


| Basic Information | |
|---|---|
| Family ID | F009981 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 310 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PREAIAVVHVDGQVPEQVLAKLRTIPAVRQAKAVRLF |
| Number of Associated Samples | 249 |
| Number of Associated Scaffolds | 310 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.32 % |
| % of genes near scaffold ends (potentially truncated) | 99.35 % |
| % of genes from short scaffolds (< 2000 bps) | 87.74 % |
| Associated GOLD sequencing projects | 232 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.903 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.548 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.226 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.258 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.77% β-sheet: 0.00% Coil/Unstructured: 89.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 310 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 46.13 |
| PF02163 | Peptidase_M50 | 10.97 |
| PF03602 | Cons_hypoth95 | 4.19 |
| PF12850 | Metallophos_2 | 3.87 |
| PF13505 | OMP_b-brl | 3.55 |
| PF13714 | PEP_mutase | 1.61 |
| PF00069 | Pkinase | 0.97 |
| PF01979 | Amidohydro_1 | 0.65 |
| PF01242 | PTPS | 0.65 |
| PF04055 | Radical_SAM | 0.65 |
| PF01042 | Ribonuc_L-PSP | 0.65 |
| PF12686 | DUF3800 | 0.65 |
| PF10431 | ClpB_D2-small | 0.65 |
| PF14520 | HHH_5 | 0.32 |
| PF14294 | DUF4372 | 0.32 |
| PF13432 | TPR_16 | 0.32 |
| PF04338 | DUF481 | 0.32 |
| PF00682 | HMGL-like | 0.32 |
| PF00383 | dCMP_cyt_deam_1 | 0.32 |
| PF07681 | DoxX | 0.32 |
| PF08818 | DUF1801 | 0.32 |
| PF07238 | PilZ | 0.32 |
| PF00005 | ABC_tran | 0.32 |
| PF00749 | tRNA-synt_1c | 0.32 |
| PF13394 | Fer4_14 | 0.32 |
| PF13673 | Acetyltransf_10 | 0.32 |
| PF00821 | PEPCK_GTP | 0.32 |
| PF14871 | GHL6 | 0.32 |
| PF00468 | Ribosomal_L34 | 0.32 |
| PF02597 | ThiS | 0.32 |
| PF12894 | ANAPC4_WD40 | 0.32 |
| PF00216 | Bac_DNA_binding | 0.32 |
| COG ID | Name | Functional Category | % Frequency in 310 Family Scaffolds |
|---|---|---|---|
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 4.19 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 4.19 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 4.19 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 4.19 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 4.19 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.87 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.65 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.65 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
| COG0230 | Ribosomal protein L34 | Translation, ribosomal structure and biogenesis [J] | 0.32 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.32 |
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.32 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.32 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.32 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.32 |
| COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.32 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.32 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.90 % |
| Unclassified | root | N/A | 17.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886011|MRS1b_contig_6710555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300000559|F14TC_108554354 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300000567|JGI12270J11330_10143875 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300000567|JGI12270J11330_10223682 | Not Available | 624 | Open in IMG/M |
| 3300001151|JGI12713J13577_1010540 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300001593|JGI12635J15846_10471427 | Not Available | 745 | Open in IMG/M |
| 3300001867|JGI12627J18819_10023179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2543 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101711360 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300004092|Ga0062389_101008574 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300004092|Ga0062389_102963300 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300004092|Ga0062389_104508441 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300004479|Ga0062595_100298680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1084 | Open in IMG/M |
| 3300004480|Ga0062592_102262322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. P52-10 | 543 | Open in IMG/M |
| 3300005184|Ga0066671_11062738 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005332|Ga0066388_103070118 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300005435|Ga0070714_102086811 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005441|Ga0070700_101127585 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005446|Ga0066686_10073877 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300005450|Ga0066682_10407309 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005454|Ga0066687_10113987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1384 | Open in IMG/M |
| 3300005458|Ga0070681_10591946 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300005533|Ga0070734_10100483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1699 | Open in IMG/M |
| 3300005538|Ga0070731_10224009 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300005538|Ga0070731_10465763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 841 | Open in IMG/M |
| 3300005560|Ga0066670_10490553 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005563|Ga0068855_101359048 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005598|Ga0066706_10068431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2474 | Open in IMG/M |
| 3300005602|Ga0070762_10444085 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005610|Ga0070763_10120843 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300005610|Ga0070763_10123511 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005610|Ga0070763_10215502 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300005610|Ga0070763_10371860 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005610|Ga0070763_10511555 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300005610|Ga0070763_10930948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300005712|Ga0070764_10064683 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300005764|Ga0066903_107229440 | Not Available | 574 | Open in IMG/M |
| 3300005842|Ga0068858_101686833 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005921|Ga0070766_10433143 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300006028|Ga0070717_11082201 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006031|Ga0066651_10645067 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006047|Ga0075024_100178894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
| 3300006050|Ga0075028_100064082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1800 | Open in IMG/M |
| 3300006050|Ga0075028_100087434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1568 | Open in IMG/M |
| 3300006050|Ga0075028_100350061 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300006173|Ga0070716_100275447 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300006173|Ga0070716_100421681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300006173|Ga0070716_101223248 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300006237|Ga0097621_100010002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6915 | Open in IMG/M |
| 3300006237|Ga0097621_101290271 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300006354|Ga0075021_10504828 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300006358|Ga0068871_101056926 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300006791|Ga0066653_10054928 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300006796|Ga0066665_10164794 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300006854|Ga0075425_100100206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3292 | Open in IMG/M |
| 3300006854|Ga0075425_101743126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300006893|Ga0073928_11240836 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006954|Ga0079219_10314142 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300006954|Ga0079219_11080720 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300007076|Ga0075435_100453272 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300007788|Ga0099795_10273486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300009029|Ga0066793_10238676 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300009089|Ga0099828_11656416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300009101|Ga0105247_11102140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300009147|Ga0114129_11300210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300009162|Ga0075423_11382241 | Not Available | 753 | Open in IMG/M |
| 3300009174|Ga0105241_11985751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300009521|Ga0116222_1543958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300009522|Ga0116218_1315084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300009522|Ga0116218_1501258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300009523|Ga0116221_1327138 | Not Available | 664 | Open in IMG/M |
| 3300009524|Ga0116225_1343390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300009551|Ga0105238_10157172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2249 | Open in IMG/M |
| 3300009551|Ga0105238_10784216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300009624|Ga0116105_1210689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300009628|Ga0116125_1005867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3547 | Open in IMG/M |
| 3300009632|Ga0116102_1186751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300009665|Ga0116135_1488909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300009792|Ga0126374_10309230 | Not Available | 1064 | Open in IMG/M |
| 3300010048|Ga0126373_10615960 | Not Available | 1139 | Open in IMG/M |
| 3300010048|Ga0126373_12519548 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010339|Ga0074046_10001973 | All Organisms → cellular organisms → Bacteria | 18070 | Open in IMG/M |
| 3300010339|Ga0074046_10759365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300010360|Ga0126372_10015584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4286 | Open in IMG/M |
| 3300010360|Ga0126372_10375441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1286 | Open in IMG/M |
| 3300010361|Ga0126378_11722645 | Not Available | 712 | Open in IMG/M |
| 3300010361|Ga0126378_12302795 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010362|Ga0126377_10050205 | All Organisms → cellular organisms → Bacteria | 3633 | Open in IMG/M |
| 3300010376|Ga0126381_100851287 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300010376|Ga0126381_104280789 | Not Available | 553 | Open in IMG/M |
| 3300010379|Ga0136449_100072358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7376 | Open in IMG/M |
| 3300010379|Ga0136449_100112950 | All Organisms → cellular organisms → Bacteria | 5503 | Open in IMG/M |
| 3300010379|Ga0136449_103183405 | Not Available | 635 | Open in IMG/M |
| 3300011089|Ga0138573_1089096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
| 3300011120|Ga0150983_14467912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 621 | Open in IMG/M |
| 3300011120|Ga0150983_16633623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300011271|Ga0137393_10619441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300011411|Ga0153933_1127241 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012096|Ga0137389_11478889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300012203|Ga0137399_10336855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1251 | Open in IMG/M |
| 3300012205|Ga0137362_10042142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3684 | Open in IMG/M |
| 3300012208|Ga0137376_10465249 | Not Available | 1097 | Open in IMG/M |
| 3300012211|Ga0137377_11841706 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012354|Ga0137366_10036729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3797 | Open in IMG/M |
| 3300012363|Ga0137390_11799489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300012363|Ga0137390_12013113 | Not Available | 503 | Open in IMG/M |
| 3300012469|Ga0150984_121916269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300012917|Ga0137395_10753932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300012927|Ga0137416_11821759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300012930|Ga0137407_11176479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300012951|Ga0164300_10296053 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300012957|Ga0164303_10937008 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012957|Ga0164303_11505490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300012986|Ga0164304_11580712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300013100|Ga0157373_10595064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300013105|Ga0157369_11044057 | Not Available | 836 | Open in IMG/M |
| 3300013296|Ga0157374_11851482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300013297|Ga0157378_10032626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4602 | Open in IMG/M |
| 3300013307|Ga0157372_12856047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300014169|Ga0181531_10306410 | Not Available | 972 | Open in IMG/M |
| 3300014169|Ga0181531_10422648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 820 | Open in IMG/M |
| 3300014489|Ga0182018_10540376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300014654|Ga0181525_10106172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1552 | Open in IMG/M |
| 3300014657|Ga0181522_10429382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300015262|Ga0182007_10388571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300015371|Ga0132258_10346315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3673 | Open in IMG/M |
| 3300016294|Ga0182041_11748128 | Not Available | 576 | Open in IMG/M |
| 3300016404|Ga0182037_11226589 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300017924|Ga0187820_1285529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300017927|Ga0187824_10142678 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300017927|Ga0187824_10335392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300017934|Ga0187803_10250741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300017934|Ga0187803_10448691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300017943|Ga0187819_10580613 | Not Available | 636 | Open in IMG/M |
| 3300017948|Ga0187847_10021881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3934 | Open in IMG/M |
| 3300017955|Ga0187817_10002469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9570 | Open in IMG/M |
| 3300017972|Ga0187781_10286638 | Not Available | 1168 | Open in IMG/M |
| 3300017973|Ga0187780_10479044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300017973|Ga0187780_11099171 | Not Available | 581 | Open in IMG/M |
| 3300017975|Ga0187782_10323845 | Not Available | 1164 | Open in IMG/M |
| 3300017975|Ga0187782_10720129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300017995|Ga0187816_10548192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300018007|Ga0187805_10457850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300018016|Ga0187880_1043401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2446 | Open in IMG/M |
| 3300018020|Ga0187861_10285263 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300018025|Ga0187885_10481792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300018034|Ga0187863_10057966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2203 | Open in IMG/M |
| 3300018038|Ga0187855_10082806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1952 | Open in IMG/M |
| 3300018042|Ga0187871_10512247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300018043|Ga0187887_10459802 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300018047|Ga0187859_10238326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300018064|Ga0187773_11264364 | Not Available | 500 | Open in IMG/M |
| 3300018085|Ga0187772_10615524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300018085|Ga0187772_11221355 | Not Available | 554 | Open in IMG/M |
| 3300018085|Ga0187772_11471948 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018086|Ga0187769_10895633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300018090|Ga0187770_11596428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300018090|Ga0187770_11613518 | Not Available | 529 | Open in IMG/M |
| 3300018468|Ga0066662_12141621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 586 | Open in IMG/M |
| 3300019186|Ga0184588_123581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300019273|Ga0187794_1555029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300019786|Ga0182025_1140799 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300020021|Ga0193726_1239571 | Not Available | 741 | Open in IMG/M |
| 3300020199|Ga0179592_10090201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300020579|Ga0210407_10032291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3896 | Open in IMG/M |
| 3300020579|Ga0210407_10721052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300020580|Ga0210403_10137998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1990 | Open in IMG/M |
| 3300020580|Ga0210403_11415464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300020580|Ga0210403_11462528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300020581|Ga0210399_10534680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300020581|Ga0210399_10630717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300020581|Ga0210399_11022077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300020582|Ga0210395_11300143 | Not Available | 532 | Open in IMG/M |
| 3300020583|Ga0210401_11588432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300021170|Ga0210400_10553011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 949 | Open in IMG/M |
| 3300021178|Ga0210408_10075005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2648 | Open in IMG/M |
| 3300021180|Ga0210396_11281116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300021181|Ga0210388_10002014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 15850 | Open in IMG/M |
| 3300021404|Ga0210389_10844444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300021407|Ga0210383_10693384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300021420|Ga0210394_10241419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1581 | Open in IMG/M |
| 3300021420|Ga0210394_11185401 | Not Available | 656 | Open in IMG/M |
| 3300021432|Ga0210384_10085603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2833 | Open in IMG/M |
| 3300021432|Ga0210384_10483379 | Not Available | 1115 | Open in IMG/M |
| 3300021432|Ga0210384_10891310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300021433|Ga0210391_11564789 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021433|Ga0210391_11591637 | Not Available | 500 | Open in IMG/M |
| 3300021474|Ga0210390_10613104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
| 3300021477|Ga0210398_11339063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300021478|Ga0210402_11997496 | Not Available | 506 | Open in IMG/M |
| 3300021479|Ga0210410_10381392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300021479|Ga0210410_10849174 | Not Available | 799 | Open in IMG/M |
| 3300021479|Ga0210410_11386565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300021559|Ga0210409_10447267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1152 | Open in IMG/M |
| 3300021559|Ga0210409_10953405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300021559|Ga0210409_11396761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300022515|Ga0224546_1001772 | Not Available | 1141 | Open in IMG/M |
| 3300022522|Ga0242659_1033629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300022528|Ga0242669_1028297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300022557|Ga0212123_10050234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3834 | Open in IMG/M |
| 3300022557|Ga0212123_10647890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300022721|Ga0242666_1113597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300023019|Ga0224560_106167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300023255|Ga0224547_1008067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1320 | Open in IMG/M |
| 3300024249|Ga0247676_1078153 | Not Available | 548 | Open in IMG/M |
| 3300025134|Ga0207416_1194070 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300025406|Ga0208035_1004117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2321 | Open in IMG/M |
| 3300025453|Ga0208455_1025001 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300025482|Ga0208715_1101113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300025506|Ga0208937_1098844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300025612|Ga0208691_1147578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300025899|Ga0207642_10706863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300025900|Ga0207710_10403667 | Not Available | 702 | Open in IMG/M |
| 3300025906|Ga0207699_10327317 | Not Available | 1076 | Open in IMG/M |
| 3300025911|Ga0207654_10520705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300025913|Ga0207695_10669456 | Not Available | 919 | Open in IMG/M |
| 3300025913|Ga0207695_11428866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300025913|Ga0207695_11596997 | Not Available | 533 | Open in IMG/M |
| 3300025915|Ga0207693_10369231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
| 3300025917|Ga0207660_10739985 | Not Available | 802 | Open in IMG/M |
| 3300025923|Ga0207681_10813506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300025927|Ga0207687_10869638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300025928|Ga0207700_11314588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300025939|Ga0207665_10499716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300025945|Ga0207679_12161994 | Not Available | 505 | Open in IMG/M |
| 3300026035|Ga0207703_11245113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300026142|Ga0207698_10110516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2302 | Open in IMG/M |
| 3300026217|Ga0209871_1087900 | Not Available | 603 | Open in IMG/M |
| 3300026309|Ga0209055_1128689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300026317|Ga0209154_1226807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300026328|Ga0209802_1208524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300026330|Ga0209473_1169458 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300026371|Ga0257179_1043977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300026467|Ga0257154_1065355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300026529|Ga0209806_1145800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300026557|Ga0179587_10348066 | Not Available | 961 | Open in IMG/M |
| 3300027030|Ga0208240_1001976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2054 | Open in IMG/M |
| 3300027371|Ga0209418_1083628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300027559|Ga0209222_1005272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2788 | Open in IMG/M |
| 3300027576|Ga0209003_1061427 | Not Available | 681 | Open in IMG/M |
| 3300027591|Ga0209733_1034072 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300027591|Ga0209733_1100647 | Not Available | 729 | Open in IMG/M |
| 3300027648|Ga0209420_1066249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1059 | Open in IMG/M |
| 3300027652|Ga0209007_1013097 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
| 3300027674|Ga0209118_1140525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300027698|Ga0209446_1126543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300027826|Ga0209060_10094940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1398 | Open in IMG/M |
| 3300027853|Ga0209274_10049195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1998 | Open in IMG/M |
| 3300027854|Ga0209517_10017570 | All Organisms → cellular organisms → Bacteria | 6958 | Open in IMG/M |
| 3300027854|Ga0209517_10425767 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300027867|Ga0209167_10282799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300027875|Ga0209283_10099892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1897 | Open in IMG/M |
| 3300027882|Ga0209590_10377191 | Not Available | 915 | Open in IMG/M |
| 3300027884|Ga0209275_10057999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1883 | Open in IMG/M |
| 3300027889|Ga0209380_10041475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2610 | Open in IMG/M |
| 3300027889|Ga0209380_10113453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1573 | Open in IMG/M |
| 3300027895|Ga0209624_10314962 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300027908|Ga0209006_10939933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300027910|Ga0209583_10316435 | Not Available | 714 | Open in IMG/M |
| 3300028047|Ga0209526_10385802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300028380|Ga0268265_11035583 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300028759|Ga0302224_10393653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300028800|Ga0265338_10710139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300028906|Ga0308309_10088425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2364 | Open in IMG/M |
| 3300028906|Ga0308309_10280926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1402 | Open in IMG/M |
| 3300028906|Ga0308309_10443955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
| 3300028906|Ga0308309_11230330 | Not Available | 645 | Open in IMG/M |
| 3300029907|Ga0311329_10204978 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300029922|Ga0311363_10649506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
| 3300029939|Ga0311328_10098593 | Not Available | 2443 | Open in IMG/M |
| 3300029943|Ga0311340_10090013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3425 | Open in IMG/M |
| 3300029953|Ga0311343_11039975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300030051|Ga0302195_10162568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300030053|Ga0302177_10249598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300030490|Ga0302184_10322580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300030520|Ga0311372_11014787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1093 | Open in IMG/M |
| 3300030524|Ga0311357_11383077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300030739|Ga0302311_10993036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300031057|Ga0170834_102514414 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300031057|Ga0170834_110399519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300031128|Ga0170823_16949742 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300031231|Ga0170824_104939671 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031232|Ga0302323_100693992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300031247|Ga0265340_10111513 | Not Available | 1264 | Open in IMG/M |
| 3300031446|Ga0170820_16757820 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031524|Ga0302320_10041859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8362 | Open in IMG/M |
| 3300031715|Ga0307476_10434015 | Not Available | 971 | Open in IMG/M |
| 3300031718|Ga0307474_10302395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1232 | Open in IMG/M |
| 3300031720|Ga0307469_12065732 | Not Available | 554 | Open in IMG/M |
| 3300031740|Ga0307468_102404540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031753|Ga0307477_11092597 | Not Available | 521 | Open in IMG/M |
| 3300031754|Ga0307475_11162555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300031771|Ga0318546_11338973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300031788|Ga0302319_11486633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300031823|Ga0307478_11389829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031912|Ga0306921_12680644 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031941|Ga0310912_10626612 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300031942|Ga0310916_10912407 | Not Available | 736 | Open in IMG/M |
| 3300032782|Ga0335082_10788218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300032805|Ga0335078_11750511 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300032828|Ga0335080_10612877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
| 3300032828|Ga0335080_12170754 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032954|Ga0335083_10971689 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300032954|Ga0335083_11202431 | Not Available | 587 | Open in IMG/M |
| 3300032955|Ga0335076_11471942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300033134|Ga0335073_12091379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300033158|Ga0335077_11356056 | Not Available | 688 | Open in IMG/M |
| 3300033289|Ga0310914_10222574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1690 | Open in IMG/M |
| 3300033475|Ga0310811_10261506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2037 | Open in IMG/M |
| 3300034282|Ga0370492_0048656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1741 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.52% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.29% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.29% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.65% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.32% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.32% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.32% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.32% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.32% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.32% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.32% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.32% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.32% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.32% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001151 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019186 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MRS1b_0194.00000240 | 2162886011 | Miscanthus Rhizosphere | ELAGQPREAIAVVHVDGAVPEAVLGELRKSPAVKEAKAIRLS |
| F14TC_1085543542 | 3300000559 | Soil | AIAVVHVDGRVPDTVLRELRKSPAVKQAKAIRLF* |
| JGI12270J11330_101438752 | 3300000567 | Peatlands Soil | EQPREAIAVVHVDGRVPEEVLRKLRTIPAVQKAKAVRLF* |
| JGI12270J11330_102236822 | 3300000567 | Peatlands Soil | DAIAVVHVDGLVSEPVLAELRKVPAVEKAKAIRLF* |
| JGI12713J13577_10105401 | 3300001151 | Forest Soil | EPREAIAVVHVDGLVPEDVLRKLEEIPAVRQAKAVQLF* |
| JGI12635J15846_104714271 | 3300001593 | Forest Soil | APREAIAVVHVDGVVPEPVLAELRKVSAIEQAKAIRLS* |
| JGI12627J18819_100231794 | 3300001867 | Forest Soil | REAIAVVHVDGAVSDVVLTRLRGIPAVQRAKGVRLF* |
| JGIcombinedJ26739_1017113601 | 3300002245 | Forest Soil | VEKDAQKESDQPRAAIAVVHIDGRVSEEVLAKLRTIPAVQKAKAVRLF* |
| Ga0062389_1010085742 | 3300004092 | Bog Forest Soil | SSEPREAIAVVHVDGPVPDDVLKKLEEIPAVRQAKAVRLF* |
| Ga0062389_1029633001 | 3300004092 | Bog Forest Soil | SESREAIAVVHVDGPVPDDVLKKLEQIPAVRQAKAVRLF* |
| Ga0062389_1045084411 | 3300004092 | Bog Forest Soil | ADFSLGRRSAEKADQAREAIAVVHVDGGVSEAVLARLRTIAAVQKAKAVRLF* |
| Ga0062595_1002986801 | 3300004479 | Soil | EESINIADFSLGRRVIEKDSEQREAIAVVHVDGQVSVEVLKRLREIPAVQQAKAVRLF* |
| Ga0062592_1022623221 | 3300004480 | Soil | PNAPREAIAVVHVDGKVSPEVLAELRRVPAVEQAKAIRLF* |
| Ga0066671_110627382 | 3300005184 | Soil | RVIEKDSEQREAIAVVHVDGQVPVEVLKRLREIPAVQQAKAVRLF* |
| Ga0066388_1030701181 | 3300005332 | Tropical Forest Soil | RSGEREAEQLREAIAVVHVDGAVPDVVLTRLRGIPAVQRAKGVRLF* |
| Ga0070667_1009681272 | 3300005367 | Switchgrass Rhizosphere | SDDKGKKKAREAIAVVHVDERVPEGVLKALRKVPAIEQAKAIRLF* |
| Ga0070714_1020868111 | 3300005435 | Agricultural Soil | INIADFSLGRRVIEKDSEQREAIAVVHVDGQVPVEVLKRLREIPAVQQAKAVRLF* |
| Ga0070700_1011275852 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | RSEEELAGQPREAIAVVHVDGAVPEAVLGELRKSPAVKEAKAIRLS* |
| Ga0066686_100738771 | 3300005446 | Soil | AQGPRQAIAVVHIDGTVSESVLAELRKVPAIDQAKAVRLL* |
| Ga0066682_104073092 | 3300005450 | Soil | ENGKPREAIAVVHVDGRVPDDVLRELCRVPAVEVAKAVELF* |
| Ga0066687_101139872 | 3300005454 | Soil | SGEPGTGAAREAVAVVHVDDRVPEPVLMELRKIEAVEQAKAITLV* |
| Ga0070681_105919462 | 3300005458 | Corn Rhizosphere | VGRPNSGEPNEAIAVVHVDGRVPDKVLDELKKVPAVRQAKAILLL* |
| Ga0070734_101004833 | 3300005533 | Surface Soil | TDQAREAIAVVHVDGQVPEAVLERLRQIAAVRQAKAVRLF* |
| Ga0070731_102240093 | 3300005538 | Surface Soil | RSKSAEQDAPREAIAVVHIDGVVREEVLARLRQIPAVRQAKAITLF* |
| Ga0070731_104657631 | 3300005538 | Surface Soil | VNIADFSLGRRAVESSEPRQAIAVVHVDGPVPEPVLKALREIPAVQEAKAVRLF* |
| Ga0066670_104905531 | 3300005560 | Soil | EESINIADFSLGRRVIEKDSEQREAIAVVHVDGQVPVEVLKRLREIPAVQQAKAVRLF* |
| Ga0068855_1013590482 | 3300005563 | Corn Rhizosphere | PNEAIAVVHVDGRVPDKVLDELKKVPAVRQAKAILLL* |
| Ga0066706_100684314 | 3300005598 | Soil | LGRRAGNGENGKPREAIAVVHVDGRVPDDVLRELCRVPAVEVAKAVELF* |
| Ga0070762_104440851 | 3300005602 | Soil | DFSLGRRAEKDSDQPREAIAVVHVDGSVTDQVLAKLRTIPAVQKAKAVRLF* |
| Ga0070763_101208431 | 3300005610 | Soil | PSEALAVVHVDGQVSEAVLNKLRKIPAVQQAKAVRLF* |
| Ga0070763_101235112 | 3300005610 | Soil | AIAVVHVDSSVPEDVLRKLEEIPAVRQAKAVQLF* |
| Ga0070763_102155022 | 3300005610 | Soil | SAEASSEPSEAIAVVHVDGAVPDDVLRKLEEIPAVRQAKAVRLF* |
| Ga0070763_103718601 | 3300005610 | Soil | GNAKPREAIAVVHVDGVVPEPVLAELRKVAAIQQAKAIRLF* |
| Ga0070763_105115551 | 3300005610 | Soil | PREAIAVVHVDGRVPDDVLRKLEQIPAVRQAKAVRLF* |
| Ga0070763_109309481 | 3300005610 | Soil | GRRSGETSSQPREAIAVVHVDSRVPEEVLRKLETVPAVLQAKAVELL* |
| Ga0070764_100646833 | 3300005712 | Soil | GTREAIAVIHVDAAVSEGVLTALRKVPAIARAKAIRLA* |
| Ga0066903_1072294402 | 3300005764 | Tropical Forest Soil | PNGKSDSPREAIAVVHVDGRVPDVVLSELRSVPAIEQAKAIRLS* |
| Ga0068858_1016868331 | 3300005842 | Switchgrass Rhizosphere | PAGQPREAIAVVHVDGTVSEIVLGELRKSPAVKQAKAIRLS* |
| Ga0070766_104331431 | 3300005921 | Soil | EASSEPREAIAVVHVDGPVPDDVLKKLEEIPAVRQAKAVRLF* |
| Ga0070717_110822011 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QPREAIAVVHVDGRVSEEVLAKLRTIPAVQKAKAVRLF* |
| Ga0066651_106450672 | 3300006031 | Soil | NIADFSLGRRTLEKESEREAIAVVHVDGQVSDEVLKRLRAIPAVQQAKAVRLF* |
| Ga0075024_1001788941 | 3300006047 | Watersheds | AKPGAPREAIAVVHVDGHVPPEVLAELRKVPAVEQAKAIRLF* |
| Ga0075028_1000640821 | 3300006050 | Watersheds | TKPREAIAVVHVDGVVPEPVLSELRKVSAIEQAKAIRLS* |
| Ga0075028_1000874341 | 3300006050 | Watersheds | GNAKPGTPRDAIAVVHVDGVVPEPVLAELRKVSAIEQAKAIRLF* |
| Ga0075028_1003500612 | 3300006050 | Watersheds | AREAVAVVHVDDRVSEAALAALRKVPAIEQAKAIRLF* |
| Ga0070716_1002754471 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KDSEQREAIAVVHVDGQVPVEVLKRLREIPAVQQAKAVRLF* |
| Ga0070716_1004216812 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GKQDAPRQAIAVVHVDGKVSPEVLAELRKVPAVEQAKAIRLF* |
| Ga0070716_1012232482 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QTSDQPREAIAVVHVDGAVSDVVLTRLRGIPAVQRAKGVRLF* |
| Ga0097621_1000100027 | 3300006237 | Miscanthus Rhizosphere | PVAGTPREAIAVVHVDGPVPQAVISELKGIPAVQQARAVRLPQ* |
| Ga0097621_1012902712 | 3300006237 | Miscanthus Rhizosphere | GRRAVEKEVQKESDQPREAIAVVHVDGRVPEEVLAKLRTIPAVQKAKAVRLF* |
| Ga0075021_105048282 | 3300006354 | Watersheds | AIAVVHVDGRIPPEVLAVLRKVPAVEQAKAIRLF* |
| Ga0068871_1010569262 | 3300006358 | Miscanthus Rhizosphere | REAIAVVHVDGRVPEEVLAKLRTIPAVQKAKAVRLF* |
| Ga0066653_100549281 | 3300006791 | Soil | EGLGGQPREAIAVVHVDGAVPEAVLGELRKLPAVKQAKAIRLF* |
| Ga0066665_101647943 | 3300006796 | Soil | EAIAVVHVDGAVPEAVLGELRKLPAVKQAKAIRLF* |
| Ga0075425_1001002064 | 3300006854 | Populus Rhizosphere | ESSKSRDAIAVVHIDGRVPENVLAELRRIPAVEQAKAIRLF* |
| Ga0075425_1017431262 | 3300006854 | Populus Rhizosphere | PSGKPREAIAVVHVDGSVPEAVVSELQGIPAVHQAKAIRLD* |
| Ga0073928_112408361 | 3300006893 | Iron-Sulfur Acid Spring | AIAVVHVDGLVPEDVLRKLEEIPAVRQAKAVQLF* |
| Ga0079219_103141421 | 3300006954 | Agricultural Soil | TGAAREAVAVVHVDDRVPESVLMELRKIEAVEQAKAITLI* |
| Ga0079219_110807202 | 3300006954 | Agricultural Soil | AIAVVHVDGRVPPEVLAELRKVPAIEQAKAVRLF* |
| Ga0075435_1004532721 | 3300007076 | Populus Rhizosphere | ESSKSRDAIAVVHIDGRVPENVLAELRRIPAVQQAKAIRLF* |
| Ga0099795_102734862 | 3300007788 | Vadose Zone Soil | SGKPREAIAVVHVDGRVPEAVLRELCKVPAVEIAKAVELF* |
| Ga0066793_102386763 | 3300009029 | Prmafrost Soil | VQKESDQPREAIAVVHVDGRVPEEVLAKLRTIPAVQKAKAVQLF* |
| Ga0099828_116564161 | 3300009089 | Vadose Zone Soil | NGKPGPLRQAIAVVHVDVRVPETVLAELRKVPAVEQAKAIRLF* |
| Ga0105247_111021402 | 3300009101 | Switchgrass Rhizosphere | AGQPREAIAVVHVDGTVSEVVLGELRKSPAVKQAKAIRLS* |
| Ga0114129_113002102 | 3300009147 | Populus Rhizosphere | EAIAVVHVDGRVPPEVLAELRKVPAIKQAKAIRLF* |
| Ga0075423_113822411 | 3300009162 | Populus Rhizosphere | GGPGAPREAIAVVHVDGRVPPEVLAELRKVPAIKQAKAIRLF* |
| Ga0105241_119857511 | 3300009174 | Corn Rhizosphere | AIAVVHVDERVPEGVLKALRKVPAIEQAKAIRLF* |
| Ga0116222_15439581 | 3300009521 | Peatlands Soil | SAQTSAYAREAIAVVHVDGPVPDEVVKKLEQIPAVRQAKAVRLF* |
| Ga0116218_13150841 | 3300009522 | Peatlands Soil | IADFSLGRRSAEASSEPREAIAVVHVDGPVPDDVLKKLEEIPAVRQAKAVRLF* |
| Ga0116218_15012581 | 3300009522 | Peatlands Soil | QPREAIAVVHVDGIVTDQVLAKLRTIPAVQKAKAVRLF* |
| Ga0116221_13271381 | 3300009523 | Peatlands Soil | AVAVIHVDGQVPETVLAVLRKVPAVQRAKAIRLF* |
| Ga0116225_13433902 | 3300009524 | Peatlands Soil | SLGRRGAEKDSEQPREAIAVVHWAGIVTDQVRPKLRTIPAVQKAKAVRLF* |
| Ga0105238_101571721 | 3300009551 | Corn Rhizosphere | FSGEPGTGAAREAVAVVHVDDRVPEPVLMELRKIEAVEQAKAITLV* |
| Ga0105238_107842163 | 3300009551 | Corn Rhizosphere | PREAIAVVHVDGSVPEAVISELKGIPAVQQARAVRLPQ* |
| Ga0116105_12106891 | 3300009624 | Peatland | FSLGRRSAEASSEPREAIAVVHVDGQVPDAVLRKLEEIPAVRQAKAVRLF* |
| Ga0116125_10058675 | 3300009628 | Peatland | DFSLGRRSAETSSEPREAIAVVHVDGPVPDDVLKKLEKIPAVRQAKAVRLF* |
| Ga0116102_11867512 | 3300009632 | Peatland | SSELREAIAVVHVDGSVPDDVLRKLEKIPAVRQAKAVRLF* |
| Ga0116135_14889091 | 3300009665 | Peatland | EAIAVVHVDGQVSEAVLNKLRKIPAVQQAKAVRLF* |
| Ga0126374_103092301 | 3300009792 | Tropical Forest Soil | KAVAVVHVDGRVPDDVLKVLRKVPAIEQAKAIRLF* |
| Ga0126373_106159602 | 3300010048 | Tropical Forest Soil | LDDKKASREAIAVVHIDGRVPDQVLAELRKIPAVDEAKRIHLS* |
| Ga0126373_125195481 | 3300010048 | Tropical Forest Soil | RGGERHTDEPREAIAVVHVDGAVSELVLTRLRGIPAVERAKAVRLF* |
| Ga0074046_1000197318 | 3300010339 | Bog Forest Soil | GRRGADKDSEQPREAIAVVHVDGRVTDQVLAKLRTIPAVQKAKAVRLF* |
| Ga0074046_107593652 | 3300010339 | Bog Forest Soil | SLGRRGADKDSEQPREAIAVVHVDGSVTEEVLRKLRTIPAVQKAKAVRLF* |
| Ga0126372_100155841 | 3300010360 | Tropical Forest Soil | RRMSGESAGPRQAIAVVHVDGQVPENVLTQLRRIPAVEQAKAIRLF* |
| Ga0126372_103754411 | 3300010360 | Tropical Forest Soil | SDQPREAIAVVHVDGQVPDQVLNRLQEIPAVEQAKAVRLF* |
| Ga0126378_117226451 | 3300010361 | Tropical Forest Soil | AIAVVHVDGRVPDVVLSELRRVPAIEQAKAIRLS* |
| Ga0126378_123027951 | 3300010361 | Tropical Forest Soil | SDQPREAIAVVHIDGQVPESVLERLREIPAVEQAKAVRLF* |
| Ga0126377_100502051 | 3300010362 | Tropical Forest Soil | KAVAVVHVDGRVPDDVLKVLRKVAAVEQAKAIRLF* |
| Ga0126381_1008512871 | 3300010376 | Tropical Forest Soil | EAIAVVHIDGNVADAVLAKLRQIPAVQRAKAVRLF* |
| Ga0126381_1042807892 | 3300010376 | Tropical Forest Soil | FSLGRRSAEKESDQPREAIAVVHVDGQVPDQVLNRLQEIPAVEQAKAVRLF* |
| Ga0136449_1000723588 | 3300010379 | Peatlands Soil | QPREAIAVVHVDGAVPESVLAELRKAPGVQQAKAIRLF* |
| Ga0136449_1001129501 | 3300010379 | Peatlands Soil | KAVAVVHVDGVVPEKVLASLRKLPAVRYARAVEVG* |
| Ga0136449_1031834052 | 3300010379 | Peatlands Soil | TPDEPREAIAVVHVDGRVPEPVLAKLRKIAAVEQAKAISLP* |
| Ga0138573_10890962 | 3300011089 | Peatlands Soil | RVSVKPGAPRDAIAVVHVDGLVSEPVLAELRKVPAVEKAKAIRLF* |
| Ga0150983_144679123 | 3300011120 | Forest Soil | RRAANGESAAQPEAIAVVHIDGRVPEEVLKKLRKIPAMQQAKAVRLF* |
| Ga0150983_166336231 | 3300011120 | Forest Soil | EPREAIAVVHVDGPVPDEVLRKLEKIPAVRQAKAMRLF* |
| Ga0137393_106194412 | 3300011271 | Vadose Zone Soil | VGNIKPGAPREAIAVVHVDGLVPQPVLAELRKVPAVQEAKAIRLF* |
| Ga0153933_11272412 | 3300011411 | Attine Ant Fungus Gardens | EAIAVVHVDGRVPENVLVKLRTIPAIQQAKAVQLL* |
| Ga0137389_114788892 | 3300012096 | Vadose Zone Soil | SVEPREAIAVVHVDGPVPDDVLKKLEEIPAVRQAKAVRLF* |
| Ga0137399_103368551 | 3300012203 | Vadose Zone Soil | PREAIAVVHVDGRVPPEVLAELRKVPAIERAKAIRLF* |
| Ga0137362_100421421 | 3300012205 | Vadose Zone Soil | KKGEARKAVAVVHVDGRVPDDVLKVLRKVAAVEQAKAIRLF* |
| Ga0137376_104652491 | 3300012208 | Vadose Zone Soil | PEAIAVVHIDGRVPEEVLKKLRKIPAMQQAKAVRLF* |
| Ga0137377_118417061 | 3300012211 | Vadose Zone Soil | EAIAVVHVDGRVPEEVLTKLRAIPAVQQAKAVQLL* |
| Ga0137366_100367296 | 3300012354 | Vadose Zone Soil | SLGRRGIEKEVQKESPTPREAIAVVHVDGRVSEEVLTKLRQIAAVQQAKAVQLF* |
| Ga0137390_117994892 | 3300012363 | Vadose Zone Soil | ADFSLGRRSSEASVETREAIAVVHVDGPVPDDVLKKLEEIPAVRQAKAVRLF* |
| Ga0137390_120131131 | 3300012363 | Vadose Zone Soil | AIAVVHVDGKVPPEVLAELRKVPAVEQAKAIRLF* |
| Ga0150984_1219162691 | 3300012469 | Avena Fatua Rhizosphere | AIAVVHVDGQVSDEVLKRLRAIPAVQQAKAVRLF* |
| Ga0137395_107539322 | 3300012917 | Vadose Zone Soil | EKEVQKESDQPREAIAVVHVDGRVSEEVLAKLRTIPAVEKAKAVRLF* |
| Ga0137416_118217592 | 3300012927 | Vadose Zone Soil | GVEKEVQKESDQPREAIAVVHVDGRVSEEVLAKLRTIPAVEKAKAVRLF* |
| Ga0137407_111764791 | 3300012930 | Vadose Zone Soil | KQNASRRAIAVVHVDGRVPEAVLAELRKVPAIDQAKAIRLY* |
| Ga0164300_102960531 | 3300012951 | Soil | KAIAVVHIDGKVTDDVLKALRKISAIEQAKAIRLF* |
| Ga0164303_109370081 | 3300012957 | Soil | PRKAIAVVHIDGKVTDDVLKALRKISAIEQAKAIRLF* |
| Ga0164303_115054901 | 3300012957 | Soil | AIAVVHVDGKVPDAVVSELGGIPAVQQAKAVRLD* |
| Ga0164304_115807121 | 3300012986 | Soil | RVIEKDSEQREAIAVVHVDGQVSVEVLKRLREIPAVQQAKAVRLF* |
| Ga0157373_105950641 | 3300013100 | Corn Rhizosphere | IADFSLGRRVIEKDSEQREAIAVVHVDGQVSVEVLKRLREIPAVQQAKAVRLF* |
| Ga0157369_110440571 | 3300013105 | Corn Rhizosphere | PREAIAVVHVDGKVSPEVLAELRRVPAVEQAKAIRLF* |
| Ga0157374_118514821 | 3300013296 | Miscanthus Rhizosphere | KDVQKESDQPREAIAVVHVDGRVSEDVLAKLRTIPAV* |
| Ga0157378_100326268 | 3300013297 | Miscanthus Rhizosphere | ELAGQPREAIAVVHVDGAVPEAVLGELRKSPAVKQAKAIRLT* |
| Ga0157372_128560471 | 3300013307 | Corn Rhizosphere | SINIADFSLGRRTLEKESEREAIAVVHVDGQVSDEVLKRLRSIPAVQQAKAVRLF* |
| Ga0181531_103064101 | 3300014169 | Bog | VSSEPREAIAVVHVDGSVPDEVLRKLEKIPAVRQAKAVRLF* |
| Ga0181531_104226483 | 3300014169 | Bog | EAIAVVHVDGVVPEPVLAELRKVSAIEQAKAIRLF* |
| Ga0182018_105403762 | 3300014489 | Palsa | LGRRSAEASPEPREAIAVVHIDGRVPEEVLKRLEKIPAVRQAKAVRLF* |
| Ga0181525_101061721 | 3300014654 | Bog | SLGRRSAEASSEPREAIAVVHVDGPVPDDVLKKLEEIPAVQQAKAVRLF* |
| Ga0181522_104293821 | 3300014657 | Bog | DSDQPREAIAVVHVDGSVTEEVLKKLRTIPAVQKAKAVRLF* |
| Ga0182007_103885712 | 3300015262 | Rhizosphere | RVIEKDSEQREALAVVHVDGQVPVEVLKRLREIPAVQQAKAVRLF* |
| Ga0132258_103463156 | 3300015371 | Arabidopsis Rhizosphere | PREAIAVVHVDGAVPEAVLGELRKSPAVKQAKAIRLT* |
| Ga0182041_117481281 | 3300016294 | Soil | PKEAIAVVHVDEVVPEAILAELRKIPAVETAKAVRLF |
| Ga0182037_112265891 | 3300016404 | Soil | REAIAVVHVDGAVPDVVLTRLRGIAAVQTAKGVRLF |
| Ga0187820_12855292 | 3300017924 | Freshwater Sediment | SLGRRASDSSGEREAIAVVHVDGPVPDVVLKKLESIPAVQQAKAVRLF |
| Ga0187824_101426782 | 3300017927 | Freshwater Sediment | GEAIAVVHVDTKVPEEVLEALRKIPAMQSAKAIRL |
| Ga0187824_103353922 | 3300017927 | Freshwater Sediment | EGAEAMSEAIAVVHVDEVVPGSVLAKLKEIPAVKTAKGIRLF |
| Ga0187803_102507412 | 3300017934 | Freshwater Sediment | SEQAREAIAVVHVDGDVPNEVLKRLREIPAVKQAKAVRLF |
| Ga0187803_104486912 | 3300017934 | Freshwater Sediment | SDQPREAIAVVHVDGRVPEEVLTKLRTIPAVQKAKSVRLF |
| Ga0187819_105806132 | 3300017943 | Freshwater Sediment | VPREAIAVVHIDGVVPDEVLAKLRRVPAIQQAKAIKLF |
| Ga0187847_100218816 | 3300017948 | Peatland | RSAEKDSDQPREAIAVVHVDGLVTEGVLTKLRTIPAVQKARAVRLF |
| Ga0187817_100024691 | 3300017955 | Freshwater Sediment | EAIAVVHIDGIVPDEVLAKLRKVPAIQQAKAIRLF |
| Ga0187781_102866381 | 3300017972 | Tropical Peatland | QTREAIAVVHVDGVVPEGVLEKLRKIPAVQTAKAVRLV |
| Ga0187780_104790441 | 3300017973 | Tropical Peatland | QTSDRKGAPRDAIAVVHVDGNVPDQVLAELRRVPAVEQAKAIRLF |
| Ga0187780_110991712 | 3300017973 | Tropical Peatland | GDLTPGVPREAIAVVHIDGVVPDQVLAKLRKVPAIQQAKAIRLF |
| Ga0187782_103238452 | 3300017975 | Tropical Peatland | EKESNQPREAIAVVHVDGQVPGQVLDRLKEIPAVQQAKGVRLF |
| Ga0187782_107201291 | 3300017975 | Tropical Peatland | EAPPSGEAIAVVHVDGIVPDGVLAKLRKIPAVQTAKAVRLF |
| Ga0187816_105481922 | 3300017995 | Freshwater Sediment | GEVESGQPREAIAVVHVDGVVPEEVVKKLKAIPAVHTAKAVRLF |
| Ga0187805_104578501 | 3300018007 | Freshwater Sediment | SNETPDQPREAIAVVHVDGQVPDAVLTRLRGIAAVQQAKAVRLF |
| Ga0187880_10434014 | 3300018016 | Peatland | SSELREAIAVVHVDGSVPDDVLRKLEKIPAVRQAKAVRLF |
| Ga0187861_102852632 | 3300018020 | Peatland | PREAVAVVHVDGQVPETVLAVLRKIPAVQRAKAIRLF |
| Ga0187885_104817922 | 3300018025 | Peatland | ANFSLGRRNGETSSEPREAIAVVHVDSRVPDEVLRKLEKIPAVLQAKAVELF |
| Ga0187863_100579663 | 3300018034 | Peatland | ESINIADFSLGRRSIESSESQREAIAVVHVDGNVSEQVLTRLRGISAVQTAKAVRLF |
| Ga0187855_100828061 | 3300018038 | Peatland | REAIAVVHVDGNVSEQVLTRLRGIAAVQTAKAVRLF |
| Ga0187871_105122471 | 3300018042 | Peatland | ILGEESINIADFSLGRRSIESSEQLREAIAVVHVDGNVSEQVLTRLRGIAAVQTAKAVRL |
| Ga0187887_104598021 | 3300018043 | Peatland | NEDPSTPREAVAVVHVDGQVPETVLAVLRKIPAVQRAKAIRLF |
| Ga0187859_102383262 | 3300018047 | Peatland | SDQPSEAIAVVHVDGQVSEAVLNKLRKIPAVQQAKAVRLF |
| Ga0187773_112643641 | 3300018064 | Tropical Peatland | SKKEHAPKEAIAVVHVDEVVPEAILAELRKIPAVETAKAVRLF |
| Ga0187772_106155241 | 3300018085 | Tropical Peatland | KESTQAREAIAVVHVDGQVPDHVLFKLRQIPAVQKAKAVRLF |
| Ga0187772_112213552 | 3300018085 | Tropical Peatland | RALKEAIAVVHVDEVVPEAILAELRKIPAVETAKAVRLF |
| Ga0187772_114719481 | 3300018085 | Tropical Peatland | AAAKESEQPREAIAVVHVDGDVPDEVLVKLRKIPAVQQAKAVRLF |
| Ga0187769_108956332 | 3300018086 | Tropical Peatland | PSAEGSDQSREAIAVVHVDGSVPAEVLAKLRQIPAVKTAKAVRLF |
| Ga0187770_115964282 | 3300018090 | Tropical Peatland | GRRSTDKNLNQPREAIAVVHVDGTVPHEVLGKLQQIPAVQTAKAVRLF |
| Ga0187770_116135181 | 3300018090 | Tropical Peatland | EGPGEAIAVVHFDGMVPEAVLAEVRQIPAVQQAKLIRLS |
| Ga0066662_121416211 | 3300018468 | Grasslands Soil | AGGATGDGPEAIAVVHVDVRIPETVLAELRKIPAVAQAKAIRLF |
| Ga0184588_1235812 | 3300019186 | Soil | EAIAVVHVDGPVPETVLRKLEQIPAVRQAKAVRLF |
| Ga0187794_15550292 | 3300019273 | Peatland | RRSDAADSTQPSEAIAVVHVDGSVPDGVLKKLRKIPAVQTAKAVRLF |
| Ga0182025_11407993 | 3300019786 | Permafrost | QPREAIAVVQVDGRVPEEVLAKLRQIPAVQQAKAVQLL |
| Ga0193726_12395712 | 3300020021 | Soil | AREAIAVVHVDGSVPEAVLIELRKVPAVSEAKAIRLF |
| Ga0179592_100902011 | 3300020199 | Vadose Zone Soil | KGEARKSVAVVHVDGRVPDDVLKVLRKVAAVEQAKAIRLF |
| Ga0210407_100322911 | 3300020579 | Soil | SEALAVVHVDGQVSEAVLNKLRKIPAVQQAKAVRLF |
| Ga0210407_107210522 | 3300020579 | Soil | LGRRGVEKDAAQPREAIAVVHVDGQVTEEVLTKLRTIPAVQKAKAVRLF |
| Ga0210403_101379983 | 3300020580 | Soil | REAIAVLHVDGVVPDRVLSALRKVPAIARAKAIRLA |
| Ga0210403_114154642 | 3300020580 | Soil | GEQTSDQPREAIAVVHVDGAVSDVVLTRLRGIPAVQRAKGVRLF |
| Ga0210403_114625281 | 3300020580 | Soil | REAIAVVHVDGRVPDDVLKKLVKIPAVRQAKAVRLF |
| Ga0210399_105346801 | 3300020581 | Soil | MGQLREAIAVVHVDGRVPEAVLAELRKVAAIQQATAISLP |
| Ga0210399_106307171 | 3300020581 | Soil | TSGEPREAIAVVHVDGPVPDGVLKKLEEIPAVRQAKAVRLF |
| Ga0210399_110220772 | 3300020581 | Soil | EAGSSEPSEAIAVVHVDGQVPDAVLEKLRKIPAVHQAKAVRLF |
| Ga0210395_113001431 | 3300020582 | Soil | GMREAIAVVHVDGVVPDRVLAALRKVPAIARAKAIRLA |
| Ga0210401_115884321 | 3300020583 | Soil | ADCSLGRRGVEKDAAQPREAIAVVHVDGQVTEEVLTKLRTIPAVQKAKAVRLF |
| Ga0210400_105530112 | 3300021170 | Soil | SINSADFSLGRRAEKDSDQPREAIAVVHVDGSVTDQVLAKLRTIPAVQKAKAVRLF |
| Ga0210408_100750054 | 3300021178 | Soil | KAVAVVHIDGRVPEDVVKALRKIPAIEQAKAIRLF |
| Ga0210396_112811161 | 3300021180 | Soil | NIADFSLGRRAERDSDQPREAIAVVHVDGSVTDQVLAKLRTIPAVQKAKAVRLF |
| Ga0210388_1000201417 | 3300021181 | Soil | AEAGSDQPSEAIAVVHVDGHVSDAVLNELRKIPAVHQAKAVRLF |
| Ga0210389_108444441 | 3300021404 | Soil | KKTEPRKAVAVVHIDGRVSEDVLKALRKIPAIEQAKAIRLF |
| Ga0210383_106933842 | 3300021407 | Soil | RSAEAGSDQPSEALAVVHVDGQVSEAVLNKLRKIPAVQQAKAVRLF |
| Ga0210394_102414193 | 3300021420 | Soil | REAIAVVHVDGRVSEEVLGKLRTIPAVQKAKAVRLL |
| Ga0210394_111854012 | 3300021420 | Soil | NGKPGAPRDAIAVVHVDGRVSPEVLAELRKVPAIEQAKAIRLF |
| Ga0210384_100856031 | 3300021432 | Soil | APRDAIAVVHVDGRVSPEVLAELRKVPAIEQAKAIRLF |
| Ga0210384_104833791 | 3300021432 | Soil | RSSGATSEPREAIAVVHVDGRVPEDVLRKLEEIPAVRQAKAVQLF |
| Ga0210384_108913101 | 3300021432 | Soil | GAPREAIAVVHVDGRVSEEVLAELKKVPAVALAKAIRLF |
| Ga0210391_115647892 | 3300021433 | Soil | GRRAIEKDVQKESDQPREAIAVVHVDGRVPEEVLAKLRQIPAVQQAKAVQLF |
| Ga0210391_115916371 | 3300021433 | Soil | GNAKPREAIAVVHVDGVVPERVLAELRKVSAIEQAKAIRLF |
| Ga0210390_106131042 | 3300021474 | Soil | DFSLGRRSAEASSEPREAIAVVHVDGPVPDEVLRKLEKIPAVRQAKAMRLF |
| Ga0210398_113390631 | 3300021477 | Soil | SSEPREAIAVVHVDGRVPDDVLRKLEQIPAVRQAKAVRLF |
| Ga0210402_119974962 | 3300021478 | Soil | RSAEKGSDQPREAIAVVHVDGHVTEEVLAKLRTIPAVHKAKAVRLF |
| Ga0210410_103813921 | 3300021479 | Soil | ADFSLGRRGVEKDAAQPREAIAVVHVDGQVTEEVLTKLRTIPAVQKAKAVRLF |
| Ga0210410_108491741 | 3300021479 | Soil | NRIPGAPRDAIAVVHVDGRVSPEVLAELRKVPAIEQAKAIRLF |
| Ga0210410_113865652 | 3300021479 | Soil | TPRDAIAVVHVDGVVPEPVLAELRKVSAIEQAKAIRLF |
| Ga0210409_104472673 | 3300021559 | Soil | AGAPREAIAVVHVDGRVSEEVLAELKKVPAVALAKAIRLF |
| Ga0210409_109534052 | 3300021559 | Soil | INIADFSLGRRAIEKDVQKESDQPREAIAVVHVDGRVSEEVLGKLRTIPAVQKAKAVRLL |
| Ga0210409_113967611 | 3300021559 | Soil | AEAGSEVREAIAVVHVDGQVPDEVLKKLEEIPAVEKAKAVRLF |
| Ga0224546_10017722 | 3300022515 | Soil | SSEPREAIAVVHVDGPAPDEVLKKLEQIPAVRQAKAVRLF |
| Ga0242659_10336291 | 3300022522 | Soil | PREAIAVVHVDGAVSDVVLTRLRGIPAVQRAKGVRLF |
| Ga0242669_10282972 | 3300022528 | Soil | SLGRRGGEQTSDQPREAIAVVHVDGAVSDVVLTRLRGIPAVQRAKGVRLF |
| Ga0212123_100502346 | 3300022557 | Iron-Sulfur Acid Spring | EAIAVVHVDGRVPDDVLKKLEQIPAVRQAKAVRLF |
| Ga0212123_106478901 | 3300022557 | Iron-Sulfur Acid Spring | GRRSAEVSSEPREAIAVVHVDGSVPDEVLRKLEKIPAVRQAKAVRLF |
| Ga0242666_11135972 | 3300022721 | Soil | NIADFSLGRRAAESSGEREAIAVVHVDGPVPDAVLKKLESISAVRQAKAVRLF |
| Ga0224560_1061672 | 3300023019 | Soil | VEASSEPREAIAVVHVDGPVPETVLRKLEQIPAVRQAKAVRLF |
| Ga0224547_10080671 | 3300023255 | Soil | NIADFSLGRRGSDDSSEREAIAVVHIDGDVTDAVLKKLEEIPAVRQAKAVRLF |
| Ga0247676_10781531 | 3300024249 | Soil | KPNSPREAIAVVHMDGKVSPEVLAELRRVPAVEQAKAIRLF |
| Ga0207416_11940702 | 3300025134 | Iron-Sulfur Acid Spring | GIEKDVQKESDQPREAIAVVHVDGRVPEEVLAKLRKIPAVQQAKAVQLL |
| Ga0208035_10041171 | 3300025406 | Peatland | SLGRRSAETSSEPREAIAVVHVDGNVPDTVLRKLEQIPAVRQAKAVRLF |
| Ga0208455_10250013 | 3300025453 | Peatland | SLGRLAENEDPSTPREAVAVVHVDGQVPETVLAVLRKVPAVQRAKAIRLF |
| Ga0208715_11011132 | 3300025482 | Arctic Peat Soil | SDQPREAIAVVHVDGRVPEEVLAKLRTIPAVQKAKAVRLL |
| Ga0208937_10988441 | 3300025506 | Peatland | RGVDPSSELREAIAVVHVDGSVPDDVLRKLEKIPAVRQAKAVRLF |
| Ga0208691_11475781 | 3300025612 | Peatland | EAIAVVHVDGQVSEAVLNKLRKIPAVQQAKAVRLF |
| Ga0207642_107068632 | 3300025899 | Miscanthus Rhizosphere | SEEELAGQPREAIAVVHVDGAVPEAVLGELRKSPAVKEAKAIRLS |
| Ga0207710_104036672 | 3300025900 | Switchgrass Rhizosphere | EAIAVVHVDGRVPEGVLKVLRKVDAIEQAKAIRLF |
| Ga0207699_103273172 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DVQKESDQPREAIAVVHVDGRVSEDVLAKLRTIPAVQKAKAVRLF |
| Ga0207654_105207051 | 3300025911 | Corn Rhizosphere | RFSGEPGTGAAREAVAVVHVDDRVPESVLMELRKIEAVEQAKAITLV |
| Ga0207695_106694562 | 3300025913 | Corn Rhizosphere | EPGTGAAREAVAVVHVDDRVPESVLMELRKIEAVEQAKAITLV |
| Ga0207695_114288662 | 3300025913 | Corn Rhizosphere | REAIAVVHVDGDVPEAVVSELRGIPAVQQAKAVRLD |
| Ga0207695_115969972 | 3300025913 | Corn Rhizosphere | AESEGDQPRQALAVVHVDGTIPEPVLAELRKANGVQQAKAIRLF |
| Ga0207693_103692311 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EAIAVVHVDGDVPEAVVSELRGIPAVQQAKAVRLD |
| Ga0207660_107399851 | 3300025917 | Corn Rhizosphere | NAPREAIAVVHMDGKVSPEVLAELRRVPAVEQAKAIRLF |
| Ga0207681_108135062 | 3300025923 | Switchgrass Rhizosphere | AGAPREAIAVVHVDGSVPEAVISELKGIPAVQQARAVRLPQ |
| Ga0207687_108696382 | 3300025927 | Miscanthus Rhizosphere | AGQPREAIAVVHVDGAVPEAVLGELRKSPAVKEAKAIRLS |
| Ga0207700_113145881 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LWEESINIADFSLGRRVIEKDSEQREAIAVVHVDGQVSVEVLKRLREIPAVQQAKAVRLF |
| Ga0207665_104997162 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SGEQTSDQPREAIAVVHVDGAVSDVVLTRLRGIPAVQRAKGVRLF |
| Ga0207679_121619941 | 3300025945 | Corn Rhizosphere | EAIAVVHVDGKVSPEVLAELRRVPAVEQAKAIRLF |
| Ga0207703_112451131 | 3300026035 | Switchgrass Rhizosphere | GSSREAIAVVHVDGSVPEAVISELKGIPAVQQAKAVRLPQ |
| Ga0207698_101105161 | 3300026142 | Corn Rhizosphere | GTPREAIAVVHVDGPVPQAVISELKGIPAVQQARAVRLPQ |
| Ga0209871_10879002 | 3300026217 | Permafrost Soil | FSLGRRAAEKNSDQPRQAIAVVHVDGSVTEQVLAKLRTIPAVQQAKAVRLF |
| Ga0209055_11286892 | 3300026309 | Soil | GNGENGKPREAIAVVHVDGRVPDDVLRELCRVPAVEVAKAVELF |
| Ga0209154_12268071 | 3300026317 | Soil | GRKAVAVVHIDGRVPEEVVKALRKIPAIEQAKAIRLF |
| Ga0209802_12085241 | 3300026328 | Soil | KKIGGRKAVAVVHIDGRVPEEVVKALRKIPAIEQAKAIRLF |
| Ga0209473_11694582 | 3300026330 | Soil | ESINIADFSLGRRVIEKDSEQREAIAVVHVDGQVPVEVLKRLREIPAVQQAKAVRLF |
| Ga0257179_10439772 | 3300026371 | Soil | QPEAIAVVHIDGRVPEEVLKKLRKIPAVQQAKAVRLF |
| Ga0257154_10653551 | 3300026467 | Soil | EAGSEVREAIAVVHVDGQVPDEVLRKLEQIPAVEKAKAVRLF |
| Ga0209806_11458002 | 3300026529 | Soil | ESAAQPEAIAVVHIDGRVPEEVLKKLRKIPAMQQAKAVRLF |
| Ga0179587_103480662 | 3300026557 | Vadose Zone Soil | RSADSSAETREAIAVVHVDGPVPDDVLRKLEQIPAVRQAKAVRLF |
| Ga0208240_10019764 | 3300027030 | Forest Soil | KDSDQPREAIAVVHVDGSVTDQVLAKLRTIPAVQKAKAVRLF |
| Ga0209418_10836281 | 3300027371 | Forest Soil | PRKAVAVVHVDGRVPDDVLKVLRKVPAIEQAKAIRLF |
| Ga0209222_10052721 | 3300027559 | Forest Soil | LGEEEINIANFSLGRRSGETSSQPREAIAVVHVDSRVPEEVLRKLETVPAVLQAKAVELL |
| Ga0209003_10614272 | 3300027576 | Forest Soil | RKAVAVVHIDGRVPEEVLKALRRIPAIEQAKAIRLF |
| Ga0209733_10340723 | 3300027591 | Forest Soil | EVQKESDQPREAIAVVHVDGRVPEEVLAKLRKIPAVQQAKAVQLF |
| Ga0209733_11006471 | 3300027591 | Forest Soil | MKPNTPAEAIAVVHVDSPVPEAVLLELRKIPAVQQAKAIQLY |
| Ga0209420_10662493 | 3300027648 | Forest Soil | AKPREAIAVVHVDGVVPEPVLAELRKVAAIQQAKAIRLF |
| Ga0209007_10130973 | 3300027652 | Forest Soil | LREAIAVVHVDGRVPEEVLAKLRQIPAVQQAKAVELL |
| Ga0209118_11405252 | 3300027674 | Forest Soil | STEASSEPREAIAVVHVDGPVPDDVLKKLEEIPAVRQAKAVRLF |
| Ga0209446_11265432 | 3300027698 | Bog Forest Soil | AKPREAIAVVHVDGTVPEPVLAELRKVPAIEQAKAIRLF |
| Ga0209060_100949402 | 3300027826 | Surface Soil | RRSAEKTDQAREAIAVVHVDGQVPEAVLERLRQIAAVRQAKAVRLF |
| Ga0209274_100491951 | 3300027853 | Soil | LGRRSGETSSQPREAIAVVHVDSRVPEEVLRKLETVPAVLQAKAVELL |
| Ga0209517_1001757010 | 3300027854 | Peatlands Soil | DAIAVVHVDGLVSEPVLAELRKVPAVEKAKAIRLF |
| Ga0209517_104257671 | 3300027854 | Peatlands Soil | QAGGAVMHVDGRVSDEVLAKLRTIPAVQKAKAVRLF |
| Ga0209167_102827991 | 3300027867 | Surface Soil | PREAIAVVHVDGQVPEQVLAKLRTIPAVRQAKAVRLF |
| Ga0209283_100998921 | 3300027875 | Vadose Zone Soil | NGKPREAIAVVHVDGRVPEDVLRELCKVPAVEVAKAVELF |
| Ga0209590_103771911 | 3300027882 | Vadose Zone Soil | KPGAPREAIAVVHVDGRVPPEVLAELRKVPAIERAKAIRLF |
| Ga0209275_100579993 | 3300027884 | Soil | KSDQASDAIAVVHVDGNVSDAVLAKLKKIPAVQQAKAVRLF |
| Ga0209380_100414751 | 3300027889 | Soil | RRSAETSSEPREAIAVVHVDGPVPDDVLKKLEKIPAVQQAKAVRLF |
| Ga0209380_101134531 | 3300027889 | Soil | GSDQPSEAIAVVHVDGHVSDAVLNELRKIPAVHQAKAVRLF |
| Ga0209624_103149622 | 3300027895 | Forest Soil | ESINIADFSLGRRGVGKEVQKESDQPREAIAVVHVDGRVSEAVLAKLRGIPAVQQAKAVQLF |
| Ga0209006_109399332 | 3300027908 | Forest Soil | NIADFSLGRRAVEKDAQKESDQPRAAIAVVHIDGRVSEEVLAKLRTIPAVQKAKAVRLF |
| Ga0209583_103164351 | 3300027910 | Watersheds | VGNAKPGAPREAIAVVHVDGHVPPEVLAELRKVPAVEQAKAIRLF |
| Ga0209526_103858021 | 3300028047 | Forest Soil | FRFPEAIAVVHIDGRVPEEVLKKLRKIPAVQQAKAVRLF |
| Ga0268265_110355831 | 3300028380 | Switchgrass Rhizosphere | PNEAIAVVHVDGRVPDKVLDELKKVPAVRQAKAILLL |
| Ga0302224_103936531 | 3300028759 | Palsa | AEASSEPREAIAVVHVDGHVPQEVLKKLEEIPAVRQAKAVRLF |
| Ga0265338_107101391 | 3300028800 | Rhizosphere | VQEESDQPREAIAVVHVDGRVPEEVLAKLRTIPAVQKAKAVRLL |
| Ga0308309_100884253 | 3300028906 | Soil | LGRRGAEASSEPREAIAVVHVDGRVPDDVLRELEQIPAVRQAKAVRLF |
| Ga0308309_102809261 | 3300028906 | Soil | GRRAGEGTPREAIAVVHVDSAVPEAVLVELRKVPAVAEAKAIQLF |
| Ga0308309_104439551 | 3300028906 | Soil | GNGPGAVREDIAVVHVDGAVPDRVLAALRKVPAVARAKAIRLP |
| Ga0308309_112303301 | 3300028906 | Soil | PRDAIAVVHVDGRVSPEVLAELRKVPAIEQAKAIRLF |
| Ga0311329_102049781 | 3300029907 | Bog | LGRRNGEASSSGTKADSREALAVVHVDGRVPDEVLKKLEKIPAVKQAKAVRLF |
| Ga0311363_106495061 | 3300029922 | Fen | RSAEASSEPREAIAVVHVDGQVPDAVLRKLEEIPAVRQAKAVRLF |
| Ga0311328_100985931 | 3300029939 | Bog | NGEASSSGTKADSREALAVVHVDGRVPDEVLKKLEKIPAVKQAKAVRLF |
| Ga0311340_100900131 | 3300029943 | Palsa | RSAEAGSDQPSEAIAVVHVDGKISDSVLNKLRKIPAVQQAKAVRLF |
| Ga0311343_110399751 | 3300029953 | Bog | ADSREALAVVHVDGRVPDEVLKKLEKIPAVKQAKAVRLF |
| Ga0302195_101625683 | 3300030051 | Bog | DFSLGRRSAEASSEPREAIAVVHVDGPVPDDVLKKLEKIPAVRQAKAVRLF |
| Ga0302177_102495983 | 3300030053 | Palsa | EVREAIAVVHVDGQVPDEVLRKLEQIPAVEKAKAVRLF |
| Ga0302184_103225801 | 3300030490 | Palsa | EISAHTREAIAVVHVDGPVPDEVLKQLEKIPAVRQAKAVRLF |
| Ga0311372_110147871 | 3300030520 | Palsa | SEHPREAIAVVHVDGIVPEAVLEKLRKIPAVKTAKAVRQF |
| Ga0311357_113830771 | 3300030524 | Palsa | SSEPRQAIAVVHVDGPVPDEVLKKLEEIPAVQQAKAVRLF |
| Ga0302311_109930361 | 3300030739 | Palsa | EASSEPREAIAVVHVDGHVPQEVLKKLEEIPAVRQAKAVRLF |
| Ga0170834_1025144141 | 3300031057 | Forest Soil | DFSLGRRAIEKDVQKESDQPREAIAVVHVDGRVSEEVLAKLRTIPAVQKAKAVRLL |
| Ga0170834_1103995192 | 3300031057 | Forest Soil | EAIAVVHVDGRVSDEVLAKLRTIPAVQKAKAVRLF |
| Ga0170823_169497421 | 3300031128 | Forest Soil | REAIAVVHVDGRVSEEVLAKLRTIPAVQKAKAVRLL |
| Ga0170824_1049396711 | 3300031231 | Forest Soil | QVQKASEQPREAIAVVHVDGPVPEAVLAKLRQIPAVHQAKAVQLF |
| Ga0302323_1006939921 | 3300031232 | Fen | SEAIAVVHVDVRVPDDVLAELKKIPAVLQAKAIRLL |
| Ga0265340_101115131 | 3300031247 | Rhizosphere | LGRRAVEKDVQKESDQPREAIAVVHVDGRVPEEVLAKLRTIPAVQKAKAVRLL |
| Ga0170820_167578202 | 3300031446 | Forest Soil | EKQVQKASEQPREAIAVVHVDGPVPEAVLAKLRQIPAVHQAKAVQLF |
| Ga0302320_100418591 | 3300031524 | Bog | FSLGRRNGEASSSGTKADSREALAVVHVDGRVPDEVLKKLENIPAVKQAKAVRLF |
| Ga0307476_104340151 | 3300031715 | Hardwood Forest Soil | EAIAVVHVDGRVPDDVLRKLEQISAVRQAKAVRLF |
| Ga0307474_103023952 | 3300031718 | Hardwood Forest Soil | RGAEANTEREAIAVVHVDGPVPLDVLRKLEEIPAVRQAKSVRLF |
| Ga0307469_120657321 | 3300031720 | Hardwood Forest Soil | PREAIAVVHVDGRVPEGVLAELKRIPAVEQAKAIRLF |
| Ga0307468_1024045401 | 3300031740 | Hardwood Forest Soil | GRRAGNGDPGKSREAIAVVHVDGRVPDDVLRELCEVPAVEVAKAVELF |
| Ga0307477_110925971 | 3300031753 | Hardwood Forest Soil | SEPREAIAVVHVDSRVPDDVLRKLEEIPAVRQAKAVQLF |
| Ga0307475_111625551 | 3300031754 | Hardwood Forest Soil | SLGRRSAEAGSEVREAIAVVHVDGQVPDEVLKRLEGIPAVQKAKAVRLF |
| Ga0318546_113389731 | 3300031771 | Soil | KKEPRNAVAVVHVDGRVPDDVLKELSKVAAVEQAKAIRLF |
| Ga0302319_114866331 | 3300031788 | Bog | EASSEPREAIAVVHVDGQVPDAVLRKLEEIPAVRQAKAVRLF |
| Ga0307478_113898292 | 3300031823 | Hardwood Forest Soil | SEPREAIAVVHVDGRVPDDVLRKLEEIPAVRQAKAVQLF |
| Ga0306921_126806441 | 3300031912 | Soil | GRRSRERETEQPREAIAVVHVDGAVPELVLTRLRGISAVERAKAVRLF |
| Ga0310912_106266122 | 3300031941 | Soil | LGRRSAEKETDAPREAIAVVHVDGAVPDVVLTRLRGIAAVQTAKGVRLF |
| Ga0310916_109124072 | 3300031942 | Soil | RESKREHAPKEAIAVVHVDEVVPEAILSELRKIPAVETAKAVRLF |
| Ga0335082_107882182 | 3300032782 | Soil | AAQEDPATPREAVAVVHIDGEVPEAVLAALREIPAVQRAKAIRLF |
| Ga0335078_117505112 | 3300032805 | Soil | SVDKDSDQTREAIAVVHVDGEVTEQVLTKLRAIPAVQQAKAVRLF |
| Ga0335080_106128772 | 3300032828 | Soil | GPNEAIAVVHVDGSVSEKVLDELKKVSAVRQAKAIRLF |
| Ga0335080_121707542 | 3300032828 | Soil | SESTQPREAIAVVHVDGAVPELVLTRLREIAAVQQAKAVRLF |
| Ga0335083_109716891 | 3300032954 | Soil | PREAIAVVHVDGAVPDVVLTRLRGIPAVQTAKGVRLF |
| Ga0335083_112024311 | 3300032954 | Soil | IADFSLGRRSAEIPDQPREAIAVVHVDGRISDEVLRRLREIPAVQTAKAVRLF |
| Ga0335076_114719422 | 3300032955 | Soil | SINIADFSLGRRGVDKGLDLLREAIAVVHVDGEVTEQVLTKLRGIPAVQQAKAVRLF |
| Ga0335073_120913792 | 3300033134 | Soil | ETESGEPREAIAVVHVDGVVPEDVVKKLKAIAAVHTAKAVRLF |
| Ga0335077_113560562 | 3300033158 | Soil | REALAVVHVDGVVPEPVLAELRDSPAVEQAKAIRLF |
| Ga0310914_102225743 | 3300033289 | Soil | ESKKERAPKEAIAVVHVDEVVPEAILAELRKIPAVETAKAVRLF |
| Ga0310811_102615061 | 3300033475 | Soil | GTGAAREAVAVVHVDDRVPESVLMELRKIEAVEQAKAITLV |
| Ga0370492_0048656_1_108 | 3300034282 | Untreated Peat Soil | EAIAVVHVDGQVPDEVLRKLEEIPAVRQAKAVRLF |
| ⦗Top⦘ |