333_102409605 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKVKKK* |
| Ga0129333_102733682 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKQKKR* |
| Ga0129333_103941021 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKIIKFVVKLLGYEWSGDQLNLPVWQVKAKKKNK* |
| Ga0129333_107605811 | 3300010354 | Freshwater To Marine Saline Gradient | MRIKFIKFIVKLLGYEWGGDALKAPIWTIKAKAKKK* |
| Ga0129336_1000165213 | 3300010370 | Freshwater To Marine Saline Gradient | MRIKIIKFVVKLLGYEWSGDQLNLPVWQVKAKKKK* |
| Ga0129336_100537305 | 3300010370 | Freshwater To Marine Saline Gradient | MRIKIIKFVVKALGYEWSGDELKLPVCQVKAKTKKK* |
| Ga0129336_102197923 | 3300010370 | Freshwater To Marine Saline Gradient | RIKIIKFVVKILGYEWSGDELKLPVWQVKAKQKKK* |
| Ga0133913_100699778 | 3300010885 | Freshwater Lake | MRIKIIRFVVKALGYQWSGDELKLPVWYVKEKKKK* |
| Ga0151620_10083326 | 3300011268 | Freshwater | MRIKIIKTVVKLLGYEWGGDKLNAPIWTVKEKKKSK* |
| Ga0157137_1028803 | 3300012286 | Freshwater | MMRIKIIKFVVRVLGYEWGGDSLKLPYWTVKEKKK* |
| Ga0157138_10164751 | 3300012352 | Freshwater | VMRIKIIKCVVKVLGYEWGGDNLTAPIWTVKAKKK* |
| Ga0157138_10716672 | 3300012352 | Freshwater | MRIKIIRFVVKALGYEWGGDSLKLPYWTVKEKKKDK* |
| Ga0157203_10479232 | 3300012663 | Freshwater | MKGKSMRIKIIKFVVKILGYEWGGDNLHAPLWTVKAKKKK* |
| Ga0157210_10252163 | 3300012665 | Freshwater | MRIKIIKFVVKALGYEWGGDTLNAPIWTVKAKKK* |
| Ga0129337_10216673 | 3300012968 | Aqueous | MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKKKK* |
| Ga0129338_13002443 | 3300012970 | Aqueous | MIRIKIIKFVVKILGYEWGGDALRAPVWTVKAKKKK* |
| Ga0129338_13518233 | 3300012970 | Aqueous | MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKRKKN* |
| Ga0164293_1000032953 | 3300013004 | Freshwater | MMRIKIIKFVVKALGYQWSGDDLKLPVWYVKEKKKVK* |
| Ga0164293_100163638 | 3300013004 | Freshwater | MRLKIIKLVVKLLGYEWSGDNLKLPIWYVKEKKKSE* |
| Ga0164293_100859193 | 3300013004 | Freshwater | MRIKIIKAVVKLLGYEWGGDKLNLPYWTVKEKKKK* |
| Ga0164292_109318312 | 3300013005 | Freshwater | MRIKIIRFVVKALGYDWGGDSLKAPVWTVKAKKKK* |
| (restricted) Ga0172367_1001725613 | 3300013126 | Freshwater | MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKTKRNK* |
| (restricted) Ga0172367_102078522 | 3300013126 | Freshwater | MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKKKK* |
| (restricted) Ga0172367_104757972 | 3300013126 | Freshwater | MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKTKKK* |
| (restricted) Ga0172367_104757982 | 3300013126 | Freshwater | MRIKIIKFVVKLLGYEWSGDELKLPVWQIKAKTKKK* |
| (restricted) Ga0172373_100325126 | 3300013131 | Freshwater | MRIKIIKFIVKLLGYEWSGDELKLPVWQVKAKTKKTK* |
| (restricted) Ga0172372_101245474 | 3300013132 | Freshwater | MRIKIIKFVVKILGYEWSGDNLNLPVWQVKAKTKKK* |
| Ga0177922_100188813 | 3300013372 | Freshwater | MRIKIIRFVVKALGYEWGGDNLNVLVWTVKAKKKK* |
| Ga0119954_100043320 | 3300014819 | Freshwater | MRIKIIKFVVKLLGYEWGGDNLLAPIWTVKAKKK* |
| Ga0169931_100623365 | 3300017788 | Freshwater | MRIKIIKFVVKILGYEWSGDNLNLPVWQVKAKTKKK |
| Ga0169931_101015002 | 3300017788 | Freshwater | MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKTKKK |
| Ga0169931_102299444 | 3300017788 | Freshwater | MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKKKK |
| Ga0169931_104903952 | 3300017788 | Freshwater | MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKQKKK |
| Ga0188881_100277712 | 3300019146 | Freshwater Lake | MRIKIIKFVVKALGYEWSGDELKLPVWQVKAKTKKK |
| Ga0181359_10009645 | 3300019784 | Freshwater Lake | MRIKIIRAVVKLLGYEWGGDALNAPIWTVKAKKKK |
| Ga0181359_10431002 | 3300019784 | Freshwater Lake | MRIKVIRFVVKVLGYEWGGDALNVPVWTVKAKKKK |
| Ga0181359_11813483 | 3300019784 | Freshwater Lake | MRIKIIRFVVKALGYQWGGDALSAPVWTVKAKKKK |
| Ga0207193_103243516 | 3300020048 | Freshwater Lake Sediment | MRIKIIRAVVKLLGYEWGGDRLNAPIWTVKEKKKSK |
| Ga0207193_10346613 | 3300020048 | Freshwater Lake Sediment | MRIKFIRFVVKTLGYDWGGDNLNAPVWTVKAKKKK |
| Ga0194113_102003376 | 3300020074 | Freshwater Lake | MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKTKRNK |
| Ga0194113_103751794 | 3300020074 | Freshwater Lake | MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKTKKK |
| Ga0211732_10538297 | 3300020141 | Freshwater | MRIKIIRSVVKLLGYEWGGDNLNAPVWTVKAKKKK |
| Ga0211732_11729163 | 3300020141 | Freshwater | MRIKIIKAVVKLLGYEWLGDELNLPVWYVKEKKKSK |
| Ga0211732_12873815 | 3300020141 | Freshwater | MRIKIIRSIVKLLGYEWGGDNLNAPVWTVKAKKKK |
| Ga0211732_15256983 | 3300020141 | Freshwater | MRIKIIKFVVKALGYEWSGDELKLPVWQVKAKQKKK |
| Ga0211736_100532893 | 3300020151 | Freshwater | MRIKVIRFVVKALGYEWGGDLLNAPIWTVKAKKKK |
| Ga0211736_100847383 | 3300020151 | Freshwater | MRIKIIKAVVKLLGYEWGGDNLNAPIWTVKAKKKK |
| Ga0211736_103214922 | 3300020151 | Freshwater | MRIKIIKFVVKALGYQWSGDDLKLPVWYVKEKKKVK |
| Ga0211736_1070703812 | 3300020151 | Freshwater | MRIKIIKAVVKLLGYEWSGDELKLPIWYVKEKKRKR |
| Ga0211736_109622892 | 3300020151 | Freshwater | MRIKIIRAVVKLLGYEWGGDNLNAPVWTVKAKKKK |
| Ga0211736_109950542 | 3300020151 | Freshwater | MRIRIIRFVVKALGYEWGGDLLNAPIWTVKAKKKK |
| Ga0211734_100339963 | 3300020159 | Freshwater | MRIKLIRFVVKALGYEWGGDLLNAPIWTVKAKKKK |
| Ga0211734_102336207 | 3300020159 | Freshwater | MRIKIIRAVVKLLGYEWGGDNLNAPIWTVKEKKNKK |
| Ga0211734_107564617 | 3300020159 | Freshwater | MRLKIIKFVVKLLGYEWSGDNLKLPIWYVKEKKKSE |
| Ga0211733_111716792 | 3300020160 | Freshwater | MRIKIIRFVVKALGYEWGGDLLNAPIWTVKAKKKK |
| Ga0211726_100916713 | 3300020161 | Freshwater | MRIKIIRFVVKTLGYEWGGDNLNAPVWTVKAKKKK |
| Ga0211735_109765574 | 3300020162 | Freshwater | QGKVMRIKIIKAVVKLLGYEWLGDELNLPVWYVKEKKKSK |
| Ga0194116_100634459 | 3300020204 | Freshwater Lake | IMRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKTKKK |
| Ga0211731_103915352 | 3300020205 | Freshwater | MRIKIIRFVVKTLGYEWGGDLLNAPIWTVKAKKKK |
| Ga0208464_1019813 | 3300020482 | Freshwater | MRIKIIRFVVKALGYDWGGDNLNAPVWTVKAKKKK |
| Ga0208326_1019392 | 3300020494 | Freshwater | MRIKIIKFIVKALGYEWSGDQLNLPVWQVKAKTKKK |
| Ga0208050_10263503 | 3300020498 | Freshwater | MRIKIIKFVVKALGYEWSGDELKLPVWYIKDKKKK |
| Ga0208088_10332001 | 3300020505 | Freshwater | MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKS |
| Ga0208234_10068754 | 3300020515 | Freshwater | MRIKIIRFVVKALGYEWSGDELKLPVWYVKEKKKK |
| Ga0208223_10015735 | 3300020519 | Freshwater | MRIKIIKFVVKSLGYEWSGDELKLPVWYVKEKKKK |
| Ga0208232_10040794 | 3300020527 | Freshwater | MMRIKIIKFVVKALGYQWSGDDLKLPVWYVKEKKKVK |
| Ga0208232_10102134 | 3300020527 | Freshwater | MRIRIIRFVVKSLGYEWGGDLLNAPIWTVKAKKKK |
| Ga0208233_10043953 | 3300020529 | Freshwater | MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKAKKKN |
| Ga0208233_10291952 | 3300020529 | Freshwater | MRIKIIKFVVKALGYEWSGDELKLPVWYIKEKKKK |
| Ga0208233_10441751 | 3300020529 | Freshwater | MGKKGKVMRIKIIKLVVKLLGYEWRGDKLNLPVWTVKAKKK |
| Ga0208487_10331632 | 3300020531 | Freshwater | MRIKIIRFVVKTLGYEWLGDELNLPVWYVKEKKKSK |
| Ga0207942_10052584 | 3300020549 | Freshwater | MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKSK |
| Ga0208362_10000019 | 3300020558 | Freshwater | MRIKIIKFVVKLLGYEWSGDNLKLPVWYVKEKKKK |
| Ga0208362_10295042 | 3300020558 | Freshwater | MRIKFIRFVVKTLGYEWGGDNLNAPVWTVKAKKKK |
| Ga0207909_10105605 | 3300020572 | Freshwater | MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKKK |
| Ga0207909_10134272 | 3300020572 | Freshwater | MRIKIIRAVVKLLGYEWGGDKLNVPIWTVKEKKKK |
| Ga0194048_100005705 | 3300021519 | Anoxic Zone Freshwater | MRIKIIRFIVKTLGYEWGGDNLNAPVWTVKAKKKK |
| Ga0222714_100435745 | 3300021961 | Estuarine Water | MRIKIIRFIVKALGYEWSGDELKLPVWQVKAKQKKK |
| Ga0222714_101523162 | 3300021961 | Estuarine Water | MRIKIIKFVVKVLGYEWSGDELKLPVWQVKAKQKKK |
| Ga0222713_100211764 | 3300021962 | Estuarine Water | MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKNKK |
| Ga0222713_106338351 | 3300021962 | Estuarine Water | MIRIKIIKFVVKILGYEWGGDALRAPVWTVKAKKRK |
| Ga0222712_100724792 | 3300021963 | Estuarine Water | VRIKIIKFVVKALGYEWSGDELKLPIWYVKAKKKK |
| Ga0222712_101315974 | 3300021963 | Estuarine Water | MRIKIIRFVVKALGYEWGGDKLNLPYWTVKEKKKK |
| Ga0222712_105195091 | 3300021963 | Estuarine Water | MRIKIIKFVVRLLGYEWSGDELKLPVWYVKEKKKK |
| Ga0222712_106484643 | 3300021963 | Estuarine Water | MRIKIIRFVVKALGYEWGGDNLNAPIWTVKAKKKK |
| Ga0214921_10000213134 | 3300023174 | Freshwater | MRIKIIKFVVKVLGYEWGGENLKLPYWTVKGKKRNK |
| Ga0214921_1000029565 | 3300023174 | Freshwater | MRIKIIRFVVKALGYEWSGDELKLPIWYVKEKKKK |
| Ga0214921_1000373141 | 3300023174 | Freshwater | MRIKIIRFVVKALGYEWGGDALKAPVWTVKTKKKK |
| Ga0214921_100913002 | 3300023174 | Freshwater | MMRIKIIKFVVKVLGYQWSGDDLKLPVWYVKEKKKVK |
| Ga0247724_100003662 | 3300024239 | Deep Subsurface Sediment | MRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKAK |
| Ga0255147_100024619 | 3300024289 | Freshwater | MRIKIIKLIVKILGYEWSGDELKLPVWQVKAKQKKR |
| Ga0255147_10303181 | 3300024289 | Freshwater | MRIKIIRFVVKILGYEWSGDQLKLPVWQVKEKTKKK |
| Ga0255148_10391234 | 3300024306 | Freshwater | RGKIMRIKIIKFVVKLLGYEWSGDNLNLPVWQVKAKKKAK |
| Ga0244777_106367192 | 3300024343 | Estuarine | MRIKIIKFVVKALGYEWGGDSLNLPYWTVKEKKKK |
| Ga0244775_1000183263 | 3300024346 | Estuarine | MRIKIIRFVVKALGYEWGGDNLNAPVWTVKAKKKK |
| Ga0244775_1000183913 | 3300024346 | Estuarine | MRIKIIRFVVKALGYDWGGDALNVPVWTVKAKKKK |
| Ga0244775_1000305411 | 3300024346 | Estuarine | MEIGVEMRIKIIKFVVKSLGYEWSGDELKLPVWYVKEKKKK |
| Ga0244775_100220943 | 3300024346 | Estuarine | MRIKIIKFVVKALGYEWGGDSLNAPIWTVKAKKKK |
| Ga0244775_100270862 | 3300024346 | Estuarine | MRIRIIRFVVKALGYEWGGDALNVPIWTVKAKKKK |
| Ga0244775_101589412 | 3300024346 | Estuarine | MRIKIIRFVVKALGYDWGGDSLNAPVWTVKAKKKK |
| Ga0244775_102000951 | 3300024346 | Estuarine | MRIKIIRFVVKALGYQWGGDNLNVPVWTVKAKKKK |
| Ga0244775_102964031 | 3300024346 | Estuarine | MRIKIIRFVVKALGYEWGGDALNVPIWTVKAKKKK |
| Ga0244775_104196082 | 3300024346 | Estuarine | MRIRIIRFVVKALGYQWGGDLLNAPIWTVKAKKKK |
| Ga0244775_105760123 | 3300024346 | Estuarine | MRIKIIKTVVRLLGYEWGGDNLNAPIWTVKAKKKK |
| Ga0244775_113782293 | 3300024346 | Estuarine | MRIKIIRAMVKLLGYEWGGDSLNAPVWTVKAKKKK |
| Ga0255142_10511472 | 3300024352 | Freshwater | MRIKIIKFVVKILGYEWSGDELNLPVWQVKAKKKK |
| Ga0255268_11467403 | 3300024572 | Freshwater | GGKIMRIKIIKFVVKLLGYEWSGDNLNLPVWQVKAKKKAK |
| Ga0208424_10173551 | 3300025445 | Aqueous | GKIMRIKIIKFVVKLLGYEWSGDNLNLPIWYVKAKKKK |
| Ga0208546_100002659 | 3300025585 | Aqueous | MRIKIIKFVVKLLGYEWSGDNLNLPIWYVKAKKKK |
| Ga0208546_11431582 | 3300025585 | Aqueous | MRLKIIKFVVKALGYEWSGDNVKIPVWYVKEKKKK |
| Ga0255155_10664312 | 3300026455 | Freshwater | VRIKIIKFVVKILGYEWSGDNINLPVWQVKAKKKKNR |
| Ga0208009_10015578 | 3300027114 | Deep Subsurface | MRIRIIKTVVKLLGYEWSGDELKLPVWYVKEKKKK |
| Ga0255107_10196982 | 3300027136 | Freshwater | MRIKIIRFVVKALGYEWGGDSLNAPIWTVKAKKKK |
| Ga0255102_10373963 | 3300027144 | Freshwater | MKGKSMRIKIIKFVVKILGYEWGGDNLHAPLWTVKAKKKK |
| Ga0208022_10335004 | 3300027418 | Estuarine | MRINIIKFVVKALGYEWSGDELKLPVWYVKEKKKKK |
| Ga0208788_10358764 | 3300027499 | Deep Subsurface | MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKEKKKSK |
| Ga0209552_100027318 | 3300027563 | Freshwater Lake | MRIKIIRFVVKALGYQWGGDALNAPIWTVKAKKKK |
| Ga0209552_10635653 | 3300027563 | Freshwater Lake | MRIKIIKFVVKALGYEWGGDNLNVPVWTVKAKKKK |
| Ga0208966_100012530 | 3300027586 | Freshwater Lentic | MRIKIIRFVVKALGYEWGGDNLNLPYWTVKAKKKK |
| Ga0208133_10261275 | 3300027631 | Estuarine | VMRIKIIKFVVKSLGYEWSGDELKLPVWYVKEKKKK |
| Ga0209357_10699201 | 3300027656 | Freshwater Lake | MRIKIIRFVVKALGYEWGGDALNIPVWTVKAKKKK |
| Ga0209551_100050428 | 3300027689 | Freshwater Lake | MRIKIIRAMVKLLGYEWGGDNLNAPVWTVKAKKKK |
| Ga0209551_10277723 | 3300027689 | Freshwater Lake | MRIKIIKFVVKTLGYEWSGDELKLPIWYVKAKKKK |
| Ga0209551_12577032 | 3300027689 | Freshwater Lake | MRIKIIKIVVKLLGYEWGGDNLNAPIWTVKAKKKK |
| (restricted) Ga0247836_10113413 | 3300027728 | Freshwater | MRIKIIKFVVNLLGYEWSGDNLKLPVWYVKEKKKK |
| Ga0209087_100052534 | 3300027734 | Freshwater Lake | MRIKIIRFVVKALGYEWGGDFLNAPIWTVKAKKKK |
| Ga0209598_100308883 | 3300027760 | Freshwater Lake | MRIKIIRFVVKALGYEWGGDKLNAPIWTVKAKKKN |
| Ga0209770_1000106822 | 3300027769 | Freshwater Lake | MRIKIIRAVVKLLGYEWGGDSLNAPVWTVKAKKKK |
| Ga0209770_100067705 | 3300027769 | Freshwater Lake | MRIKIIKFVVKALGYDWGGDSLKAPVWTVKAKKKK |
| Ga0209770_102272673 | 3300027769 | Freshwater Lake | MRIKIIKFVVKALGYEWSGDELKLPIWYVKAKKKK |
| Ga0209500_104381011 | 3300027782 | Freshwater Lake | MRIKIIRFVVKALGYQWSGDELKLPVWYVKEKKKK |
| Ga0209972_1000264621 | 3300027793 | Freshwater Lake | MRIKIIKFVVKLLGYEWSGDNLNLPVWQVKAKKKGK |
| Ga0209107_102941103 | 3300027797 | Freshwater And Sediment | MRIKIIRAVVKLLGYEWGGDLLNAPIWTVKAKKKK |
| Ga0209358_102245372 | 3300027804 | Freshwater Lake | MRIKIIRFVVKALGYEWSGDELKLPVWQVKAKQKKK |
| Ga0209229_100872492 | 3300027805 | Freshwater And Sediment | MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKK |
| Ga0209230_101289021 | 3300027836 | Freshwater And Sediment | MRIKIIRFVVKTLGYEWGGDQLNLPYWTVKEKKKK |
| Ga0209230_101853811 | 3300027836 | Freshwater And Sediment | MRIKIIKFVVKTLGYEWGGDQLNLPYWTVKEKKKTK |
| Ga0209550_102325703 | 3300027892 | Freshwater Lake | KGYQVMRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKSK |
| Ga0209550_104020513 | 3300027892 | Freshwater Lake | MRIKIIKFVVKALGYEWGGDALNAPVWTVKAKKKK |
| Ga0209550_104064882 | 3300027892 | Freshwater Lake | MRIKIIRSVVKLLGYEWGGDSLNAPVWTVKAKKKK |
| Ga0209550_104255703 | 3300027892 | Freshwater Lake | MRIKIIKAVVKLLGYEWSGDELKLPVWYVKEKKKK |
| Ga0209298_1000021847 | 3300027973 | Freshwater Lake | MRIKIIKFVVKLLGYEWSGDNLKLPYWTVKAKKKK |
| Ga0247723_1000055116 | 3300028025 | Deep Subsurface Sediment | MRIKIIKFVVKALGYEWGGDSLKAPIWTVKEKKKK |
| Ga0247723_10018328 | 3300028025 | Deep Subsurface Sediment | MRIKIIRFVVKTLGYEWGGDNLNAPIWTVKAKKKK |
| Ga0119944_10344253 | 3300029930 | Aquatic | MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKKKIK |
| Ga0315907_1000157916 | 3300031758 | Freshwater | MRIKIIKFVVKFLGYEWSGDNVNLPVWQVKAKKKNK |
| Ga0315907_100905723 | 3300031758 | Freshwater | MRIKIIKFIVKTLGYEWGGDNLNAPIWTIKAKKKK |
| Ga0315907_101543384 | 3300031758 | Freshwater | MRIKIIKLVVKLLGYEWSGDNLNLPVWQVKAKKKGK |
| Ga0315909_1002511712 | 3300031857 | Freshwater | MRIKIIKFVVKVLGYEWSGDNLNLPVWQVKAKKKGK |
| Ga0315904_1000307427 | 3300031951 | Freshwater | MRLKIIKFVVKLMGYEWSGDELKLPVWQVKAKKKK |
| Ga0315904_1001317917 | 3300031951 | Freshwater | MRIKIIKAVVKLLGYEWSGDELKLPVWQVKAKKKK |
| Ga0315904_1001448023 | 3300031951 | Freshwater | VVKENQIMRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKK |
| Ga0315904_106014243 | 3300031951 | Freshwater | MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKKNK |
| Ga0315904_112434041 | 3300031951 | Freshwater | MRIKIIKFVVKALGYEWSGDELKLPVWQIKAKQKKK |
| Ga0315905_1000560223 | 3300032092 | Freshwater | MRIKVIKFVVKALGYEWSGDDLKLPVWYVKEKKKK |
| Ga0315903_108250441 | 3300032116 | Freshwater | IMRIKIIKAVVKLLGYEWSGDELKLPVWQVKAKKKK |
| Ga0334980_0000095_6251_6361 | 3300033816 | Freshwater | MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKNKK |
| Ga0334979_0000654_10523_10633 | 3300033996 | Freshwater | MRLKIIKLVVKLLGYEWSGDNLKLPIWYVKEKKKSE |
| Ga0334991_0425139_236_343 | 3300034013 | Freshwater | MRIKIIKFVVKALGYEWSGDELRLPVWYVKEKKKK |
| Ga0334985_0768636_259_366 | 3300034018 | Freshwater | MRIRIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKK |
| Ga0335005_0139568_1212_1322 | 3300034022 | Freshwater | MRIKIIKFVVKALGYEWSGDDLKLPVWYVKEKKKNK |
| Ga0335019_0000027_69530_69637 | 3300034066 | Freshwater | MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKEKKKK |
| Ga0335019_0001030_659_766 | 3300034066 | Freshwater | MRIKIIRFVVKALGYDWGGDSLKAPVWTVKAKKKK |
| Ga0335019_0062540_1337_1459 | 3300034066 | Freshwater | MKGKSMRIKIIRFVVKILGYEWGGDNLHAPIWTVRAKKKK |
| Ga0335028_0070094_58_171 | 3300034071 | Freshwater | MRIKIIKFVVKALGYEWSGDNLKLPVWYVKEKKKEVK |
| Ga0310127_019398_899_1009 | 3300034072 | Fracking Water | MRIKIIKFVVKALGYEWSGDELKLPVWYVKAKTKKK |
| Ga0310130_0000204_36973_37101 | 3300034073 | Fracking Water | VGEKSKMRIKIIKFVVKALGYEWSGDELKLPVWYVKAKKKKK |
| Ga0310130_0003909_2013_2129 | 3300034073 | Fracking Water | MRIKIIKFVVKILGYQWGGDSLNAPIWTVKAKKNDNKK |
| Ga0335025_0002251_7905_8015 | 3300034096 | Freshwater | MRIKIIKFVVKLLGYEWSGDNLKLPVWQVKAKTKNK |
| Ga0335027_0613770_270_380 | 3300034101 | Freshwater | MRIKIIKLVVKLLGYEWSGDDLKLPVWYVKEKKNKK |
| Ga0335036_0316488_879_989 | 3300034106 | Freshwater | MRIKIIKFVVKALGYEWSGDSLKLPVWYVKEKKKVK |
| Ga0335065_0788095_95_202 | 3300034200 | Freshwater | MRIKIIKFVVKALGYEWGGDNLNLAYWTVKEKKKK |
| ⦗Top⦘ |