


| Basic Information | |
|---|---|
| Family ID | F010324 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 305 |
| Average Sequence Length | 42 residues |
| Representative Sequence | DLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 305 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.74 % |
| % of genes from short scaffolds (< 2000 bps) | 87.54 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.459 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (53.770 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.115 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.951 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 305 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 9.51 |
| PF13578 | Methyltransf_24 | 3.28 |
| PF00404 | Dockerin_1 | 2.30 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.98 |
| PF01041 | DegT_DnrJ_EryC1 | 0.98 |
| PF08241 | Methyltransf_11 | 0.33 |
| PF02675 | AdoMet_dc | 0.33 |
| PF07847 | PCO_ADO | 0.33 |
| PF13489 | Methyltransf_23 | 0.33 |
| PF00157 | Pou | 0.33 |
| PF08299 | Bac_DnaA_C | 0.33 |
| COG ID | Name | Functional Category | % Frequency in 305 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 9.51 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.98 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.98 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.98 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.98 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.98 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.33 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.33 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.46 % |
| All Organisms | root | All Organisms | 25.90 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 1.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 53.77% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 9.18% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.57% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.59% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.93% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.62% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 2.62% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.62% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.97% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.97% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.31% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.98% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.98% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.98% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.98% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.66% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.66% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.66% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.33% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.33% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.33% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.33% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.33% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.33% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.33% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.33% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.33% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300001855 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012966 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022867 | Saline water microbial communities from Ace Lake, Antarctica - #1 | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100992931 | 3300000115 | Marine | EIEQKMDLFFEKLQSMPWWMVGLWVSVVAAIYGIKASEIKNFSK* |
| DelMOSpr2010_100182871 | 3300000116 | Marine | KLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK* |
| DelMOSpr2010_101038001 | 3300000116 | Marine | KMDLFFEKLQSMPWWMVGLWVSVVAAIYGIKASEIKNFSK* |
| DelMOSpr2010_101113511 | 3300000116 | Marine | AKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK* |
| DelMOSpr2010_101806171 | 3300000116 | Marine | KLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK* |
| DelMOSpr2010_102747693 | 3300000116 | Marine | KLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK* |
| JGI24005J15628_101536712 | 3300001589 | Marine | MDLFFEKLEMMPWWLVGLWVSVVAAIYGIKASEITKLNKK* |
| JGI11772J19994_10167101 | 3300001748 | Saline Water And Sediment | KLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNGGK* |
| JGI11772J19994_10221034 | 3300001748 | Saline Water And Sediment | DLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK* |
| JGI2160J19893_100290931 | 3300001855 | Marine Sediment | LDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNNGGKK* |
| KVWGV2_106561504 | 3300002242 | Marine Sediment | IERKMDLFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSK* |
| Ga0055584_1011313551 | 3300004097 | Pelagic Marine | MDLFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSK* |
| Ga0055584_1018622633 | 3300004097 | Pelagic Marine | EGMSQKLDIYFEKLQAMPWWITGLWISVVAAIYGIKATDIINTKKGK* |
| Ga0074648_10811891 | 3300005512 | Saline Water And Sediment | KMQAKIDLYFQKLQEMPWWIVGLWVTVVTAIYGLKATDVINMNKNGGK* |
| Ga0074648_10863351 | 3300005512 | Saline Water And Sediment | KLQDMPGWIVGLWVSVVAAIYGLKATDVINMNKQK* |
| Ga0074648_10975421 | 3300005512 | Saline Water And Sediment | QEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK* |
| Ga0074648_11104551 | 3300005512 | Saline Water And Sediment | QKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK* |
| Ga0074648_11374291 | 3300005512 | Saline Water And Sediment | LQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNK* |
| Ga0074648_12140421 | 3300005512 | Saline Water And Sediment | FQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK* |
| Ga0074647_10038881 | 3300005611 | Saline Water And Sediment | LQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK* |
| Ga0074647_10119531 | 3300005611 | Saline Water And Sediment | QEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK* |
| Ga0074647_10363941 | 3300005611 | Saline Water And Sediment | EDISKKLDLYFEKLQAMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0075474_100851684 | 3300006025 | Aqueous | DLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGKK* |
| Ga0075474_101100674 | 3300006025 | Aqueous | KLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKQK* |
| Ga0075474_101170791 | 3300006025 | Aqueous | YFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK* |
| Ga0075474_101902374 | 3300006025 | Aqueous | YFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK* |
| Ga0075474_102067791 | 3300006025 | Aqueous | QKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNGGK* |
| Ga0075474_102363431 | 3300006025 | Aqueous | KIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK* |
| Ga0075474_102647033 | 3300006025 | Aqueous | IDLYFQKLQEMPWWIVGLWVSVVAAIYGIKATDVINMNKNK* |
| Ga0075478_101019971 | 3300006026 | Aqueous | YFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINVNKNK* |
| Ga0075478_101308305 | 3300006026 | Aqueous | LDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK* |
| Ga0075462_100975191 | 3300006027 | Aqueous | IEAKLDLYFEKLSAMPWWITGLWISVVAAIYGIKATDIIKTNGGKNNGK* |
| Ga0075462_101314781 | 3300006027 | Aqueous | DLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK* |
| Ga0075466_11084781 | 3300006029 | Aqueous | EQKMDLFFEKLQSMPWWMVGLWVSVVAAIYGIKASEIKNFSK* |
| Ga0075502_10284871 | 3300006357 | Aqueous | IQAKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK* |
| Ga0075503_10360475 | 3300006400 | Aqueous | LDLYFEKLSAMPWWITGLWISVVAAIYGIKATDIIKTNGGKNNGK* |
| Ga0075503_16905412 | 3300006400 | Aqueous | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK* |
| Ga0075506_10305711 | 3300006401 | Aqueous | EKLSAMPWWITGLWISVVAAIYGIKATDIIKTNGGKNNGK* |
| Ga0075511_11224603 | 3300006402 | Aqueous | LYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK* |
| Ga0075461_100662926 | 3300006637 | Aqueous | DLFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSGK* |
| Ga0075461_100897941 | 3300006637 | Aqueous | KIGQKLDLYFEKLQAMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0070749_100136941 | 3300006802 | Aqueous | KMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVMNMNKK* |
| Ga0070749_101524491 | 3300006802 | Aqueous | DLYFEKLQAMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0070749_102250761 | 3300006802 | Aqueous | KIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKSK* |
| Ga0070749_103434204 | 3300006802 | Aqueous | KLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0070749_105355351 | 3300006802 | Aqueous | LDLYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0070749_105578911 | 3300006802 | Aqueous | EKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK* |
| Ga0070749_106304501 | 3300006802 | Aqueous | LDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0070749_106448654 | 3300006802 | Aqueous | QQKIDLYFQKLQEMPWWIVGLWASVVAAIYGLKATDIINMNKNK* |
| Ga0070749_106797111 | 3300006802 | Aqueous | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMYKK* |
| Ga0070749_107736671 | 3300006802 | Aqueous | DLYFQKLQDMPWWVVGLWVSVVAAVYGLKATDVINMNKNK* |
| Ga0070754_103603341 | 3300006810 | Aqueous | LYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNNGGKR* |
| Ga0070754_103815871 | 3300006810 | Aqueous | AKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0070754_103969871 | 3300006810 | Aqueous | KMQEKIDLYFQKLQEMPWWIVGLWVSVGAAIYGLKATDVINMNKK* |
| Ga0070754_104158171 | 3300006810 | Aqueous | FAEDEKMQEKIVLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK* |
| Ga0070754_104724413 | 3300006810 | Aqueous | EKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK* |
| Ga0075476_100699433 | 3300006867 | Aqueous | EDEKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDIMNMNKK* |
| Ga0075476_101311851 | 3300006867 | Aqueous | AEDPALEKKLDLYFEKLQNMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0075476_101632381 | 3300006867 | Aqueous | EDEKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVMNMNKK* |
| Ga0075476_102301571 | 3300006867 | Aqueous | EDEDISKKLDLYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0075476_102618891 | 3300006867 | Aqueous | DLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK* |
| Ga0075476_103010371 | 3300006867 | Aqueous | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINVNKNK* |
| Ga0075476_103572853 | 3300006867 | Aqueous | QAKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0075481_101328285 | 3300006868 | Aqueous | KLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0075481_101614484 | 3300006868 | Aqueous | QAKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK* |
| Ga0075479_102525793 | 3300006870 | Aqueous | SVFAEDEKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGIKATDVINMNKNK* |
| Ga0075475_101361111 | 3300006874 | Aqueous | KMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINVNKNK* |
| Ga0070750_1001438812 | 3300006916 | Aqueous | EKLQAMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0070750_100333697 | 3300006916 | Aqueous | DLYFQKLQEMPWWIVGLWVTVVTAIYGLKATDVINMNKNK* |
| Ga0070750_103979313 | 3300006916 | Aqueous | FQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNK* |
| Ga0070750_104430031 | 3300006916 | Aqueous | KLSAMPWWITGLWVSVVAAIYGIKATDIIKTNGGKNNGK* |
| Ga0070746_100636561 | 3300006919 | Aqueous | EKIGQKLDLYFEKLQNMPWWVTGLWISVVAAVYGIKATDIINTKKSK* |
| Ga0070746_103971551 | 3300006919 | Aqueous | IVSLWVSVVAAIYGIKATDLIKTNGSKK*KRK*K* |
| Ga0070746_104761121 | 3300006919 | Aqueous | EIGQKLDLYFEKLQTMPWWITGLWISVVAAVYGIKATDIINTKKVK* |
| Ga0070746_104893141 | 3300006919 | Aqueous | KMQAKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK* |
| Ga0070748_12945613 | 3300006920 | Aqueous | LFFEKLQSMPWWMVGLWVSVVAAIYGIKASEIKNFSK* |
| Ga0098045_11350312 | 3300006922 | Marine | ERKMDLFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSK* |
| Ga0075110_10614481 | 3300007074 | Saline Lake | EDIGKKLDLYFDKLDGMPWWITGLWISVVAAIYGIKATDIINTKKGK* |
| Ga0075460_101050206 | 3300007234 | Aqueous | DLYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0075460_102138511 | 3300007234 | Aqueous | DLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0075460_102918313 | 3300007234 | Aqueous | LYFQKLQDMPWWVVGLWVSVVAAVYGLKATDVINMNKNK* |
| Ga0070745_11174681 | 3300007344 | Aqueous | EKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVMNMNKK* |
| Ga0070745_13531571 | 3300007344 | Aqueous | KLQGMPWWITGLWISVVAAVYGIKATDIINTKKGKNKCFHGVY* |
| Ga0070752_12794113 | 3300007345 | Aqueous | KLQQMPWWLTGLWISVVAAIYGLKATDIIKTNGK* |
| Ga0070752_13182801 | 3300007345 | Aqueous | KLQEMPWWIVGLWVSVVAAIYGLKATDIMNMNKK* |
| Ga0070752_13186671 | 3300007345 | Aqueous | QKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNK* |
| Ga0070752_13446413 | 3300007345 | Aqueous | AEDEDISKKLDLYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0070753_10131651 | 3300007346 | Aqueous | DLYFQKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0070753_11638152 | 3300007346 | Aqueous | KMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDIMNMNKK* |
| Ga0099851_12710881 | 3300007538 | Aqueous | QAKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKDNGKR* |
| Ga0099851_12855251 | 3300007538 | Aqueous | FMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0099851_13321871 | 3300007538 | Aqueous | QAKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0099849_11697831 | 3300007539 | Aqueous | DISKKLDLYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0099849_12663421 | 3300007539 | Aqueous | TKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK* |
| Ga0099847_10603485 | 3300007540 | Aqueous | LYFEKLQGMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0099847_10654263 | 3300007540 | Aqueous | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDIMNMNKK* |
| Ga0099847_10845753 | 3300007540 | Aqueous | LYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0099847_10953751 | 3300007540 | Aqueous | DLYFQKLQEMPWWIVSLWVSVVAAIYGIKATELIKTNGKK* |
| Ga0099847_11446371 | 3300007540 | Aqueous | EDISKKLDLYFEKLQGMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0099847_11948083 | 3300007540 | Aqueous | QEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNK* |
| Ga0099847_12181591 | 3300007540 | Aqueous | IEQKMDLFFEKLQSMPWWMVGLWVSVVAAIYGIKASEIKNFSK* |
| Ga0099848_12851791 | 3300007541 | Aqueous | LDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNNGGKR* |
| Ga0099848_12933993 | 3300007541 | Aqueous | DKMQAKIDLYFQKLQDMPWWVVGLWVSVVAAVYGHKATDVINMNKNK* |
| Ga0099846_10652391 | 3300007542 | Aqueous | AKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGKK* |
| Ga0099846_11854305 | 3300007542 | Aqueous | VFAEDDKMQAKIDLYFQKLQDMPWWVVGLWVSVVAAVYGLKATDVINMNKNK* |
| Ga0099846_13055793 | 3300007542 | Aqueous | LQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK* |
| Ga0099846_13232052 | 3300007542 | Aqueous | YFQKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK* |
| Ga0070751_13441684 | 3300007640 | Aqueous | YFQKLQEMPWWIVGLWVTVVTAIYGLKATDVINMNKNK* |
| Ga0075480_100933328 | 3300008012 | Aqueous | DLYFEKLQGMPWWVTGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0075480_104527993 | 3300008012 | Aqueous | YFQKLQEMLWRIVGLWVSVVAAIYGLKATDVINMNKNK* |
| Ga0102963_13263791 | 3300009001 | Pond Water | IDLYFQKLQEMPWWIVGLWASVVAAIYGLKATDIINMNKGK* |
| Ga0102957_10248411 | 3300009027 | Pond Water | QEMPWWIVSLWVSVVAAIYGIKATDLIKTNGRKK* |
| Ga0102957_12846621 | 3300009027 | Pond Water | YFQKLQEMPWWIVGLWVSVVAAIYGIKATDIINTKNGGKK* |
| Ga0115566_102424811 | 3300009071 | Pelagic Marine | EIERKMDLFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSK* |
| Ga0114918_102758901 | 3300009149 | Deep Subsurface | MKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK* |
| Ga0114918_105784481 | 3300009149 | Deep Subsurface | QEKIDLYFQKLQEMSWWIVGLWVSVVAAIYGLKATDVISVNKNK* |
| Ga0114918_106171231 | 3300009149 | Deep Subsurface | IQAKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK* |
| Ga0114918_107536033 | 3300009149 | Deep Subsurface | QKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK* |
| Ga0114996_105522141 | 3300009173 | Marine | LDLYFDKLDSMPWWITGLWVSVVAAIYGIKATDIIKTNKK* |
| Ga0114996_110273803 | 3300009173 | Marine | KMDLFFEKLQSMPWWMVGLWVSVVAAIYGIKASEITKLNKK* |
| Ga0114994_106822481 | 3300009420 | Marine | DGMPWWITGLWISVVAAIYGIKATDIIKTNGSKK* |
| Ga0114998_100691737 | 3300009422 | Marine | KKLDLYFEKLDGMPWWITGLWISVVAAIYGIKATDIIKTNGSKK* |
| Ga0114998_103320141 | 3300009422 | Marine | KLDSMPWWITGLWVSVVAAIYGIKATDIIKTNKK* |
| Ga0115546_12100393 | 3300009435 | Pelagic Marine | FFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSK* |
| Ga0115558_11413231 | 3300009449 | Pelagic Marine | EIERKMDLFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSGK* |
| Ga0126447_10224291 | 3300009470 | Meromictic Pond | QQKLDLYFEKLQSMPWWITGLWISVVAAIYGIKATDIINTKKGEK* |
| Ga0127390_10112261 | 3300009474 | Meromictic Pond | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINTNKGK* |
| Ga0115003_105268871 | 3300009512 | Marine | KMDLFFEKLEMMPWWLVGLWVSVVAAIYGIKASEITKLNKK* |
| Ga0098043_11126071 | 3300010148 | Marine | MDMFFEKLQAMPWWLVGLWVSVVAAIYGIKASEIKNFSK* |
| Ga0129348_10048081 | 3300010296 | Freshwater To Marine Saline Gradient | LQEMPWWIVGLWVSVVAAIYGLKATDIINMNKGGK* |
| Ga0129348_11943581 | 3300010296 | Freshwater To Marine Saline Gradient | LQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKDNGKR* |
| Ga0129348_12040374 | 3300010296 | Freshwater To Marine Saline Gradient | KLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK* |
| Ga0129348_12187563 | 3300010296 | Freshwater To Marine Saline Gradient | KLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK* |
| Ga0129348_12969694 | 3300010296 | Freshwater To Marine Saline Gradient | LYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0129345_12100764 | 3300010297 | Freshwater To Marine Saline Gradient | MKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0129345_12116504 | 3300010297 | Freshwater To Marine Saline Gradient | DLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK* |
| Ga0129345_12654193 | 3300010297 | Freshwater To Marine Saline Gradient | DEKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK* |
| Ga0129345_12971011 | 3300010297 | Freshwater To Marine Saline Gradient | IDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK* |
| Ga0129345_13452553 | 3300010297 | Freshwater To Marine Saline Gradient | LDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK* |
| Ga0129342_12415671 | 3300010299 | Freshwater To Marine Saline Gradient | NLYFEKLQGMPWWITGLWISVVAAVYGIKATDIINTKKTK* |
| Ga0129351_11077294 | 3300010300 | Freshwater To Marine Saline Gradient | EEIQAKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGKK* |
| Ga0129351_11213225 | 3300010300 | Freshwater To Marine Saline Gradient | KLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0129351_12131151 | 3300010300 | Freshwater To Marine Saline Gradient | LDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0129351_12956671 | 3300010300 | Freshwater To Marine Saline Gradient | KEIEAKLDLYFEKLSAMPWWITGLWISVVAAIYGIKATDIIKTNGGKNNGK* |
| Ga0129351_13362971 | 3300010300 | Freshwater To Marine Saline Gradient | LNLYFEKLQGMPWWITGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0136655_10359351 | 3300010316 | Freshwater To Marine Saline Gradient | FQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGKK* |
| Ga0136655_12094671 | 3300010316 | Freshwater To Marine Saline Gradient | FQKLQEMPWWIVGLWVSVVAAINGLKATDVINMNKGK* |
| Ga0136656_10222428 | 3300010318 | Freshwater To Marine Saline Gradient | LYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGKK* |
| Ga0136656_11693554 | 3300010318 | Freshwater To Marine Saline Gradient | DLYFEKLQNMPWWVTGLWISVVAAVYGIKATDIINTKKGK* |
| Ga0136656_12824031 | 3300010318 | Freshwater To Marine Saline Gradient | KMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK* |
| Ga0129324_1000793915 | 3300010368 | Freshwater To Marine Saline Gradient | EKLQTMPWWITGLWISVVAAVYGIKATYIINTKKGK* |
| Ga0129324_104145011 | 3300010368 | Freshwater To Marine Saline Gradient | EMPWWIVGLWVSVVAAIYGLKATDVINMNKNGGK* |
| Ga0129324_104396171 | 3300010368 | Freshwater To Marine Saline Gradient | DISKKLDLYFSKLQDMPWWITGLWISVVAAVYGIKATNIINTKKGK* |
| Ga0129336_101279651 | 3300010370 | Freshwater To Marine Saline Gradient | IQAKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0129336_107130291 | 3300010370 | Freshwater To Marine Saline Gradient | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNGGK* |
| Ga0129352_106886711 | 3300012528 | Aqueous | EIQAKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK* |
| Ga0160422_102162311 | 3300012919 | Seawater | EIERKMDLFFDKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFNK* |
| Ga0163110_112525151 | 3300012928 | Surface Seawater | FEKLQQMPWWLVSLWISIVAAIYGIKATDLVKRK* |
| Ga0129341_11234485 | 3300012966 | Aqueous | FQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK* |
| Ga0180120_100601801 | 3300017697 | Freshwater To Marine Saline Gradient | AKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGKK |
| Ga0180120_104392862 | 3300017697 | Freshwater To Marine Saline Gradient | EDDKMQAKIDLYFQKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK |
| Ga0181403_11051971 | 3300017710 | Seawater | IEQKMDLFFEKLQSMPWWMVGLWVSVVAAIYGIKASEIKNFSK |
| Ga0181404_11027344 | 3300017717 | Seawater | DLFFEKLQSMPWWMVGLWVSVVAAIYGIKASEIKNFSK |
| Ga0181417_10627221 | 3300017730 | Seawater | KMDLFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSK |
| Ga0181417_10853191 | 3300017730 | Seawater | RKMDLFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSK |
| Ga0181411_11958061 | 3300017755 | Seawater | MDLFFEKLQSMPWWMVGLWVSVVAAIYGIKASEIKNFSK |
| Ga0181424_100344371 | 3300017786 | Seawater | DIQNKIDLYFAKLQQMPWWLVSLWIAIVSAIYGIKATDLIKKK |
| Ga0181565_108609521 | 3300017818 | Salt Marsh | ENISKKLDLYFEKLQGMPWWITGLWVSVVAAIYGIKATDIIKTNGGKK |
| Ga0181584_108071993 | 3300017949 | Salt Marsh | EKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK |
| Ga0181607_105028911 | 3300017950 | Salt Marsh | QNKIDLYFAKLQEMPWWLVSLWIAIVSAIYGIKATDLIKKK |
| Ga0181583_101365896 | 3300017952 | Salt Marsh | IDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK |
| Ga0181580_105205574 | 3300017956 | Salt Marsh | QKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK |
| Ga0181580_107121521 | 3300017956 | Salt Marsh | KLQAMPWWITGLWVSVVAAIYGIKATDIIKTNGSKK |
| Ga0181580_108404673 | 3300017956 | Salt Marsh | QKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNNGN |
| Ga0181580_109764443 | 3300017956 | Salt Marsh | MKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK |
| Ga0180437_103374641 | 3300017963 | Hypersaline Lake Sediment | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK |
| Ga0181590_103443281 | 3300017967 | Salt Marsh | YFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK |
| Ga0181590_106621334 | 3300017967 | Salt Marsh | DLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK |
| Ga0180438_106462181 | 3300017971 | Hypersaline Lake Sediment | AKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK |
| Ga0180433_105952534 | 3300018080 | Hypersaline Lake Sediment | LYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK |
| Ga0181592_101456521 | 3300018421 | Salt Marsh | DLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGKK |
| Ga0181592_102224691 | 3300018421 | Salt Marsh | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVMNMNKK |
| Ga0181591_108973691 | 3300018424 | Salt Marsh | FQKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK |
| Ga0181604_103969272 | 3300020191 | Salt Marsh | KLDLYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0211677_102542183 | 3300020385 | Marine | LFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSGK |
| Ga0211678_101946115 | 3300020388 | Marine | MDLFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSGK |
| Ga0211579_103988091 | 3300020472 | Marine | FFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSK |
| Ga0194129_106155312 | 3300020578 | Freshwater Lake | YFEKLQAMPWWITALWISVVAAIYGLKATDLIKTNQK |
| Ga0181598_13039831 | 3300020810 | Salt Marsh | LYFAKLQEMPWWLVSLWIAIVSAIYGIKATDLIKKK |
| Ga0213869_103161381 | 3300021375 | Seawater | EIERKMDLFFEKLQSMPWWLVGLWVSVVAAIYGIKASEIKNFSGK |
| Ga0213864_101395717 | 3300021379 | Seawater | EIQAKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK |
| Ga0222718_103430514 | 3300021958 | Estuarine Water | FMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK |
| Ga0222716_101756431 | 3300021959 | Estuarine Water | LYFEKLQNMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0222716_102887484 | 3300021959 | Estuarine Water | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNGGK |
| Ga0222716_105888223 | 3300021959 | Estuarine Water | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK |
| Ga0222715_101228056 | 3300021960 | Estuarine Water | KLQEMPWWIVGLWVTVVTAIYGLKATDVINMNKTK |
| Ga0222715_102462895 | 3300021960 | Estuarine Water | QAKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK |
| Ga0222714_1002015514 | 3300021961 | Estuarine Water | IGQKLDLYFEKLQGMPWWITGLWISVVAAVYGIKATDIINTNKNNGVKK |
| Ga0222714_101844485 | 3300021961 | Estuarine Water | FDKLESMPWWVVGLWISVVAAVYGIKATDIINTKKGK |
| Ga0222714_102881465 | 3300021961 | Estuarine Water | IDLYFQKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK |
| Ga0222714_103242661 | 3300021961 | Estuarine Water | LYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK |
| Ga0222713_100864419 | 3300021962 | Estuarine Water | DKMQAKIDLYFQKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKK |
| Ga0222713_105596911 | 3300021962 | Estuarine Water | EIQAKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK |
| Ga0222719_100863201 | 3300021964 | Estuarine Water | YFQKLQEMPWWIVGLWVTVVTAIYGLKATDVINMNKTK |
| Ga0222719_103525414 | 3300021964 | Estuarine Water | TKLDTFFTKLEQMPWWIVGLWASVVAAIYGLKATDIINTKKK |
| Ga0212030_10502173 | 3300022053 | Aqueous | FMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK |
| Ga0212030_10611653 | 3300022053 | Aqueous | EKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK |
| Ga0212030_10649501 | 3300022053 | Aqueous | QKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK |
| Ga0212030_10666233 | 3300022053 | Aqueous | KIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK |
| Ga0212025_10827573 | 3300022057 | Aqueous | KWIQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNK |
| Ga0212025_10964523 | 3300022057 | Aqueous | LDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK |
| Ga0212029_10527951 | 3300022063 | Aqueous | IYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKSK |
| Ga0212024_10257661 | 3300022065 | Aqueous | QAKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK |
| Ga0212024_10837641 | 3300022065 | Aqueous | DLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK |
| Ga0212026_10581641 | 3300022069 | Aqueous | KLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK |
| Ga0196893_10197681 | 3300022159 | Aqueous | EKLQEMPWWIVGLWVSVVAAIYGLKATDVINVNKNK |
| Ga0196893_10199733 | 3300022159 | Aqueous | KEIQAKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK |
| Ga0212020_10470605 | 3300022167 | Aqueous | LQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK |
| Ga0212027_10349181 | 3300022168 | Aqueous | QAKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNNGGKK |
| Ga0196903_10219793 | 3300022169 | Aqueous | DEKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK |
| Ga0212031_10178391 | 3300022176 | Aqueous | MKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK |
| Ga0212031_10947821 | 3300022176 | Aqueous | EKLQGMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0212031_10986162 | 3300022176 | Aqueous | MQQKIDLYFEKLEAMPWWIVGLWVSVVAAIYGIKATDIINTKRK |
| Ga0196899_10695971 | 3300022187 | Aqueous | KLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK |
| Ga0196899_11069645 | 3300022187 | Aqueous | LSAMPWWITGLWISVVAAIYGIKATDIIKTNGGKNNGK |
| Ga0196899_11961172 | 3300022187 | Aqueous | LNLYFEKLQGMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0196905_10587685 | 3300022198 | Aqueous | EIQAKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK |
| Ga0196905_11318324 | 3300022198 | Aqueous | KLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK |
| Ga0196905_11646871 | 3300022198 | Aqueous | IDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNGGK |
| Ga0196901_10054701 | 3300022200 | Aqueous | QEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNK |
| Ga0196901_100547814 | 3300022200 | Aqueous | EKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDIINMNKNK |
| Ga0196901_10655371 | 3300022200 | Aqueous | MQAKIDLYFQKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK |
| Ga0196901_10788773 | 3300022200 | Aqueous | EKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKSK |
| Ga0222629_10110291 | 3300022867 | Saline Water | KKLDLYFDKLDGMPWWITGLWISVVAAIYGIKATDIIKTNGSKK |
| Ga0255769_102636841 | 3300022927 | Salt Marsh | QAKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGKK |
| Ga0255751_104845261 | 3300023116 | Salt Marsh | QKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK |
| Ga0210003_10055041 | 3300024262 | Deep Subsurface | LYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNGGK |
| Ga0210003_11024422 | 3300024262 | Deep Subsurface | KLQEMPWWIVGLWVSVVAAIYGLKATDIMNMNKGK |
| Ga0210003_13142951 | 3300024262 | Deep Subsurface | QEKIDLYFQKLQEMSWWIVGLWVSVVAAIYGLKATDVISVNKNK |
| Ga0209992_104411993 | 3300024344 | Deep Subsurface | LFFEKLQAMPWWLVGLWVSVVAAIYGIKASEIKNFSK |
| Ga0209986_102002386 | 3300024433 | Deep Subsurface | SVFAEDDKMQAKIDLYFQKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK |
| Ga0208303_10354137 | 3300025543 | Aqueous | QEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK |
| Ga0208149_11078323 | 3300025610 | Aqueous | EKIDLYFQKLQEMPWWIVGLWVTVVTAIYGLKATDVINMNKK |
| Ga0208149_11176654 | 3300025610 | Aqueous | EKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINVNKNK |
| Ga0208004_11228533 | 3300025630 | Aqueous | EKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK |
| Ga0208161_10211981 | 3300025646 | Aqueous | KLDLYFQKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0208161_10749795 | 3300025646 | Aqueous | AKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK |
| Ga0208161_11038901 | 3300025646 | Aqueous | KLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK |
| Ga0208161_11582024 | 3300025646 | Aqueous | FLKLQEMPWWIVGLWVSVVAAIYGLKATDIINMNKGGK |
| Ga0208161_11803653 | 3300025646 | Aqueous | IQAKLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK |
| Ga0208160_11064183 | 3300025647 | Aqueous | KMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK |
| Ga0208160_11639563 | 3300025647 | Aqueous | FQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK |
| Ga0208160_11685841 | 3300025647 | Aqueous | QEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK |
| Ga0208134_10345226 | 3300025652 | Aqueous | EQKMDLFFEKLQSMPWWMVGLWVSVVAAIYGIKASEIKNFSK |
| Ga0208428_10315776 | 3300025653 | Aqueous | YFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK |
| Ga0208795_10868893 | 3300025655 | Aqueous | LYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGKK |
| Ga0208795_11069441 | 3300025655 | Aqueous | AYSVFAEDEKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGIKATDLMNMNKKQ |
| Ga0208795_11611871 | 3300025655 | Aqueous | KLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK |
| Ga0208898_10129209 | 3300025671 | Aqueous | EDEDISKKLDLYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0208898_10164278 | 3300025671 | Aqueous | EKMQAKIDLYFQKLQEMPWWIVGLWVTVVTAIYGLKATDVINMNKNGGK |
| Ga0208162_12018681 | 3300025674 | Aqueous | ISQKLDLYFEKLQNMPWWVTGLWISVVAAVYGIKATDIINTKKGK |
| Ga0208019_11741993 | 3300025687 | Aqueous | MQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNK |
| Ga0208150_10722036 | 3300025751 | Aqueous | KMQEKIDLYFEKLQEMPWWIVGLWASVVAAIYGLKATDIMNMNKK |
| Ga0208150_11627033 | 3300025751 | Aqueous | YSVFAEDEKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGIKATDVINMNKNK |
| Ga0208899_10666841 | 3300025759 | Aqueous | IDLYFQKLQEMPWWIVGLWVTVVTAIYGLKATDVINMNKNK |
| Ga0208899_12287883 | 3300025759 | Aqueous | KLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK |
| Ga0208899_12571861 | 3300025759 | Aqueous | IQAKLDLYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGSKK |
| Ga0208767_11361891 | 3300025769 | Aqueous | MKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK |
| Ga0208427_10127801 | 3300025771 | Aqueous | FAEDEKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGIKATDVINMNKNK |
| Ga0208427_11601005 | 3300025771 | Aqueous | LYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKK |
| Ga0208425_11570333 | 3300025803 | Aqueous | YFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK |
| Ga0208785_10149261 | 3300025815 | Aqueous | YFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0208785_10949093 | 3300025815 | Aqueous | FAEDDKMQAKIDLYFQKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK |
| Ga0208542_10681116 | 3300025818 | Aqueous | QEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINVNKNK |
| Ga0208542_11943191 | 3300025818 | Aqueous | EKISQKLDLYFEKLQNMPWWVTGLWISVVAAVYGIKATDIINTKKGK |
| Ga0208547_10765536 | 3300025828 | Aqueous | IDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNK |
| Ga0208547_11405164 | 3300025828 | Aqueous | DLYFIKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK |
| Ga0208917_10175091 | 3300025840 | Aqueous | KIDLYFQKLQEMPWWIVGLWVTVVTAIYGLKATDVINMNKGK |
| Ga0208917_10522801 | 3300025840 | Aqueous | ALEKKLDLYFEKLQNMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0208645_11359195 | 3300025853 | Aqueous | KLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGKK |
| Ga0208645_11629474 | 3300025853 | Aqueous | DDKMQAKIDLYFQKLQEMPWWVVGLWVSVVAAVYGLKATDVINMNKNK |
| Ga0208645_12473593 | 3300025853 | Aqueous | KLDLYFQKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNGGKK |
| Ga0208644_10851717 | 3300025889 | Aqueous | LYFEKLQGMPWWVTGLWISVVAAVYGIKATDIINTKKGK |
| Ga0209929_10830661 | 3300026187 | Pond Water | KIDLYFAKLQEMPWWLVSLWIAIVSAIYGIKATDLIKKK |
| Ga0209710_10875196 | 3300027687 | Marine | EDPEMEQKLNLYFEKLDGMPWWITGLWVSVVAAIYGIKATDIINTKKGK |
| Ga0209192_103340152 | 3300027752 | Marine | LYFEKLDGMPWWITGLWISVVAAIYGIKATDIIKTNGSKK |
| Ga0209089_103062081 | 3300027838 | Marine | EAKLDLYFDKLDTMPWWITGLWVSVVAAIYGIKATDIIKTNKK |
| Ga0209536_1002094026 | 3300027917 | Marine Sediment | IGQKLDLYFEKLQNMPWWVTGLWISVVAAVYGIKATDIINTKKSK |
| Ga0209536_1007211614 | 3300027917 | Marine Sediment | KIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKGK |
| (restricted) Ga0233413_103038431 | 3300027996 | Seawater | KLDGMPWWITGLWISVVAAIYGIKATDIIKTNGSKK |
| Ga0307380_1003429115 | 3300031539 | Soil | FQKLQEMPWWIVGLWVSVVAAIYGLKATDVINMNKNGGK |
| Ga0307379_116486201 | 3300031565 | Soil | KLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKNNEKKI |
| Ga0307376_106466364 | 3300031578 | Soil | LQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKNNVK |
| Ga0307993_11059025 | 3300031602 | Marine | DEKMEAKLDLYFDKLDSMPWWITGLWVSVVAAIYGIKATDIIKTNKK |
| Ga0307375_106782771 | 3300031669 | Soil | LYFMKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTGGKK |
| Ga0307375_107760741 | 3300031669 | Soil | KIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDIINMNKK |
| Ga0307377_101287711 | 3300031673 | Soil | MYFEKLQEMPWWIVGLWVSVVAAIYGLKATDIININKNK |
| Ga0307377_105218531 | 3300031673 | Soil | YFEKLQGMPWWITGLWISVVAAVYGIKATDIINTNKTNGVKK |
| Ga0307377_109336153 | 3300031673 | Soil | DLYFEKLQEMPWWIVGLWVSVVAAIYGLKATDVISMNKNK |
| Ga0348335_104829_751_867 | 3300034374 | Aqueous | MKLQEMPWWIVSLWVSVVAAIYGIKATDLIKTNNGGKR |
| Ga0348335_110321_720_839 | 3300034374 | Aqueous | LYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0348335_162312_2_112 | 3300034374 | Aqueous | AMPWWITGLWISVVAAIYGIKATDIIKTNGGKNNGK |
| Ga0348335_188551_2_148 | 3300034374 | Aqueous | DEDISKKLDLYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0348336_173770_2_124 | 3300034375 | Aqueous | DLYFSKLQDMPWWITGLWISVVAAVYGIKATDIINTKKGK |
| Ga0348336_214497_3_152 | 3300034375 | Aqueous | AEDEKMQEKIDLYFQKLQEMPWWIVGLWVSVVAAIYGLKATDVMNMNKK |
| ⦗Top⦘ |