


| Basic Information | |
|---|---|
| Family ID | F009577 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 316 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRQLQLIAHGEPSDVIELNTVSEPALGQEDVLISMEAAPLNPS |
| Number of Associated Samples | 230 |
| Number of Associated Scaffolds | 316 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.57 % |
| % of genes near scaffold ends (potentially truncated) | 97.47 % |
| % of genes from short scaffolds (< 2000 bps) | 93.04 % |
| Associated GOLD sequencing projects | 212 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.025 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.051 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.228 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.468 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 16.90% Coil/Unstructured: 83.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 316 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 14.24 |
| PF00440 | TetR_N | 13.92 |
| PF12680 | SnoaL_2 | 7.91 |
| PF00857 | Isochorismatase | 5.70 |
| PF01047 | MarR | 4.75 |
| PF00106 | adh_short | 4.11 |
| PF16576 | HlyD_D23 | 3.16 |
| PF00753 | Lactamase_B | 2.53 |
| PF01575 | MaoC_dehydratas | 2.22 |
| PF03625 | DUF302 | 1.90 |
| PF12700 | HlyD_2 | 0.95 |
| PF01638 | HxlR | 0.95 |
| PF07366 | SnoaL | 0.95 |
| PF03061 | 4HBT | 0.95 |
| PF04248 | NTP_transf_9 | 0.63 |
| PF00107 | ADH_zinc_N | 0.63 |
| PF13602 | ADH_zinc_N_2 | 0.63 |
| PF07681 | DoxX | 0.63 |
| PF00111 | Fer2 | 0.63 |
| PF02954 | HTH_8 | 0.63 |
| PF03992 | ABM | 0.63 |
| PF02735 | Ku | 0.63 |
| PF12697 | Abhydrolase_6 | 0.63 |
| PF03928 | HbpS-like | 0.63 |
| PF00085 | Thioredoxin | 0.63 |
| PF08843 | AbiEii | 0.32 |
| PF00196 | GerE | 0.32 |
| PF00873 | ACR_tran | 0.32 |
| PF12802 | MarR_2 | 0.32 |
| PF13474 | SnoaL_3 | 0.32 |
| PF00175 | NAD_binding_1 | 0.32 |
| PF14258 | DUF4350 | 0.32 |
| PF00892 | EamA | 0.32 |
| PF01243 | Putative_PNPOx | 0.32 |
| PF07992 | Pyr_redox_2 | 0.32 |
| PF13354 | Beta-lactamase2 | 0.32 |
| PF02566 | OsmC | 0.32 |
| PF14552 | Tautomerase_2 | 0.32 |
| PF11154 | DUF2934 | 0.32 |
| PF02826 | 2-Hacid_dh_C | 0.32 |
| PF00211 | Guanylate_cyc | 0.32 |
| PF00248 | Aldo_ket_red | 0.32 |
| PF02803 | Thiolase_C | 0.32 |
| PF03796 | DnaB_C | 0.32 |
| PF13185 | GAF_2 | 0.32 |
| PF06580 | His_kinase | 0.32 |
| PF00593 | TonB_dep_Rec | 0.32 |
| PF02896 | PEP-utilizers_C | 0.32 |
| PF12840 | HTH_20 | 0.32 |
| PF02082 | Rrf2 | 0.32 |
| PF08240 | ADH_N | 0.32 |
| PF00291 | PALP | 0.32 |
| PF07690 | MFS_1 | 0.32 |
| PF00361 | Proton_antipo_M | 0.32 |
| PF02913 | FAD-oxidase_C | 0.32 |
| PF12833 | HTH_18 | 0.32 |
| PF16925 | TetR_C_13 | 0.32 |
| COG ID | Name | Functional Category | % Frequency in 316 Family Scaffolds |
|---|---|---|---|
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 5.70 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 5.70 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 1.90 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.95 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.63 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.63 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.63 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.63 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.32 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.32 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.32 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.32 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.32 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.32 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.32 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.32 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.32 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.32 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.32 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.32 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.32 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.32 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.32 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.32 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.32 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.03 % |
| Unclassified | root | N/A | 12.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908008|FWIREl_GJ4R3DH01ETFTH | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 2166559005|cont_contig119361 | Not Available | 503 | Open in IMG/M |
| 2170459010|GIO7OMY02JW1OG | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300000559|F14TC_101085963 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300000787|JGI11643J11755_11755817 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300000955|JGI1027J12803_102144398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1424 | Open in IMG/M |
| 3300000955|JGI1027J12803_105661955 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300001593|JGI12635J15846_10646603 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300002907|JGI25613J43889_10102304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300004114|Ga0062593_101139668 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300004139|Ga0058897_11156767 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300004479|Ga0062595_101610038 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005172|Ga0066683_10746529 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005172|Ga0066683_10827773 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005181|Ga0066678_10577949 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005186|Ga0066676_10669282 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005187|Ga0066675_10350499 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300005289|Ga0065704_10537727 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005295|Ga0065707_10804124 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005295|Ga0065707_11163558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300005347|Ga0070668_101298744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 661 | Open in IMG/M |
| 3300005354|Ga0070675_102224543 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005435|Ga0070714_101266343 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005438|Ga0070701_10261248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
| 3300005438|Ga0070701_10773267 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005440|Ga0070705_100545226 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300005441|Ga0070700_101466022 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005445|Ga0070708_100799451 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300005445|Ga0070708_101493614 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005447|Ga0066689_10229924 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300005459|Ga0068867_100362701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. | 1212 | Open in IMG/M |
| 3300005459|Ga0068867_100447212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1100 | Open in IMG/M |
| 3300005467|Ga0070706_102185314 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005468|Ga0070707_101363172 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005468|Ga0070707_102180012 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005471|Ga0070698_101090640 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005518|Ga0070699_100410900 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300005529|Ga0070741_10169843 | All Organisms → cellular organisms → Bacteria | 2162 | Open in IMG/M |
| 3300005546|Ga0070696_100903574 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005549|Ga0070704_101323272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 659 | Open in IMG/M |
| 3300005552|Ga0066701_10429987 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300005555|Ga0066692_10472961 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 799 | Open in IMG/M |
| 3300005586|Ga0066691_10361045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 860 | Open in IMG/M |
| 3300005586|Ga0066691_10923370 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005618|Ga0068864_101205156 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005764|Ga0066903_100122274 | All Organisms → cellular organisms → Bacteria | 3623 | Open in IMG/M |
| 3300005764|Ga0066903_102240157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1054 | Open in IMG/M |
| 3300005764|Ga0066903_104999773 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005834|Ga0068851_10436108 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005844|Ga0068862_100068559 | All Organisms → cellular organisms → Bacteria | 3060 | Open in IMG/M |
| 3300005844|Ga0068862_101202536 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300006028|Ga0070717_10975525 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006052|Ga0075029_101209826 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006086|Ga0075019_10870116 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300006163|Ga0070715_10100888 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1346 | Open in IMG/M |
| 3300006163|Ga0070715_10151114 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300006172|Ga0075018_10819675 | Not Available | 512 | Open in IMG/M |
| 3300006176|Ga0070765_100947766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300006354|Ga0075021_11192270 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006796|Ga0066665_10537018 | Not Available | 953 | Open in IMG/M |
| 3300006844|Ga0075428_100560203 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300006844|Ga0075428_101211790 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300006844|Ga0075428_101775400 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006845|Ga0075421_101399841 | Not Available | 770 | Open in IMG/M |
| 3300006852|Ga0075433_10285416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. | 1462 | Open in IMG/M |
| 3300006852|Ga0075433_10483401 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300006854|Ga0075425_101684380 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300006893|Ga0073928_10016869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7802 | Open in IMG/M |
| 3300006904|Ga0075424_101748894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300006914|Ga0075436_100916941 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006954|Ga0079219_10235641 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1074 | Open in IMG/M |
| 3300006969|Ga0075419_11236606 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300007255|Ga0099791_10621490 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300007258|Ga0099793_10190317 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300007258|Ga0099793_10218788 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300007265|Ga0099794_10634626 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009012|Ga0066710_103897298 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009038|Ga0099829_10894356 | Not Available | 737 | Open in IMG/M |
| 3300009088|Ga0099830_10855311 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300009089|Ga0099828_10779643 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300009090|Ga0099827_11810446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300009101|Ga0105247_10385834 | Not Available | 994 | Open in IMG/M |
| 3300009143|Ga0099792_10448577 | Not Available | 799 | Open in IMG/M |
| 3300009143|Ga0099792_11088483 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 538 | Open in IMG/M |
| 3300009147|Ga0114129_10467007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
| 3300009147|Ga0114129_12693724 | Not Available | 592 | Open in IMG/M |
| 3300009156|Ga0111538_12875507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300009156|Ga0111538_14149676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 500 | Open in IMG/M |
| 3300009162|Ga0075423_10227656 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300009162|Ga0075423_11257837 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300009162|Ga0075423_12818057 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300009162|Ga0075423_13182798 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009176|Ga0105242_11378203 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300009553|Ga0105249_13470734 | Not Available | 507 | Open in IMG/M |
| 3300010046|Ga0126384_10409969 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300010046|Ga0126384_11365433 | Not Available | 659 | Open in IMG/M |
| 3300010336|Ga0134071_10116973 | Not Available | 1277 | Open in IMG/M |
| 3300010336|Ga0134071_10122030 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300010336|Ga0134071_10129093 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300010339|Ga0074046_10779681 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010341|Ga0074045_10988083 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300010358|Ga0126370_11372352 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300010366|Ga0126379_12537013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300010371|Ga0134125_10460717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1409 | Open in IMG/M |
| 3300010375|Ga0105239_12667911 | Not Available | 583 | Open in IMG/M |
| 3300010376|Ga0126381_105067088 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010399|Ga0134127_10944795 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300010403|Ga0134123_12666907 | Not Available | 567 | Open in IMG/M |
| 3300011270|Ga0137391_10683382 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300011270|Ga0137391_10749450 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 808 | Open in IMG/M |
| 3300011271|Ga0137393_10102784 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
| 3300011271|Ga0137393_10348044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1266 | Open in IMG/M |
| 3300011271|Ga0137393_11082306 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300011271|Ga0137393_11296959 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300012096|Ga0137389_11458170 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012096|Ga0137389_11564434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300012096|Ga0137389_11839940 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012153|Ga0153980_1091747 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012189|Ga0137388_10213853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1742 | Open in IMG/M |
| 3300012189|Ga0137388_11713161 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012198|Ga0137364_10060772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2552 | Open in IMG/M |
| 3300012199|Ga0137383_10687327 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300012200|Ga0137382_10315371 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300012202|Ga0137363_10053914 | All Organisms → cellular organisms → Bacteria | 2895 | Open in IMG/M |
| 3300012202|Ga0137363_10874925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 763 | Open in IMG/M |
| 3300012203|Ga0137399_10206861 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300012205|Ga0137362_10032889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4127 | Open in IMG/M |
| 3300012205|Ga0137362_10727477 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300012205|Ga0137362_11558507 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012207|Ga0137381_10447841 | Not Available | 1127 | Open in IMG/M |
| 3300012208|Ga0137376_11166090 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012208|Ga0137376_11586271 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012210|Ga0137378_11782970 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012211|Ga0137377_11744700 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012349|Ga0137387_10516963 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300012351|Ga0137386_10251968 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300012355|Ga0137369_10761915 | Not Available | 662 | Open in IMG/M |
| 3300012362|Ga0137361_10026844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4493 | Open in IMG/M |
| 3300012362|Ga0137361_10248013 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300012362|Ga0137361_11428211 | Not Available | 615 | Open in IMG/M |
| 3300012363|Ga0137390_10017210 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 6599 | Open in IMG/M |
| 3300012363|Ga0137390_10224218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1866 | Open in IMG/M |
| 3300012396|Ga0134057_1222676 | Not Available | 952 | Open in IMG/M |
| 3300012410|Ga0134060_1287503 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012582|Ga0137358_10182458 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300012582|Ga0137358_10213552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1316 | Open in IMG/M |
| 3300012582|Ga0137358_11053698 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012685|Ga0137397_10805780 | Not Available | 697 | Open in IMG/M |
| 3300012685|Ga0137397_11274466 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012918|Ga0137396_11087340 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012922|Ga0137394_10314720 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300012922|Ga0137394_11112356 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012923|Ga0137359_10269186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1519 | Open in IMG/M |
| 3300012924|Ga0137413_11845895 | Not Available | 500 | Open in IMG/M |
| 3300012925|Ga0137419_10949606 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012927|Ga0137416_10616983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 946 | Open in IMG/M |
| 3300012927|Ga0137416_12209851 | Not Available | 506 | Open in IMG/M |
| 3300012929|Ga0137404_10101991 | All Organisms → cellular organisms → Bacteria | 2317 | Open in IMG/M |
| 3300012929|Ga0137404_10388426 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1229 | Open in IMG/M |
| 3300012929|Ga0137404_11342037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 660 | Open in IMG/M |
| 3300012930|Ga0137407_10859213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 858 | Open in IMG/M |
| 3300012930|Ga0137407_11451593 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012955|Ga0164298_10723208 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300012955|Ga0164298_11700497 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012957|Ga0164303_11173687 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012971|Ga0126369_11709693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 718 | Open in IMG/M |
| 3300012972|Ga0134077_10303564 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012975|Ga0134110_10120752 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300012984|Ga0164309_10893682 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012987|Ga0164307_10967044 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012989|Ga0164305_10492530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 962 | Open in IMG/M |
| 3300012989|Ga0164305_10533363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 930 | Open in IMG/M |
| 3300012989|Ga0164305_11841436 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300013297|Ga0157378_11105610 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300013306|Ga0163162_11096988 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300014969|Ga0157376_11612091 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300015241|Ga0137418_10763615 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300015264|Ga0137403_10858381 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300015371|Ga0132258_13100142 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300015373|Ga0132257_104287906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 519 | Open in IMG/M |
| 3300016445|Ga0182038_11960569 | Not Available | 530 | Open in IMG/M |
| 3300017822|Ga0187802_10021622 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300018072|Ga0184635_10261763 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300018431|Ga0066655_10228114 | Not Available | 1173 | Open in IMG/M |
| 3300019789|Ga0137408_1172707 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300019883|Ga0193725_1132372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 556 | Open in IMG/M |
| 3300020170|Ga0179594_10034547 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300020199|Ga0179592_10180017 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300020579|Ga0210407_10100377 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300020580|Ga0210403_10381649 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300020580|Ga0210403_10458942 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300020580|Ga0210403_11292145 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300020583|Ga0210401_10214715 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300021082|Ga0210380_10367665 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300021168|Ga0210406_10061883 | All Organisms → cellular organisms → Bacteria | 3244 | Open in IMG/M |
| 3300021168|Ga0210406_10217434 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300021168|Ga0210406_10785090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Root63 | 726 | Open in IMG/M |
| 3300021168|Ga0210406_10812854 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300021170|Ga0210400_11213920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300021170|Ga0210400_11464205 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300021178|Ga0210408_11002082 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300021180|Ga0210396_10002507 | All Organisms → cellular organisms → Bacteria | 18718 | Open in IMG/M |
| 3300021401|Ga0210393_10608064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 893 | Open in IMG/M |
| 3300021406|Ga0210386_11757600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. SVR | 511 | Open in IMG/M |
| 3300021432|Ga0210384_10113474 | All Organisms → cellular organisms → Bacteria | 2429 | Open in IMG/M |
| 3300021475|Ga0210392_10331747 | Not Available | 1097 | Open in IMG/M |
| 3300021478|Ga0210402_10367455 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1335 | Open in IMG/M |
| 3300021559|Ga0210409_10932353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300021559|Ga0210409_11052567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300021559|Ga0210409_11060740 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300022726|Ga0242654_10264776 | Not Available | 621 | Open in IMG/M |
| 3300022756|Ga0222622_10416872 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300024288|Ga0179589_10163934 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300024288|Ga0179589_10493578 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300024330|Ga0137417_1211073 | Not Available | 685 | Open in IMG/M |
| 3300025885|Ga0207653_10388118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300025905|Ga0207685_10477008 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025905|Ga0207685_10591026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300025906|Ga0207699_10550230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 837 | Open in IMG/M |
| 3300025906|Ga0207699_10595717 | Not Available | 805 | Open in IMG/M |
| 3300025906|Ga0207699_10962349 | Not Available | 631 | Open in IMG/M |
| 3300025906|Ga0207699_11269114 | Not Available | 545 | Open in IMG/M |
| 3300025907|Ga0207645_10611696 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 740 | Open in IMG/M |
| 3300025922|Ga0207646_10774766 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300025922|Ga0207646_11832564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 518 | Open in IMG/M |
| 3300025927|Ga0207687_11913633 | Not Available | 507 | Open in IMG/M |
| 3300025930|Ga0207701_11153657 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300025934|Ga0207686_10856368 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300025934|Ga0207686_11646913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300025939|Ga0207665_11168281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 614 | Open in IMG/M |
| 3300025942|Ga0207689_11452884 | Not Available | 574 | Open in IMG/M |
| 3300026035|Ga0207703_10452854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. Fw109-5 | 1199 | Open in IMG/M |
| 3300026041|Ga0207639_11035211 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300026121|Ga0207683_11144559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 721 | Open in IMG/M |
| 3300026304|Ga0209240_1037190 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300026318|Ga0209471_1106963 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300026320|Ga0209131_1041005 | All Organisms → cellular organisms → Bacteria | 2659 | Open in IMG/M |
| 3300026332|Ga0209803_1065235 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300026335|Ga0209804_1150370 | Not Available | 1040 | Open in IMG/M |
| 3300026343|Ga0209159_1098063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1281 | Open in IMG/M |
| 3300026354|Ga0257180_1026417 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300026354|Ga0257180_1043859 | Not Available | 628 | Open in IMG/M |
| 3300026355|Ga0257149_1044603 | Not Available | 637 | Open in IMG/M |
| 3300026490|Ga0257153_1038943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. SVR | 980 | Open in IMG/M |
| 3300026494|Ga0257159_1024968 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300026508|Ga0257161_1111007 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300026550|Ga0209474_10508134 | Not Available | 610 | Open in IMG/M |
| 3300026551|Ga0209648_10101896 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
| 3300026555|Ga0179593_1164621 | Not Available | 2057 | Open in IMG/M |
| 3300027047|Ga0208730_1000965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 2319 | Open in IMG/M |
| 3300027070|Ga0208365_1043873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 597 | Open in IMG/M |
| 3300027071|Ga0209214_1040403 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300027535|Ga0209734_1103185 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027548|Ga0209523_1045418 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300027562|Ga0209735_1018602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1408 | Open in IMG/M |
| 3300027587|Ga0209220_1070870 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300027591|Ga0209733_1146526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300027651|Ga0209217_1036520 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300027824|Ga0209040_10277231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni | 828 | Open in IMG/M |
| 3300027874|Ga0209465_10684089 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300027882|Ga0209590_10578536 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300027882|Ga0209590_10886802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300027884|Ga0209275_10283165 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300027894|Ga0209068_10563589 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027903|Ga0209488_10203258 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300027903|Ga0209488_10307200 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1184 | Open in IMG/M |
| 3300027903|Ga0209488_10827796 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300028047|Ga0209526_10319909 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300028536|Ga0137415_10484252 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1044 | Open in IMG/M |
| 3300028906|Ga0308309_11021866 | Not Available | 716 | Open in IMG/M |
| 3300030939|Ga0138303_1230398 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300031057|Ga0170834_100814409 | Not Available | 837 | Open in IMG/M |
| 3300031057|Ga0170834_104959766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300031122|Ga0170822_11031686 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 544 | Open in IMG/M |
| 3300031128|Ga0170823_12567901 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031231|Ga0170824_112055037 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031231|Ga0170824_114172777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300031231|Ga0170824_116501714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300031474|Ga0170818_107708009 | Not Available | 523 | Open in IMG/M |
| 3300031708|Ga0310686_117916089 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300031718|Ga0307474_10707069 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300031720|Ga0307469_10423434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1144 | Open in IMG/M |
| 3300031720|Ga0307469_10470479 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300031720|Ga0307469_10505545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300031720|Ga0307469_11266826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300031720|Ga0307469_11277125 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031720|Ga0307469_11895326 | Not Available | 577 | Open in IMG/M |
| 3300031740|Ga0307468_100164976 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300031740|Ga0307468_100606551 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300031754|Ga0307475_11169567 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031754|Ga0307475_11271325 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031768|Ga0318509_10630426 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031820|Ga0307473_10027563 | All Organisms → cellular organisms → Bacteria | 2427 | Open in IMG/M |
| 3300031820|Ga0307473_10245242 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300031820|Ga0307473_10772383 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031833|Ga0310917_10131477 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300031892|Ga0310893_10239000 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300031908|Ga0310900_10995391 | Not Available | 689 | Open in IMG/M |
| 3300031910|Ga0306923_11071510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni | 870 | Open in IMG/M |
| 3300031946|Ga0310910_11348225 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031962|Ga0307479_10234171 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300031962|Ga0307479_11431212 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031962|Ga0307479_11506514 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300032001|Ga0306922_10550371 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1227 | Open in IMG/M |
| 3300032012|Ga0310902_10769687 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032075|Ga0310890_11187550 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300032174|Ga0307470_10287565 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032174|Ga0307470_10385421 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300032180|Ga0307471_100347779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1591 | Open in IMG/M |
| 3300032180|Ga0307471_102031562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300032180|Ga0307471_102395352 | Not Available | 667 | Open in IMG/M |
| 3300032205|Ga0307472_101567787 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300032261|Ga0306920_102843544 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300032783|Ga0335079_12026119 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032828|Ga0335080_11815404 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300033550|Ga0247829_10153419 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.01% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.32% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.32% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.32% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.32% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.32% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.32% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908008 | Soil microbial communities from sample at FACE Site Metagenome WIR_Elev2 | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012153 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA064 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIREl_06769510 | 2124908008 | Soil | MRQLQLVGFGEPSEVIELKTVSEPILDEEDVLVSMEAAPINPSDFL |
| cont_0419.00007140 | 2166559005 | Simulated | MRQLQLIAHGEPSDVIKLNTVAEPALGQEDVLISMEAAPLNPS |
| F62_05763420 | 2170459010 | Grass Soil | MRQLQLLAHGEPSDVIKLNTISEPPLGAEDVLISMEAAPLN |
| F14TC_1010859633 | 3300000559 | Soil | MRQLQLMAHGEPSDVIELNTVSAPVLGQEDVLVSMEAAPINPSDFL |
| JGI11643J11755_117558171 | 3300000787 | Soil | MSHPMRQLQLVAHGEPSDVXQLXTTPEQTLGXEDVLVSMXAAP |
| JGI1027J12803_1021443981 | 3300000955 | Soil | MRQLQLLAHGEPADVIELNTVAESALGQEDVLISMEAAPLNPSDFVLVRG |
| JGI1027J12803_1056619551 | 3300000955 | Soil | MRQLQLVAHGEPSDVIELNTVSEPALGEEEVLISMEAAPLNPSDFL |
| JGI12635J15846_106466031 | 3300001593 | Forest Soil | MRQLQLIAHGEPSDVIELDTISEPALGEEDVLISMEAAPVNPSDFLFV |
| JGI25613J43889_101023041 | 3300002907 | Grasslands Soil | MRQLQLVAHGEPSDVIELSTVPDPALGPEDVLISMEAAPLNP |
| Ga0062593_1011396682 | 3300004114 | Soil | MRQLQLVSHGEPSEVVELKTSSERDLGEDDVRISMEAAPINPSDFLLI |
| Ga0058897_111567671 | 3300004139 | Forest Soil | MAFGEPSDVIKLNTVAQPALGPEDVLISMEAAPLNPSDFLF |
| Ga0062595_1016100382 | 3300004479 | Soil | MRQLQLMAHGEPSDVIKLKTVAEPVLGQEEVLVSMEAAPLNPS |
| Ga0066683_107465292 | 3300005172 | Soil | MRQLQLIAHGEPSDVIELNTISEPALGQEDVLIAMEAAPLNPSDFL |
| Ga0066683_108277731 | 3300005172 | Soil | MRQLQLMAHGEPSDVIKLKTVAEPVLGQEEVLVSMEAAPLNPSDF |
| Ga0066678_105779491 | 3300005181 | Soil | MRQLQFIAHGEPSEVIELNTVSEPALGQEDVLISMEAAPMNPS |
| Ga0066676_106692822 | 3300005186 | Soil | MNILRRLQLVAHGEPSDVIELSTISQPALGQDEVLVSMEAAPLNPSDF |
| Ga0066675_103504991 | 3300005187 | Soil | MRQLQLVAFGEPSEVIELNTVSEPILGQEDVLVSMEAAPINPSDF |
| Ga0065704_105377272 | 3300005289 | Switchgrass Rhizosphere | MRRLQLIAHGEPSEVIELHTVSEPALGQEEVLIAMEAAPLN |
| Ga0065707_108041241 | 3300005295 | Switchgrass Rhizosphere | MRQLQLVAHGEPSDVIKLNTVSEPALGQEDVLISMEAAPINPSD |
| Ga0065707_111635581 | 3300005295 | Switchgrass Rhizosphere | MRQLQLLAHGEPSDVIELNTVAESALGQEDVLISMEAAPLN |
| Ga0070668_1012987442 | 3300005347 | Switchgrass Rhizosphere | MRQLQLVAHGEPADVIQLVTLSDPVLGPEDVLVSMEAAPL |
| Ga0070675_1022245431 | 3300005354 | Miscanthus Rhizosphere | MRQLQLMAHGEPLDIIELKTVAEPVLGPEEVLVSMEAAPLNPSDFLLVRGMY |
| Ga0070714_1012663432 | 3300005435 | Agricultural Soil | MRQLQLVAHGEPSDVVELNAVPEPVLGPEDVLISMEAAPLNPSDF |
| Ga0070701_102612482 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLLAHGEPSDVIELNTVAESALGQEDVLISMEAAPLNPSDFVLVRGM |
| Ga0070701_107732672 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLLAHGEPSDVIELNTVAESELGQEDVLISMEAAPLNPSDFVLVRGMY |
| Ga0070705_1005452261 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLVAHGEPSEVVELTTVGARALGPEDVLISMEAAPLNPSDF |
| Ga0070700_1014660221 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRLQLIAHGEPSDVIELHTVSEPALGQEDVLIAMEAAPLNPSD |
| Ga0070708_1007994512 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLIAHGEPSDVIELNTVSEPALGQEDVLISMEAAPLNPSDF |
| Ga0070708_1014936141 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLMAHGEPSEVIELNRVFEPALGQEDVLISMEAAPLNPSDFL |
| Ga0066689_102299242 | 3300005447 | Soil | MRQLQLMAHGEPPNVIELHTVSEPVLGQEEVLVSMEAAPLN |
| Ga0068867_1003627011 | 3300005459 | Miscanthus Rhizosphere | MRQLQLVSHGEPSEVVELKTSSERDLGEDDVRISMEVAPINPSDFL |
| Ga0068867_1004472121 | 3300005459 | Miscanthus Rhizosphere | MRQLQFVAHGEPSDVIKLDTVSKSALGQEDVLISMEAAPI |
| Ga0070706_1021853142 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLMAHGEPSEVIELHTVSEPALGQEDVLVSMEAAPINPSDFLLVR |
| Ga0070707_1013631722 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLVAYGEPSDVIELNTVAEPALGQEDVLISMEAAPLNPSD |
| Ga0070707_1021800121 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLVAHGEPSDVIELNTVSEPALGQDDVLISMEAAPLNP |
| Ga0070698_1010906402 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLVAFGEPSEVIELNTVSEPILGQDDVLVSMEAAPINPSDF |
| Ga0070699_1004109003 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLVAHGEPSDVIELNTISEPALGQEDVLIAMEAAPLNPSD |
| Ga0070741_101698431 | 3300005529 | Surface Soil | MRQLQLVAFGEPSEVIELNTISEPVLGQEDVLVSMEAAP |
| Ga0070696_1009035742 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLVAFGEPSEVVELNTVSESALGQEDVLVSMEAAPINPSD |
| Ga0070704_1013232721 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLVAHGEPSDVIELNTVSTPALGDEDVLVSMEAAPLNPSDFLLV |
| Ga0066701_104299872 | 3300005552 | Soil | MRQLQLMAHGEPSDVIKLKTVAEPVLGQEEVLVSMEAAPLNPSDFLLVR |
| Ga0066692_104729611 | 3300005555 | Soil | MNILRRLQLVAHGEPSDVIELNTVSQPALGQDEVLISMEAAPLNPS |
| Ga0066691_103610451 | 3300005586 | Soil | MRQLQLVAFGEPSEVIELNAVSEPALGQEDVLVSMEA |
| Ga0066691_109233701 | 3300005586 | Soil | MRQLQLMAHGEPSDVIKLKTVAEPVLGQEEVLVSMEAAPLNPSDFL |
| Ga0068864_1012051562 | 3300005618 | Switchgrass Rhizosphere | MRQLQLLAHGEPSDVIELNTVAESELGQEDVLISMEAAPLNPSDF |
| Ga0066903_1001222741 | 3300005764 | Tropical Forest Soil | MRQLQLMAFGEPSDVIQLNALAEPALGPEDVLVSMEAAPLNPSDF |
| Ga0066903_1022401571 | 3300005764 | Tropical Forest Soil | MNILRRLQLVAHGEHSDVIELSTVSQPALGKEEVLISMEAAPL |
| Ga0066903_1049997732 | 3300005764 | Tropical Forest Soil | MRQLQLMAFGEPSEVIQLNTLSKPALGAEDVLVSMEVA |
| Ga0068851_104361081 | 3300005834 | Corn Rhizosphere | MRQLQLVSHGEPSEVVELKTSSERDLGEDDVRISM |
| Ga0068862_1000685597 | 3300005844 | Switchgrass Rhizosphere | MRQLQLVSHGEPSEVVELKTSSERDLGEDDVRISME |
| Ga0068862_1012025361 | 3300005844 | Switchgrass Rhizosphere | MRQLQLVAHGEPSDVIQLATTPEQTLGQEDVLVSMEA |
| Ga0070717_109755252 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLIAHGEPSDVIELNAVSEPVLGPEDVLISMEAAPLNPSDFLFV |
| Ga0075029_1012098262 | 3300006052 | Watersheds | MQQLQLVAYGEPSDVIELNRVPEPALGQEDVLVSMEAAPI |
| Ga0075019_108701162 | 3300006086 | Watersheds | MRQLQLIAHGEPSQVVELKTSSERPLCEDDVLVSMEAASINPSDFLLIRG |
| Ga0070715_101008881 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MMNILRRLQLVAHGEPSDVIELSTVSQPALGQEDVLVSME |
| Ga0070715_101511141 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNPMRQLQLVAHGEPSDVIRLATTPEQTLGPEDVLVSMEAAPLNPS |
| Ga0075018_108196752 | 3300006172 | Watersheds | MRQLQLIAHGEPSEVIELNTVSEPALGQEEVLISMEAAPLNPSDFLF |
| Ga0070765_1009477662 | 3300006176 | Soil | MRQLQLIAHGEPPDVIELNTVSEPTLGQEDVLISMEAA |
| Ga0075021_111922701 | 3300006354 | Watersheds | MRQLQLIAHGEPSDVIELNAVSEPALGPEEVFISMEAAPLNP |
| Ga0066665_105370181 | 3300006796 | Soil | MRQLQLLAHGEPSDVIELNTVAESALGQEDVLISMEAAPLNPSDF |
| Ga0075428_1005602031 | 3300006844 | Populus Rhizosphere | MRQLQLVAHGEPSDVIKLSTVSEPALGEEEVLISMEAAPLNPSDFL |
| Ga0075428_1012117901 | 3300006844 | Populus Rhizosphere | MRQLQLLAHGEPSDVIELNTVAESELGQEDVLISMEAAPLNPSDFVLVRGM |
| Ga0075428_1017754002 | 3300006844 | Populus Rhizosphere | MRRLQLIAHGEPSDVIELHTVSEPALGQEDVLIAME |
| Ga0075421_1013998411 | 3300006845 | Populus Rhizosphere | MRQLQLLAHGEPSDVIELNTVAASALGQEDVLISMEAAPLNPSDFVLV |
| Ga0075433_102854163 | 3300006852 | Populus Rhizosphere | MRQLQLVSHGEPSEVVELKTSSERDLGEDDVRISMEAA |
| Ga0075433_104834013 | 3300006852 | Populus Rhizosphere | MRQLQLMAHGEPSEVIELNRVSEPALGQEDVLISMEAAPLNPSDF |
| Ga0075425_1016843801 | 3300006854 | Populus Rhizosphere | MRQLQLLAHGEPSDVIELNTVAESALGQEDVLISME |
| Ga0073928_100168691 | 3300006893 | Iron-Sulfur Acid Spring | MRRLQLLAHGEPSDVIELNTVAESALGEEDVLISM |
| Ga0075424_1017488942 | 3300006904 | Populus Rhizosphere | MRQLQLIAHGEPSDVVELNTIAEPALGQEDVLVSMEAAPLNPSD |
| Ga0075436_1009169411 | 3300006914 | Populus Rhizosphere | MRQLQFLAHGEPLDVTELNVVAEPALGTEDVLISMEAAPINPSDFLFVRG |
| Ga0079219_102356411 | 3300006954 | Agricultural Soil | MRQLQLVAHGEPSDVIKLNTVAEPALGEEDVLISMEAAPLNPSDFLFVRG |
| Ga0075419_112366061 | 3300006969 | Populus Rhizosphere | MRQLQLVAHGEPSDVVQLVTTPEQTLGQEDVLVSMEAAPV |
| Ga0099791_106214901 | 3300007255 | Vadose Zone Soil | MRQLQLVAHGEPSDVIELNTVSEPALGKEDVLISMEAAPLNPSDFLFVR |
| Ga0099793_101903172 | 3300007258 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDVLISM |
| Ga0099793_102187881 | 3300007258 | Vadose Zone Soil | MRQLHLIAHGEPSDVIELNTVSEPALGPEDVLISMEAAPLNPSDFLFVR |
| Ga0099794_106346261 | 3300007265 | Vadose Zone Soil | MRQLQLVAHGEPYDVIELNTISEPALGQEEVLISMEAAPLNPSDFL |
| Ga0066710_1038972981 | 3300009012 | Grasslands Soil | MRQLQLAAYGEPSEVIKLNTVAEPALGQEDVLVSMEAAPLNPSDFLLVSGR |
| Ga0099829_108943561 | 3300009038 | Vadose Zone Soil | MRQLQLLAHGEPSEVIELNAIPESALGQEDVLISMEAAPLNP |
| Ga0099830_108553112 | 3300009088 | Vadose Zone Soil | MRQLQLVAHGEPAEVIELQTVAEPALREDDVLISMEA |
| Ga0099828_107796431 | 3300009089 | Vadose Zone Soil | MRQLQLIAHGEPSDVIKLNTVAEPALGQEDVLISMEAAPLNP* |
| Ga0099827_118104461 | 3300009090 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTVPEPVLGVGDVLLSMQAAP |
| Ga0105247_103858341 | 3300009101 | Switchgrass Rhizosphere | MRQLQLLAHGEPSDVIELNTVAESELGQEDVLISMEAAPLNPS |
| Ga0099792_104485772 | 3300009143 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTVSEPTLGQEDLLISMEAAPL |
| Ga0099792_110884831 | 3300009143 | Vadose Zone Soil | MNILRRLQLVAHGEPSDVIELNTVSQPALGEEDVLVSMEAAPLNPS |
| Ga0114129_104670072 | 3300009147 | Populus Rhizosphere | MRQLQLMAHGEPSDVIELKTVAEPVLGHEEVLVSMEAAP |
| Ga0114129_126937241 | 3300009147 | Populus Rhizosphere | MRQLQLLAHGEPSEVIELNTVAESELGQEDVLISMEAAPLNPSDFVLVRG |
| Ga0111538_128755071 | 3300009156 | Populus Rhizosphere | MAHGEPSDVIKLKTVAEPVLGPEEVLVSMEAAPLNPSD |
| Ga0111538_141496761 | 3300009156 | Populus Rhizosphere | MRQLQLMAHGEPSDVIELKTVAEPVLGPEEVLVSMEAAPLNPSDF |
| Ga0075423_102276561 | 3300009162 | Populus Rhizosphere | MRQLQLIAHGEPSDVIEINTVSEPALGQEDVLISMEAAP |
| Ga0075423_112578371 | 3300009162 | Populus Rhizosphere | MRQLQLIAHGEPSDVIELNTVCEPALGEEDVLVSMEAAPLNPSDFLL |
| Ga0075423_128180572 | 3300009162 | Populus Rhizosphere | MRQLQLIAHGEPSDVIELNAVHESALGQEDVLISMEA |
| Ga0075423_131827981 | 3300009162 | Populus Rhizosphere | MRQLQLVAKGEPSDVIKLNTVSEPALGQEDVLVSMEAAP |
| Ga0105242_113782032 | 3300009176 | Miscanthus Rhizosphere | MRQLQFIAHGEPSEAIELNTVSEPALGQEDVLISMEAAPLN |
| Ga0105249_134707343 | 3300009553 | Switchgrass Rhizosphere | MRQLQLVAFGEPSEVIELNTVSEPALGQEDVLVSMEA |
| Ga0126384_104099691 | 3300010046 | Tropical Forest Soil | MRQLRLIAYGEPSEVVELNTISEPVLGQEDVLVSMEAAPLNPSDF |
| Ga0126384_113654332 | 3300010046 | Tropical Forest Soil | MRQLQLAAFGEPSEVIELNTVSEPVLGQEDVLVSME |
| Ga0134071_101169731 | 3300010336 | Grasslands Soil | MRQLQLLAHGEPSDVIELNTVAESALGQEDVLISMEAAPLNPSDFVLVRG |
| Ga0134071_101220303 | 3300010336 | Grasslands Soil | MRQLQLVAHGEPSDVIELNTVLEPALGEEEVLISME |
| Ga0134071_101290933 | 3300010336 | Grasslands Soil | LHLIAHGEPSDVIELNTVSEPALGQEDVLISMEAAPM |
| Ga0074046_107796811 | 3300010339 | Bog Forest Soil | MRQLQLMAFGEPSDVIQLNTVAEPPLGPEDVLVSMEAAPLNPSDF |
| Ga0074045_109880832 | 3300010341 | Bog Forest Soil | MRQLQLIAHGEPSEVIELNTVSEPPLGQEDVLISMEAAPLNPSD |
| Ga0126370_113723522 | 3300010358 | Tropical Forest Soil | MRQLQLIANGEPWDVVELRTVAEPVLGHDDVLVSMEAAPLNPSDFL |
| Ga0126379_125370132 | 3300010366 | Tropical Forest Soil | MRQLQLMVFGEPSDVIQLNTLAEPALGPEDVLVSME |
| Ga0134125_104607173 | 3300010371 | Terrestrial Soil | MRLLQLVAHGEPSDVIQLATTPEQTLGQEDVLVSMEAAPLNPS |
| Ga0105239_126679112 | 3300010375 | Corn Rhizosphere | MRQVQLIAHGEPSEVIELNTVSEPALGQEDVLISMEAAP |
| Ga0126381_1050670881 | 3300010376 | Tropical Forest Soil | MRQLQLVAHGELSDVIELNRVSEPALGHDDVLVSMKAA |
| Ga0134127_109447951 | 3300010399 | Terrestrial Soil | MRQLQIMAHGEPSDVIKLKTVAEPVLGPEEVLVSMEAAPLNPSDFL |
| Ga0134123_126669071 | 3300010403 | Terrestrial Soil | MRQLQLLAHGEPSDVIELNTVAESELGQEDVLISMEAAPLNPSDFV |
| Ga0137391_106833821 | 3300011270 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNAVSEPALGPEDVLISM |
| Ga0137391_107494501 | 3300011270 | Vadose Zone Soil | MNRLRRLQLVAHGEPSDVIELSTVSQPALGQEDVLVSMEAAPLN |
| Ga0137393_101027844 | 3300011271 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTISEPALGQEDVLISMEAAPLN |
| Ga0137393_103480441 | 3300011271 | Vadose Zone Soil | MRQLQLMAFGEPSEVIQLNTLSEPALGPEDVLISMEAAPLNPSD |
| Ga0137393_110823061 | 3300011271 | Vadose Zone Soil | MRQLQLTAHGEPSDVIELNTVSEPALGPEEVLISMEAAPVN |
| Ga0137393_112969592 | 3300011271 | Vadose Zone Soil | MRHLQLLAHGEPSEVIGLNVIPESALGQEDVLISMEAAPLNPSD |
| Ga0137389_114581702 | 3300012096 | Vadose Zone Soil | MRRLQLVAHGEPSDVIELDTVPDPALGPEDVLISM |
| Ga0137389_115644342 | 3300012096 | Vadose Zone Soil | LQIIAFGEPADVIELNTVSEPALGQEDVLISMEAAPLN |
| Ga0137389_118399401 | 3300012096 | Vadose Zone Soil | MRQLQVIAHGEPSDVIELNAVSEPALGPEDVLISMEAAPLNPSDFL |
| Ga0153980_10917471 | 3300012153 | Attine Ant Fungus Gardens | MRQLQLIAHGEPSDVIKLNTVAEPDLGQEDVLISMEAA |
| Ga0137388_102138533 | 3300012189 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELKTISEPALGEEDVLISMEAAPLNP |
| Ga0137388_117131611 | 3300012189 | Vadose Zone Soil | MRQLQLIAHGEPSDVVELKTISEPALGPEEVLVTMEAAPLN |
| Ga0137364_100607723 | 3300012198 | Vadose Zone Soil | MRQLKLIAHGEPSDVIELNTVSEPALGQEDVLISMEAAPMN |
| Ga0137383_106873271 | 3300012199 | Vadose Zone Soil | MRQLQLVAHGKPSDVIELNTVSELALGQEEVLVSMEAAPLNP |
| Ga0137382_103153712 | 3300012200 | Vadose Zone Soil | MRQLQLLAHGEPSDVIELNTVAESALGPEDVLISMEAA |
| Ga0137363_100539141 | 3300012202 | Vadose Zone Soil | MRQLQLMAQGEPSDVIKLKTVAEPDLGQEEVLVSMEAAPLNPSDF |
| Ga0137363_108749252 | 3300012202 | Vadose Zone Soil | MNILRQLQLVAHGEPSDVIKLNTVAEPALGQEDVLISMEAAPI |
| Ga0137399_102068611 | 3300012203 | Vadose Zone Soil | MRQLQLMAHGEPSDVIKLKTVAEPDLGQEEVLVSMEAAPLNP* |
| Ga0137362_100328891 | 3300012205 | Vadose Zone Soil | MRRLQRIAHGDPSEVIELHTVSAPALGQEEVLITMEAAPLNPSDFLLV |
| Ga0137362_107274772 | 3300012205 | Vadose Zone Soil | MRQLQLTAHGEPSDVIQLNTLSEPALGPEEVLISMEAA |
| Ga0137362_115585071 | 3300012205 | Vadose Zone Soil | MRQLQLIAHGEPSDVIKLNTVAEPDLGQEDVLISMEAAPLNPSDFM |
| Ga0137381_104478411 | 3300012207 | Vadose Zone Soil | MRQLQLSAHGEPSDVIELNTVAESALGQEDVLISMEAAPLNPSDFVLVRG |
| Ga0137376_111660902 | 3300012208 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELRTVSEPALGQEDVLISMEAA |
| Ga0137376_115862711 | 3300012208 | Vadose Zone Soil | MRQLQLVAYGEPSDVIELNTVPEPALGQEDVLISMEAAPLNPSDF |
| Ga0137378_117829701 | 3300012210 | Vadose Zone Soil | MRRLQLIAHGEPSEVIELHTVSEPALGQEEVLIAMEAAPLNPS |
| Ga0137377_117447001 | 3300012211 | Vadose Zone Soil | MRQLQLIAHGEPLDVIKLNTVAEPALGQEGVLISMEAAPLNPSDF |
| Ga0137387_105169632 | 3300012349 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDVLISMEAAPLNPSDFLFVR |
| Ga0137386_102519681 | 3300012351 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTVSERALGQEDVLISMEAAPVNPSDFLFVGGT |
| Ga0137369_107619152 | 3300012355 | Vadose Zone Soil | MRQLQLMAQGEPSDVIELNTVSEPVLGQEDVLISMEAAP |
| Ga0137361_100268446 | 3300012362 | Vadose Zone Soil | MHERGLFMRQLQLVAHGKPSDVIELNTVCEPALGQEEVLVSME |
| Ga0137361_102480132 | 3300012362 | Vadose Zone Soil | MRQLQLVAHGEPSDVIELNRVSEPALGEEEVLIT* |
| Ga0137361_114282111 | 3300012362 | Vadose Zone Soil | MRQLQFIAHGEPSEVIELNTVSEPALGQEDVLISME |
| Ga0137390_100172101 | 3300012363 | Vadose Zone Soil | MRRLQLIAHGGPSEVIALHTVSEPALGQEEVLIAMEAAPLNPSDFL |
| Ga0137390_102242185 | 3300012363 | Vadose Zone Soil | MRQLQLVAHGEPSEVIELHTVSEPVLGQEDVLVSMEAAPLNP |
| Ga0134057_12226762 | 3300012396 | Grasslands Soil | MRQLQLLAHGEPSDVIELNTVAESGLGQEDVLISMEAAPLNPSDFV |
| Ga0134060_12875032 | 3300012410 | Grasslands Soil | MRQLQLVAHGEPSDVIELNTVSEPALGEEDVLVSMEAAPLNPTDFLF |
| Ga0137358_101824581 | 3300012582 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNAVSEPALSPEEVLISMEAAPLNPSDFLFA |
| Ga0137358_102135521 | 3300012582 | Vadose Zone Soil | MRQLQLVAFGEPSEVIELNTVSEPALGQEDVLVSMEAAPINPSDVL |
| Ga0137358_110536982 | 3300012582 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDLLISMEAAPLNPSDFLFVRG |
| Ga0137397_108057801 | 3300012685 | Vadose Zone Soil | MRQLQLLAHGEPSAVIELNTVAESALGQGDVLISMEAAPLNPSDF |
| Ga0137397_112744661 | 3300012685 | Vadose Zone Soil | MKGVFMRQLQLLAHGEPSDVIKLKTVAEPALGQEEVLVSMEAAPLNPSDFLF |
| Ga0137396_110873401 | 3300012918 | Vadose Zone Soil | MRRLQLIAHGDPSDVIELHTVSEPALGQEEVLITMEAAPLN |
| Ga0137394_103147203 | 3300012922 | Vadose Zone Soil | MRQLPLVAHGEPSDVIELNTVSEPALGQDDVLISMEAAPLNPS |
| Ga0137394_111123561 | 3300012922 | Vadose Zone Soil | MRQLQLTAHGEPSDVIELNTVPEPALGQEEVLISMEAAPLNPSDFLF |
| Ga0137359_102691861 | 3300012923 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDVLISMEAAPLNPSDFL |
| Ga0137413_118458952 | 3300012924 | Vadose Zone Soil | MQQLQFVAHGEPSNVIELNAVSEPALGQEDVLISME |
| Ga0137419_109496061 | 3300012925 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELKTVSEPALGQEDVLISMEAAP |
| Ga0137416_106169831 | 3300012927 | Vadose Zone Soil | MQRLQLAAHGEPSDVIELSTVPDPALGPEDVLVSMEAAPLNPSDF |
| Ga0137416_122098511 | 3300012927 | Vadose Zone Soil | MRRLQLLAHGEPSDVIELKTVAESALGQEDVLISM |
| Ga0137404_101019914 | 3300012929 | Vadose Zone Soil | MRQLQLMAHGEPSDVIKLKTVAEPALGQEEVLVSM |
| Ga0137404_103884261 | 3300012929 | Vadose Zone Soil | MNILRRLQLVAHGEPSDVIELSTISQPALGQDEVLISMEAAPLNPS |
| Ga0137404_113420372 | 3300012929 | Vadose Zone Soil | MNILRRLRLVAHGEPSDVIELSAVSQPALGQDEVLISMEAAPLNPS |
| Ga0137407_108592131 | 3300012930 | Vadose Zone Soil | MNRLRRLQLVAHGEPSDVIELNTVFEPALGQEDVLVSMEAAPLNPSDFLFVR |
| Ga0137407_114515931 | 3300012930 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDVLISMEAAPLNPSDFLF |
| Ga0164298_107232082 | 3300012955 | Soil | MRQLQLIAHGEPSDVIQLNTVSEPPLGPEEVLISMEAAPLNP |
| Ga0164298_117004971 | 3300012955 | Soil | MSNPMRQLQLVAHGEPLDVIQLATTPEQTLGQEDVLVSMEAAPLNPSDFLF |
| Ga0164303_111736871 | 3300012957 | Soil | MRQLQLVAHGEPSDVIQLATTPEQTLGQEDVLVSMEAAPLNPSDFL |
| Ga0126369_117096931 | 3300012971 | Tropical Forest Soil | MNILRRLQLVAHGEHSDVIELSTVSQPALGKEEVLISMEAAPLNPSDFL |
| Ga0134077_103035642 | 3300012972 | Grasslands Soil | MRQLQLTAHGEPSDVIKLKTVAEPVLGQEEVLVSMEAA |
| Ga0134110_101207523 | 3300012975 | Grasslands Soil | MAHGEPPDVIELHTVSEPVLGQEEVLVSMEAAPLNPS |
| Ga0164309_108936821 | 3300012984 | Soil | MRLLQLVAHGEPSDVIQLATTPEQTLGQEDVLVSMEAAPL |
| Ga0164307_109670442 | 3300012987 | Soil | MRQLQLVAHGEPLDVIQLATTPEQTLGQEDVLVSMEAAPLNPSDFLFV |
| Ga0164305_104925303 | 3300012989 | Soil | MRQLQLIAHGEPSDVIQLNTISEPALGQEDVLISME |
| Ga0164305_105333633 | 3300012989 | Soil | MRQLQLIAHGEPSDVIELKTVSEPALGPEDLLISME |
| Ga0164305_118414361 | 3300012989 | Soil | MRQLQLVAHGEPSDVIQLATTPEQTLGQEDVLVSMEAAPLNPSDFLFV |
| Ga0157378_111056104 | 3300013297 | Miscanthus Rhizosphere | MRQLQLAAFGEPSEVIELKTVPEPVLGQEDVLVSMEAASIN |
| Ga0163162_110969882 | 3300013306 | Switchgrass Rhizosphere | MRQLQLMAHGEPSDVIELKTVAEPLLGPEEVLVSMEAAPLNPSDFLLV |
| Ga0157376_116120911 | 3300014969 | Miscanthus Rhizosphere | MRQLQFIAHGEPSEVIELNTVSEPALGQEDVLISMEAAP |
| Ga0137418_107636152 | 3300015241 | Vadose Zone Soil | MRRLQLIAHGDPSEVIELHTVSEPALGQEEVLITMEAAPLN |
| Ga0137403_108583811 | 3300015264 | Vadose Zone Soil | MRQLQLVAFGEPSEVIELNTVSEPVLGQEDVLVSMEAAT |
| Ga0132258_131001421 | 3300015371 | Arabidopsis Rhizosphere | MRQLQLLAHGEPSDVIQLNTVAEAAIGREDVLISMEAAPLNPSDFVLVRGMYGIQ |
| Ga0132257_1042879062 | 3300015373 | Arabidopsis Rhizosphere | MKRSFLMRQLQLVAHGEPSDVIELITVSEPVLGEEEVLVSME |
| Ga0182038_119605691 | 3300016445 | Soil | MRQLQLMAFGEPSDVIQLNTLAEPALGPEEVLVSMEAAP |
| Ga0187802_100216222 | 3300017822 | Freshwater Sediment | MRQLQLIAHGEPSDVIKLNTVSEPALGQEDVLISMEAAPLNPSDFLFVRGT |
| Ga0184635_102617632 | 3300018072 | Groundwater Sediment | MRHLQLLAHGEPADVIELNTIAESALGQEDVLISME |
| Ga0066655_102281141 | 3300018431 | Grasslands Soil | MRQLQLLAHGEPSDVIELNTVAESALGHEDVLISMEAAPLNPSDFLFV |
| Ga0137408_11727073 | 3300019789 | Vadose Zone Soil | MRQLQLTAHGEPSDVIELNTVPEPALGQEEVLISMEAA |
| Ga0193725_11323721 | 3300019883 | Soil | MRQLQLIAHGEPSEVIELNTVAEPALGQEDVLISMEAAPL |
| Ga0179594_100345471 | 3300020170 | Vadose Zone Soil | MRQLQIVAHGEPSDVIELSTVSEPALGQEDVLISMEAAPLNPS |
| Ga0179592_101800173 | 3300020199 | Vadose Zone Soil | MRQLQLIAHGEPSDVIKLNTVSEPVLDQGGLLISMEAA |
| Ga0210407_101003771 | 3300020579 | Soil | MRQLQLIAHGEPSDVIELNTVSDPALGPEEVLISMEAAP |
| Ga0210403_103816493 | 3300020580 | Soil | MSNPMRQLQLVAHGEPSDVIQLAATPEQTLGREDVL |
| Ga0210403_104589421 | 3300020580 | Soil | MRQLQLIAHGEPSDVIELNTDSDPALGPEEVLISMEAAPLNPSDF |
| Ga0210403_112921451 | 3300020580 | Soil | MRQLQLIAHGEPSDVIELKTVPEPPLGQDDVLISMEAAPMNPS |
| Ga0210401_102147154 | 3300020583 | Soil | MRRLQLIAHGEPSDVIELNTVSEPALGQEDLLISM |
| Ga0210380_103676652 | 3300021082 | Groundwater Sediment | MRQLQLMAHGEPSDVIELKTVAEPVLGPEEVLVSMEAAPLN |
| Ga0210406_100618831 | 3300021168 | Soil | MRQLQLVAHGEPSDVIELNTVSEPALGPEEVLISMEAAPVNPSD |
| Ga0210406_102174341 | 3300021168 | Soil | MRQLQFIAHGEPSDVIQLNTIPEPPLGQEDALISMEAAPLDPSDFL |
| Ga0210406_107850901 | 3300021168 | Soil | MRQLQFIAHGEPSDVIQLNTIPEPALGQEDVLISMEAAPLDPSDFLFILGM |
| Ga0210406_108128541 | 3300021168 | Soil | MRQLQLIAYGEPSDVIKLNTIAEPALGQEDVLISIEAAPLNPSD |
| Ga0210400_112139201 | 3300021170 | Soil | VRLLQLIAHGEPSDVIELNTVSEPALGQEDVLISMEAAPVKSIGL |
| Ga0210400_114642051 | 3300021170 | Soil | MRQLQLIAHGEPSDVIELNTVYEPVLGQDDVLISMEAAPLNPS |
| Ga0210408_110020821 | 3300021178 | Soil | MRQLQLLAFGEPSEVVELNTVSEPVLGQEDVLVSMEAAPLNGG |
| Ga0210396_100025077 | 3300021180 | Soil | MRQLHLVAPGEPSDVIELHKVSEPALGQEDVLISIERISKA |
| Ga0210393_106080642 | 3300021401 | Soil | MRQLQFIAHGEPSDVIQLNTIPEPALGQEDVLISMEAAPLDPSDFL |
| Ga0210386_117576001 | 3300021406 | Soil | MQQLQLVAYGEPSKVIELNKVSEPVLGQEDVLVSMEAA |
| Ga0210384_101134741 | 3300021432 | Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDLLISM |
| Ga0210392_103317473 | 3300021475 | Soil | MRQLHLIAHGEPSDVIELNTVSEPALGQEDLLISMEAAPLNPSDFLF |
| Ga0210402_103674551 | 3300021478 | Soil | MNILRRLQLVAHGEPSDVIELSTVSQPALGRDEVLISMEAAPLNPSD |
| Ga0210409_109323531 | 3300021559 | Soil | MRQLQFIAHGEPSDVIQLNTIPEPALGQEDVLISME |
| Ga0210409_110525672 | 3300021559 | Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDVLISMEAAPL |
| Ga0210409_110607402 | 3300021559 | Soil | MRQLQLAAQGEPSDVIELNTVSEPALGKEDVLISMEGAPLDPSDFLFVRGMYGVR |
| Ga0242654_102647761 | 3300022726 | Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDLLISMEAAPLNPSDF |
| Ga0222622_104168721 | 3300022756 | Groundwater Sediment | MRQLQLIAHGEPSDVIELNTVSEPVLGQEDVLIPMEAAPLNPSDFLFV |
| Ga0179589_101639341 | 3300024288 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDVLISMEAAPLNPS |
| Ga0179589_104935782 | 3300024288 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDVLISME |
| Ga0137417_12110731 | 3300024330 | Vadose Zone Soil | MRQLHLIAHGEPSDVIELNTVSEPALGQEDVLISMEAERRR |
| Ga0207653_103881182 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLMAHGEPSEVIELNRVSEPALGQEDVLISME |
| Ga0207685_104770082 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLVAHGEPSDVIELNTVSEPALGEEEVLISMEAAPLNPSD |
| Ga0207685_105910261 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLVAFGEPSEVIELNTVSEPVLGQDDVLVSMEAAPINPS |
| Ga0207699_105502302 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQFIAHGEPSDVIQLNTIPEPALGQEDVLISMEAAPLDPSDFLFV |
| Ga0207699_105957172 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLRLMGNGEPSEVIELNTVSEPALGQEDVLISMEAAP |
| Ga0207699_109623491 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQVIAHGEPSDVIELNAISEPALGQEDVLISMEAAPLNPSDF |
| Ga0207699_112691142 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHLQLVAHGEPSDVIELKTVSEPALGQEDVLISMEAAPLNPSDFLFVL |
| Ga0207645_106116961 | 3300025907 | Miscanthus Rhizosphere | MRQLQLLAHGEPSAVIELNTVAEPALGQEDVLISMEAAP |
| Ga0207646_107747663 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLVAFGEPSEVIELNTVSEPVLGQEDVLVSME |
| Ga0207646_118325642 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQLMAHGEPADVIEPRTVAEPVLGPEEVLVSMEAAPLNP |
| Ga0207687_119136331 | 3300025927 | Miscanthus Rhizosphere | MRQLQLVANGEPSDVIKLNTVSEPALGQEEVLVSME |
| Ga0207701_111536571 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLQIMAHGEPSDVIKLKTVAEPVLGQEEVLVSMEAAPLNPS |
| Ga0207686_108563681 | 3300025934 | Miscanthus Rhizosphere | MRQLQLIAHGEPSEVIELNTVSEPALGQEDVLISMEAAPINPSDFLFVR |
| Ga0207686_116469132 | 3300025934 | Miscanthus Rhizosphere | MRQLQLLAHGEPSDVIELNTVAESALGQEDVLVSMEAAPLNP |
| Ga0207665_111682812 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRLQLVAHGEPLDVIELNTVSTPALGDEDVLVSMEAA |
| Ga0207689_114528841 | 3300025942 | Miscanthus Rhizosphere | MRQLQLLAHGEPSDVIELKTVAESALGQEDVLISMEAAPLNLSDFVLVRGMYGI |
| Ga0207703_104528543 | 3300026035 | Switchgrass Rhizosphere | MRQLQLVAFGEPSEVIELKTVPEPVLGQEDVLVSMEA |
| Ga0207639_110352112 | 3300026041 | Corn Rhizosphere | MRQLQLVAHGEPSDVIQLATTPEQTLGQEDVLVSMEAAPLNPSD |
| Ga0207683_111445591 | 3300026121 | Miscanthus Rhizosphere | MRQLQLLAHGEPSDVIELKTVAQSALGQEDVLISMEAAPLNPSDFLFVRG |
| Ga0209240_10371904 | 3300026304 | Grasslands Soil | MKLFMRQLQLVAHGEPSEVIELNTVAEPALGPEDVLIS |
| Ga0209471_11069633 | 3300026318 | Soil | MRQLQLIAHGEPSDVIELNTVSEPTLGQEEVLISME |
| Ga0209131_10410051 | 3300026320 | Grasslands Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDVLISMEA |
| Ga0209803_10652354 | 3300026332 | Soil | MRQLQLVAYGEPSDVIELHTVSEPVLGEQDVLLSMEAAPLNPSDFLF |
| Ga0209804_11503702 | 3300026335 | Soil | MRQLQLVAHGEPSDVIKLNTVPEPALGQEDVLISMEAAPINPSDFLYV |
| Ga0209159_10980631 | 3300026343 | Soil | MRQLQLLAHGEPSDVIELNTVAESALGQEDVLISM |
| Ga0257180_10264172 | 3300026354 | Soil | MRQLQLIAHGEPSDVIKLNTVAEPDLGQEDVLISMEAAPLNPSDFLFVRGT |
| Ga0257180_10438592 | 3300026354 | Soil | MRRLQLLAHGEPSDVIELNTVAESALGQEDVLISMEAAPLN |
| Ga0257149_10446032 | 3300026355 | Soil | MRQLQLIAHGEPSDVIELNAVTEPALGPEDVLISMEAAP |
| Ga0257153_10389432 | 3300026490 | Soil | MQQLQLVAYGEPSDVIELNRVPEPALGQEDVLVSMEAAPINPSDCM |
| Ga0257159_10249681 | 3300026494 | Soil | MRQLQLIAYGEPSDVIKLNTIAEPALGQEDVLISIEA |
| Ga0257161_11110072 | 3300026508 | Soil | MRQLQLIAHGEPSDVIKLNTVAEPALGQEDVLISIEAAPLNPS |
| Ga0209474_105081341 | 3300026550 | Soil | MRQLQLIAHGEPSDVIELNAVSEPALGPEDVLISMEAAPLNPSDFL |
| Ga0209648_101018961 | 3300026551 | Grasslands Soil | MRQLQLVAHGEPSDVIELNTVPEPALGPEDVLISMEAAPLNPSDFL |
| Ga0179593_11646211 | 3300026555 | Vadose Zone Soil | MRQLQLLAHGEPSDVIELNTVAESALGQEDVLISMEAAPLNPSDFLFVRG |
| Ga0208730_10009651 | 3300027047 | Forest Soil | MRQLQLIAHGQPSDVIELNTVSEPTLGPDEVLISMEAAP |
| Ga0208365_10438731 | 3300027070 | Forest Soil | MRQLQLMAFGEPLDVIQLNTLAEPALGPEDVLVSMEAAPLNPSDFLLVRGIY |
| Ga0209214_10404032 | 3300027071 | Forest Soil | MRQLQLIAHGEPSDVIKLNTVAEPALGQEDVLISME |
| Ga0209734_11031853 | 3300027535 | Forest Soil | MRQLQLIAHGEPSEVIELNTVSEPVLGQEDVLISMEAAPLNPSDFLFVR |
| Ga0209523_10454182 | 3300027548 | Forest Soil | MRQLQLIAHGEPSEVIELNTISEPALGQEEVLISMEAAPLNPSDFLFVSGKYGV |
| Ga0209735_10186021 | 3300027562 | Forest Soil | MRQLQLIAHGEPSDVIELNTVSEPALGPEEVLISMEAAPVNPSDFL |
| Ga0209220_10708701 | 3300027587 | Forest Soil | MRQLQLIAHGEPSDVIELNTISEPALGQEDVLISMEAAPLNPSDFLFV |
| Ga0209733_11465261 | 3300027591 | Forest Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDLLISMEAAPLNPSD |
| Ga0209217_10365203 | 3300027651 | Forest Soil | MQQLQLVAYGEPSDVIELNRVPEPALGQGDVLVSMEAA |
| Ga0209040_102772311 | 3300027824 | Bog Forest Soil | MRQLQLIANGEPSDVIELNTVSEPALGQEDVLISMEAAPLNPS |
| Ga0209465_106840891 | 3300027874 | Tropical Forest Soil | MRQLRQISYGEPSDVIELNTISESALDQEDVLVSMEA |
| Ga0209590_105785361 | 3300027882 | Vadose Zone Soil | MRQLQLVAFGEPSEVIELNAVSEPALGQEDVLVSMEAAPI |
| Ga0209590_108868022 | 3300027882 | Vadose Zone Soil | MRQLQLVAHGEPSDVIELSTVPDPALGPEDVLISMEAAPLNPSDFLFV |
| Ga0209275_102831651 | 3300027884 | Soil | MRRLQLIAHGEPSDVIELNTVSEPALGQEDLLISMEAAPL |
| Ga0209068_105635891 | 3300027894 | Watersheds | MSNPMRQLQLVAHGEPSDVVQLATTPEQTLGQEDVLVSMEAAPVNPSDFLFVR |
| Ga0209488_102032581 | 3300027903 | Vadose Zone Soil | MRQLQLIAHGEPSDVIELNAVSEPALSPEEVLISMEAAPLNPSDFLFVSGK |
| Ga0209488_103072002 | 3300027903 | Vadose Zone Soil | MNVLRRLQLVAHGEPSGVIKLNTAPEPALGQEDVLISMEAAP |
| Ga0209488_108277961 | 3300027903 | Vadose Zone Soil | MRQLQLVAHGEPSDVIELNTVSEPALGPEDVLVSMAAAPL |
| Ga0209526_103199091 | 3300028047 | Forest Soil | MRQLQFIAHGEPSDVIQLNTIPEPVLGQEDVLISMEAAPLNP |
| Ga0137415_104842522 | 3300028536 | Vadose Zone Soil | MNRLRRLQLVAHGEPSDVIELSTVSQPALGQEDVLVSME |
| Ga0308309_110218661 | 3300028906 | Soil | MRQLQLMAHGEPSDVIELNTVSEPALGQEDVLITM |
| Ga0138303_12303982 | 3300030939 | Soil | MNTLRRLQLVAHGEPSDVIELSTVSQPALGQDEVLISMEAKR |
| Ga0170834_1008144093 | 3300031057 | Forest Soil | MRQLQLLAHGEPSQVIELRTVAESALGQEDVLISME |
| Ga0170834_1049597664 | 3300031057 | Forest Soil | MRQLQLIAHGEPSDVIELNTISEPALGPEEVLISMEAAPL |
| Ga0170822_110316862 | 3300031122 | Forest Soil | MRQLQLLAHGEPSDVIELSTVAEPALGEEEVLISMEAAPLN |
| Ga0170823_125679011 | 3300031128 | Forest Soil | MRQLKLVAHGEPSDVIELNAVSEPALGPEEVLISMEAAPINPSDFLF |
| Ga0170824_1120550371 | 3300031231 | Forest Soil | MRQLQLLAHGEPSDVIKLNTISEPPLGAEDVLISMEA |
| Ga0170824_1141727772 | 3300031231 | Forest Soil | MRQLQLIAHGEPSDVIELNTLSEPALGQEDVLISMEAAPLNP |
| Ga0170824_1165017142 | 3300031231 | Forest Soil | MRQLQLIAHGEPSDVIELNTISEPALGPEEVLISMEAAPLNP |
| Ga0170818_1077080091 | 3300031474 | Forest Soil | MRQLQLIAHGEPSDVIELNTVSEPVLDQGDLLISMEAAPINPSDFL |
| Ga0310686_1179160893 | 3300031708 | Soil | MRQLHFIAHGEPSDVIELNTVSEPALGQEDVLISME |
| Ga0307474_107070691 | 3300031718 | Hardwood Forest Soil | MRRLQLKAHGEPSDVIELDTVSEPALGQEAVLISMEA |
| Ga0307469_104234343 | 3300031720 | Hardwood Forest Soil | MRQLRLMGNGEPSEVIELNTVSEPALGQEDVLISMEAAPINPSDFLFVR |
| Ga0307469_104704793 | 3300031720 | Hardwood Forest Soil | MNRMRQLQLVAHGEPSDVIELNTVFEPALGQEDVLIAMEAAPLNPSDFLFV |
| Ga0307469_105055452 | 3300031720 | Hardwood Forest Soil | MRQLQLVAHGEPSDVIELNTLSTPALGDEDVLVSMEAAPLNPS |
| Ga0307469_112668262 | 3300031720 | Hardwood Forest Soil | MRQLQLVAHGEPSDVIELKTVAAPALGEEDVLISMEAAPLNPSDFL |
| Ga0307469_112771251 | 3300031720 | Hardwood Forest Soil | MRQLQLVAKGEPSDVIKLNTVSEPALGQEDVLVSMEAAPSNPSD |
| Ga0307469_118953262 | 3300031720 | Hardwood Forest Soil | MRQVQLIAHGEPSEVIELNTVSEPALGQEDVLISMEAAPINPSD |
| Ga0307468_1001649763 | 3300031740 | Hardwood Forest Soil | MRQLQLIAHGEPSEVIELKTFSEPVLGPEEVIVSMEAAPLNPSD |
| Ga0307468_1006065511 | 3300031740 | Hardwood Forest Soil | MRQLQLVAFGEPSEVIELKTVPEPVLGQEDVLVTME |
| Ga0307475_111695673 | 3300031754 | Hardwood Forest Soil | MRQLQLIAHGEPSDVIELNTVSEPALGQEDLLISMEAAPL |
| Ga0307475_112713252 | 3300031754 | Hardwood Forest Soil | MRQLQLIAHGEPSNVIKLNTVAEPALGQEDVLISMEAA |
| Ga0318509_106304263 | 3300031768 | Soil | MWQLQLVVHGELSDVIELNRVSEPVLGHDDVLVSMKAAPIHRSDFLLARGIYG |
| Ga0307473_100275631 | 3300031820 | Hardwood Forest Soil | MRRLQLIAHGDPSEVIELHTVSEPALGQEDVLITMEAA |
| Ga0307473_102452422 | 3300031820 | Hardwood Forest Soil | MRQLKLIAHGKPSDVIELNTVSEPALGQEEVLISMEAAPLNPSDFLFVSGKY |
| Ga0307473_107723832 | 3300031820 | Hardwood Forest Soil | MRQLQLVAHGEPSDVIELNTVSTPALGDDDVLVSMEAAPLNPIGL |
| Ga0310917_101314772 | 3300031833 | Soil | MRQLQLIAHGEPSDVIELKTVPEPPLGQDDVLISME |
| Ga0310893_102390001 | 3300031892 | Soil | MRQLQLVSHGEPSEVVELKTSSERDLGEDDVRISMEAAPIN |
| Ga0310900_109953912 | 3300031908 | Soil | MRQLQLVSHGEPSEVVELKTSSERDLGEDDVRISMEAAPINP |
| Ga0306923_110715102 | 3300031910 | Soil | VWQLQLIAHGEPSDVIELNTVSEAALGQEDVLISMEAAP |
| Ga0310910_113482252 | 3300031946 | Soil | MRRLQLIAHGEPAEVIELHTVSEPALGQEDVLISMAAAALNPSDFL |
| Ga0307479_102341714 | 3300031962 | Hardwood Forest Soil | MRQLQLIAHGEPSDVIELNKVSEPVLGQEDVLISMEAAPLN |
| Ga0307479_114312121 | 3300031962 | Hardwood Forest Soil | MRQLQLVAHGEPSDVIELNTVPEPALGPEDVLISMEAAPINP |
| Ga0307479_115065141 | 3300031962 | Hardwood Forest Soil | MRELQLLAHGEPSDVIELNTVAESAPGQEDVLISMEAAPLNPSD |
| Ga0306922_105503711 | 3300032001 | Soil | MRQLQLMAHGEPADVIELVTVPDPGLGQEDVLVSMEAAPLNPSDF |
| Ga0310902_107696871 | 3300032012 | Soil | MRQLQLVAHGEPSDVIQLATTPEQTLGQEDVLVSMEAAPLNPSDFLFVR |
| Ga0310890_111875501 | 3300032075 | Soil | MRQLQLMAHGEPSDVIKLKTVTEPVLGQEEVLVSMEAAPLNPSDFLL |
| Ga0307470_102875654 | 3300032174 | Hardwood Forest Soil | MRQLRLVAFGEPSEVIELNTVSEPALGQEDVLVSMEAAPINP |
| Ga0307470_103854211 | 3300032174 | Hardwood Forest Soil | MRQLQLLAHGEPSDVIELNTVAEPALGQEEVLISMEAAPLNPSDFVLV |
| Ga0307471_1003477791 | 3300032180 | Hardwood Forest Soil | MRQLQLAAFGEPSEVIELKTVSEPILGEEDVLVSMEAAPI |
| Ga0307471_1020315622 | 3300032180 | Hardwood Forest Soil | MRQLQLVAHGEPSDVIELNTAPDPVLGPEDVLISMEAAPLNP |
| Ga0307471_1023953521 | 3300032180 | Hardwood Forest Soil | MRQLQLTAHGEPADVIELRTVREPVLGQEEILVAMEAAPLD |
| Ga0307472_1015677872 | 3300032205 | Hardwood Forest Soil | MRQLQLVAFGEPSEVIELNTVSEPILGQEDVLVSME |
| Ga0306920_1028435442 | 3300032261 | Soil | MRQLRQISYGEPSDVIELNAISESALDQEDVLVSMEA |
| Ga0335079_120261192 | 3300032783 | Soil | MRQLQLIAHGEPSDVIKLNTVSEPALGQEDVLISMEAAP |
| Ga0335080_118154041 | 3300032828 | Soil | MRQLQILAHGEPSDVIELNTVSEPPLGQEDVLISMEAAPLNPSDFLF |
| Ga0247829_101534195 | 3300033550 | Soil | MRRLQLRAHGEPSDVIALHTVSEPALGQEDVLIAMEAAPLN |
| ⦗Top⦘ |