


| Basic Information | |
|---|---|
| Family ID | F009565 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 316 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMAATK |
| Number of Associated Samples | 198 |
| Number of Associated Scaffolds | 316 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.04 % |
| % of genes near scaffold ends (potentially truncated) | 75.95 % |
| % of genes from short scaffolds (< 2000 bps) | 73.73 % |
| Associated GOLD sequencing projects | 180 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.848 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.861 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.861 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.785 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.71% β-sheet: 0.00% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 316 Family Scaffolds |
|---|---|---|
| PF05368 | NmrA | 2.85 |
| PF12833 | HTH_18 | 2.85 |
| PF01872 | RibD_C | 1.27 |
| PF12704 | MacB_PCD | 1.27 |
| PF01638 | HxlR | 1.27 |
| PF00753 | Lactamase_B | 1.27 |
| PF13205 | Big_5 | 1.27 |
| PF00106 | adh_short | 1.27 |
| PF12802 | MarR_2 | 1.27 |
| PF03551 | PadR | 0.95 |
| PF13305 | TetR_C_33 | 0.95 |
| PF12867 | DinB_2 | 0.95 |
| PF00440 | TetR_N | 0.95 |
| PF01546 | Peptidase_M20 | 0.95 |
| PF13360 | PQQ_2 | 0.95 |
| PF08818 | DUF1801 | 0.95 |
| PF01047 | MarR | 0.95 |
| PF04224 | DUF417 | 0.63 |
| PF01548 | DEDD_Tnp_IS110 | 0.63 |
| PF01425 | Amidase | 0.63 |
| PF13411 | MerR_1 | 0.63 |
| PF13460 | NAD_binding_10 | 0.63 |
| PF07695 | 7TMR-DISM_7TM | 0.63 |
| PF07228 | SpoIIE | 0.63 |
| PF13620 | CarboxypepD_reg | 0.63 |
| PF04238 | DUF420 | 0.63 |
| PF02687 | FtsX | 0.63 |
| PF07690 | MFS_1 | 0.63 |
| PF13431 | TPR_17 | 0.63 |
| PF03401 | TctC | 0.32 |
| PF13561 | adh_short_C2 | 0.32 |
| PF03795 | YCII | 0.32 |
| PF01979 | Amidohydro_1 | 0.32 |
| PF13602 | ADH_zinc_N_2 | 0.32 |
| PF01209 | Ubie_methyltran | 0.32 |
| PF02371 | Transposase_20 | 0.32 |
| PF01135 | PCMT | 0.32 |
| PF05988 | DUF899 | 0.32 |
| PF12645 | HTH_16 | 0.32 |
| PF13231 | PMT_2 | 0.32 |
| PF00724 | Oxidored_FMN | 0.32 |
| PF02558 | ApbA | 0.32 |
| PF06094 | GGACT | 0.32 |
| PF13847 | Methyltransf_31 | 0.32 |
| PF16757 | Fucosidase_C | 0.32 |
| PF08281 | Sigma70_r4_2 | 0.32 |
| PF09917 | DUF2147 | 0.32 |
| PF00535 | Glycos_transf_2 | 0.32 |
| PF01040 | UbiA | 0.32 |
| PF00221 | Lyase_aromatic | 0.32 |
| PF08388 | GIIM | 0.32 |
| PF12543 | DUF3738 | 0.32 |
| PF03707 | MHYT | 0.32 |
| PF02599 | CsrA | 0.32 |
| PF14534 | DUF4440 | 0.32 |
| PF02897 | Peptidase_S9_N | 0.32 |
| PF12697 | Abhydrolase_6 | 0.32 |
| PF14588 | YjgF_endoribonc | 0.32 |
| PF00072 | Response_reg | 0.32 |
| PF01124 | MAPEG | 0.32 |
| PF08546 | ApbA_C | 0.32 |
| PF00282 | Pyridoxal_deC | 0.32 |
| PF00127 | Copper-bind | 0.32 |
| PF00903 | Glyoxalase | 0.32 |
| PF07045 | DUF1330 | 0.32 |
| PF02592 | Vut_1 | 0.32 |
| PF05199 | GMC_oxred_C | 0.32 |
| PF13466 | STAS_2 | 0.32 |
| PF04986 | Y2_Tnp | 0.32 |
| PF02954 | HTH_8 | 0.32 |
| PF08279 | HTH_11 | 0.32 |
| PF08592 | Anthrone_oxy | 0.32 |
| PF00126 | HTH_1 | 0.32 |
| PF00795 | CN_hydrolase | 0.32 |
| PF00581 | Rhodanese | 0.32 |
| PF01042 | Ribonuc_L-PSP | 0.32 |
| PF12705 | PDDEXK_1 | 0.32 |
| PF09084 | NMT1 | 0.32 |
| PF13701 | DDE_Tnp_1_4 | 0.32 |
| PF10605 | 3HBOH | 0.32 |
| PF00665 | rve | 0.32 |
| PF02826 | 2-Hacid_dh_C | 0.32 |
| PF01288 | HPPK | 0.32 |
| PF01212 | Beta_elim_lyase | 0.32 |
| PF08448 | PAS_4 | 0.32 |
| PF08002 | DUF1697 | 0.32 |
| PF07676 | PD40 | 0.32 |
| PF06884 | DUF1264 | 0.32 |
| PF14329 | DUF4386 | 0.32 |
| PF01432 | Peptidase_M3 | 0.32 |
| PF05973 | Gp49 | 0.32 |
| PF10604 | Polyketide_cyc2 | 0.32 |
| PF03466 | LysR_substrate | 0.32 |
| PF14863 | Alkyl_sulf_dimr | 0.32 |
| COG ID | Name | Functional Category | % Frequency in 316 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.22 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.27 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.27 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.95 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.95 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.95 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.95 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.63 |
| COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| COG3059 | Reactive chlorine resistance protein RclC/YkgB, DUF417 family | Defense mechanisms [V] | 0.63 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.63 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.63 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 0.63 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.32 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.32 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.32 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.32 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.32 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.32 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.32 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.32 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 0.32 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.32 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.32 |
| COG3300 | MHYT domain, NO-binding membrane sensor | Signal transduction mechanisms [T] | 0.32 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.32 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.32 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.32 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.32 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.32 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.32 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.32 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.32 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.32 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.32 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.32 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.32 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.32 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.32 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.32 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.32 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.32 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.32 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.32 |
| COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.32 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.32 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.32 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.32 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.32 |
| COG1551 | sRNA-binding carbon storage regulator CsrA | Signal transduction mechanisms [T] | 0.32 |
| COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 0.32 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.32 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.32 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.32 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.48 % |
| Unclassified | root | N/A | 21.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0477186 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101627214 | All Organisms → cellular organisms → Bacteria | 3973 | Open in IMG/M |
| 3300000559|F14TC_104994055 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300000955|JGI1027J12803_101481488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 877 | Open in IMG/M |
| 3300000955|JGI1027J12803_108697077 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1611 | Open in IMG/M |
| 3300004091|Ga0062387_100993854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300005174|Ga0066680_10064330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2184 | Open in IMG/M |
| 3300005541|Ga0070733_10410255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 902 | Open in IMG/M |
| 3300005602|Ga0070762_10747595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → unclassified Methylobacter → Methylobacter sp. BBA5.1 | 659 | Open in IMG/M |
| 3300005713|Ga0066905_101111661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300005764|Ga0066903_100597107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1912 | Open in IMG/M |
| 3300005764|Ga0066903_101606376 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300005764|Ga0066903_101903575 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300005764|Ga0066903_102503285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 999 | Open in IMG/M |
| 3300005764|Ga0066903_102994557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300005764|Ga0066903_103201041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300005764|Ga0066903_107933871 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005764|Ga0066903_108441966 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005841|Ga0068863_102448435 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005921|Ga0070766_10935022 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005921|Ga0070766_10935106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300006028|Ga0070717_10899875 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300006032|Ga0066696_10561416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300006050|Ga0075028_100072198 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300006163|Ga0070715_10736447 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006176|Ga0070765_100106051 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300006354|Ga0075021_10162193 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300006797|Ga0066659_10762532 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300006797|Ga0066659_11719011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300006800|Ga0066660_10912370 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300006852|Ga0075433_11167717 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006893|Ga0073928_10590095 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300007255|Ga0099791_10204023 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300007258|Ga0099793_10663399 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300007258|Ga0099793_10729761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300007265|Ga0099794_10444307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300007265|Ga0099794_10499593 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300007788|Ga0099795_10235567 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300009012|Ga0066710_101710713 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300009038|Ga0099829_10284888 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300009038|Ga0099829_10497114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300009038|Ga0099829_10506136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
| 3300009038|Ga0099829_10681950 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300009038|Ga0099829_11604730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300009038|Ga0099829_11778615 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300009088|Ga0099830_11664015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300009089|Ga0099828_10044637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3649 | Open in IMG/M |
| 3300009089|Ga0099828_10060709 | All Organisms → cellular organisms → Bacteria | 3171 | Open in IMG/M |
| 3300009089|Ga0099828_11458632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300009137|Ga0066709_100259536 | All Organisms → cellular organisms → Bacteria | 2333 | Open in IMG/M |
| 3300009143|Ga0099792_10173586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300009792|Ga0126374_10337847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. FMUSA5-5 | 1027 | Open in IMG/M |
| 3300009792|Ga0126374_10516662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300010043|Ga0126380_11297821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300010046|Ga0126384_10915678 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300010046|Ga0126384_10954889 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300010046|Ga0126384_10979154 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300010046|Ga0126384_11577458 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300010047|Ga0126382_10277979 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300010329|Ga0134111_10531269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300010358|Ga0126370_10294123 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300010358|Ga0126370_12286835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300010359|Ga0126376_12220158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300010359|Ga0126376_12362191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300010359|Ga0126376_12864236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 532 | Open in IMG/M |
| 3300010360|Ga0126372_12536780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300010361|Ga0126378_10315436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1669 | Open in IMG/M |
| 3300010361|Ga0126378_11917558 | Not Available | 674 | Open in IMG/M |
| 3300010362|Ga0126377_13106811 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010366|Ga0126379_10014074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5757 | Open in IMG/M |
| 3300010366|Ga0126379_10680090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1121 | Open in IMG/M |
| 3300010366|Ga0126379_11578645 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300010376|Ga0126381_100203063 | All Organisms → cellular organisms → Bacteria | 2652 | Open in IMG/M |
| 3300010376|Ga0126381_100569180 | Not Available | 1608 | Open in IMG/M |
| 3300010376|Ga0126381_100886222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1284 | Open in IMG/M |
| 3300010376|Ga0126381_102102151 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300010376|Ga0126381_102683816 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300010376|Ga0126381_102983640 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010398|Ga0126383_11019898 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300010398|Ga0126383_11659443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300010398|Ga0126383_13601555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300011269|Ga0137392_10830770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300011270|Ga0137391_10012856 | All Organisms → cellular organisms → Bacteria | 6738 | Open in IMG/M |
| 3300011270|Ga0137391_10361790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300011270|Ga0137391_10640474 | Not Available | 888 | Open in IMG/M |
| 3300011270|Ga0137391_11492238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300011270|Ga0137391_11553239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300011271|Ga0137393_10161258 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
| 3300011271|Ga0137393_10452185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300011271|Ga0137393_10507507 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300011271|Ga0137393_11080824 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300011271|Ga0137393_11351020 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300011271|Ga0137393_11413320 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012096|Ga0137389_10668511 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300012096|Ga0137389_11368126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300012189|Ga0137388_10071352 | All Organisms → cellular organisms → Bacteria | 2895 | Open in IMG/M |
| 3300012189|Ga0137388_10081951 | All Organisms → cellular organisms → Bacteria | 2723 | Open in IMG/M |
| 3300012189|Ga0137388_10145605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2092 | Open in IMG/M |
| 3300012189|Ga0137388_10267778 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300012189|Ga0137388_11985985 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012199|Ga0137383_10340739 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300012199|Ga0137383_10447451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300012199|Ga0137383_10568309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300012201|Ga0137365_11219876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300012202|Ga0137363_10086155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2353 | Open in IMG/M |
| 3300012202|Ga0137363_10475310 | All Organisms → cellular organisms → Archaea | 1048 | Open in IMG/M |
| 3300012203|Ga0137399_10153563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1841 | Open in IMG/M |
| 3300012203|Ga0137399_10209167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1587 | Open in IMG/M |
| 3300012203|Ga0137399_10397007 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300012205|Ga0137362_11119920 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012205|Ga0137362_11178708 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012206|Ga0137380_10125360 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
| 3300012206|Ga0137380_10377851 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300012207|Ga0137381_10808126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300012209|Ga0137379_10102973 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
| 3300012210|Ga0137378_10431308 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300012210|Ga0137378_11492882 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 587 | Open in IMG/M |
| 3300012211|Ga0137377_10006774 | All Organisms → cellular organisms → Bacteria | 9307 | Open in IMG/M |
| 3300012211|Ga0137377_10761956 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300012349|Ga0137387_10702098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300012351|Ga0137386_10088659 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300012351|Ga0137386_10365142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
| 3300012354|Ga0137366_10456089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300012354|Ga0137366_10742093 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012356|Ga0137371_10314487 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300012357|Ga0137384_10437471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
| 3300012357|Ga0137384_10631496 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300012359|Ga0137385_10257919 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300012361|Ga0137360_10407963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1146 | Open in IMG/M |
| 3300012362|Ga0137361_10298749 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300012362|Ga0137361_11613207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter | 569 | Open in IMG/M |
| 3300012362|Ga0137361_11898572 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012363|Ga0137390_12006093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012582|Ga0137358_10506478 | Not Available | 813 | Open in IMG/M |
| 3300012582|Ga0137358_10692928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300012683|Ga0137398_10831736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300012922|Ga0137394_10496737 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300012923|Ga0137359_10713479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300012924|Ga0137413_10083707 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300012925|Ga0137419_10798490 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300012927|Ga0137416_10704455 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012927|Ga0137416_11655023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300012929|Ga0137404_10451771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1140 | Open in IMG/M |
| 3300012961|Ga0164302_10804328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 710 | Open in IMG/M |
| 3300012971|Ga0126369_10910586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 965 | Open in IMG/M |
| 3300012971|Ga0126369_12487061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300012989|Ga0164305_10863977 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012989|Ga0164305_11568697 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300014501|Ga0182024_10834077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1119 | Open in IMG/M |
| 3300014501|Ga0182024_10991857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300014657|Ga0181522_10975651 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300015051|Ga0137414_1093709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
| 3300015054|Ga0137420_1458687 | Not Available | 4964 | Open in IMG/M |
| 3300015264|Ga0137403_10880184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter acidisoli | 746 | Open in IMG/M |
| 3300016319|Ga0182033_11297180 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300016371|Ga0182034_11025462 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300016404|Ga0182037_11141983 | Not Available | 683 | Open in IMG/M |
| 3300016445|Ga0182038_11583080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300017943|Ga0187819_10496030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300017995|Ga0187816_10304070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300018060|Ga0187765_10657823 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300018090|Ga0187770_10389422 | All Organisms → cellular organisms → Archaea | 1094 | Open in IMG/M |
| 3300018431|Ga0066655_11032966 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300020579|Ga0210407_11363629 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300020580|Ga0210403_10791157 | Not Available | 754 | Open in IMG/M |
| 3300020581|Ga0210399_10058191 | All Organisms → cellular organisms → Bacteria | 3114 | Open in IMG/M |
| 3300020581|Ga0210399_10448465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
| 3300020581|Ga0210399_11320151 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300020582|Ga0210395_11152040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300021086|Ga0179596_10448493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 653 | Open in IMG/M |
| 3300021168|Ga0210406_11272841 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300021170|Ga0210400_11313633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300021178|Ga0210408_10343973 | Not Available | 1189 | Open in IMG/M |
| 3300021401|Ga0210393_10741527 | Not Available | 800 | Open in IMG/M |
| 3300021403|Ga0210397_10212682 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300021403|Ga0210397_11392957 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300021407|Ga0210383_10920587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300021478|Ga0210402_11325104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter acidisoli | 647 | Open in IMG/M |
| 3300021560|Ga0126371_10267154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1829 | Open in IMG/M |
| 3300022557|Ga0212123_10580360 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 711 | Open in IMG/M |
| 3300024290|Ga0247667_1049838 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300025905|Ga0207685_10730760 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300025906|Ga0207699_10749529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300025915|Ga0207693_10209497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1532 | Open in IMG/M |
| 3300026318|Ga0209471_1093594 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300026319|Ga0209647_1009073 | All Organisms → cellular organisms → Bacteria | 6812 | Open in IMG/M |
| 3300026328|Ga0209802_1062906 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300026328|Ga0209802_1333185 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300026361|Ga0257176_1039944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300026377|Ga0257171_1038214 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300026482|Ga0257172_1102900 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300026514|Ga0257168_1073562 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300026528|Ga0209378_1211326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300026551|Ga0209648_10000012 | All Organisms → cellular organisms → Bacteria | 100714 | Open in IMG/M |
| 3300026557|Ga0179587_10653301 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300027326|Ga0209731_1012915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1109 | Open in IMG/M |
| 3300027334|Ga0209529_1074798 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027512|Ga0209179_1113843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300027548|Ga0209523_1138015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300027603|Ga0209331_1138057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300027609|Ga0209221_1063104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
| 3300027610|Ga0209528_1059509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 846 | Open in IMG/M |
| 3300027643|Ga0209076_1010708 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
| 3300027667|Ga0209009_1032268 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300027846|Ga0209180_10003760 | All Organisms → cellular organisms → Bacteria | 7581 | Open in IMG/M |
| 3300027846|Ga0209180_10007858 | All Organisms → cellular organisms → Bacteria | 5453 | Open in IMG/M |
| 3300027862|Ga0209701_10400309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300027862|Ga0209701_10592484 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300027867|Ga0209167_10729013 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027875|Ga0209283_10039769 | All Organisms → cellular organisms → Bacteria | 2962 | Open in IMG/M |
| 3300027895|Ga0209624_10381614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 939 | Open in IMG/M |
| 3300027915|Ga0209069_10877292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300027915|Ga0209069_10977621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300028047|Ga0209526_10159628 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300028047|Ga0209526_10281668 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300028536|Ga0137415_10324040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
| 3300028536|Ga0137415_11235818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 563 | Open in IMG/M |
| 3300028716|Ga0307311_10114350 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300028720|Ga0307317_10273245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300028906|Ga0308309_11544642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300029951|Ga0311371_11787319 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300030503|Ga0311370_12302530 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300030520|Ga0311372_12061038 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300031022|Ga0138301_1227834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300031234|Ga0302325_12800576 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031474|Ga0170818_106196827 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031545|Ga0318541_10399963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300031545|Ga0318541_10755534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300031679|Ga0318561_10175246 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300031682|Ga0318560_10823869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300031708|Ga0310686_101667433 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300031708|Ga0310686_109082031 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031715|Ga0307476_11037748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300031718|Ga0307474_10196954 | Not Available | 1532 | Open in IMG/M |
| 3300031718|Ga0307474_10232098 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300031720|Ga0307469_10229415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1476 | Open in IMG/M |
| 3300031736|Ga0318501_10454005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300031744|Ga0306918_10217147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1448 | Open in IMG/M |
| 3300031753|Ga0307477_10307024 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300031771|Ga0318546_10595860 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031781|Ga0318547_10956254 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031794|Ga0318503_10030211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1585 | Open in IMG/M |
| 3300031805|Ga0318497_10512179 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031890|Ga0306925_10848170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300031912|Ga0306921_11679407 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300031945|Ga0310913_10225285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1314 | Open in IMG/M |
| 3300031945|Ga0310913_10330287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1078 | Open in IMG/M |
| 3300031945|Ga0310913_10858061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300031946|Ga0310910_10221736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1472 | Open in IMG/M |
| 3300031946|Ga0310910_11068296 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031954|Ga0306926_13000417 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031962|Ga0307479_11222417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300032001|Ga0306922_10661201 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300032001|Ga0306922_12019255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300032009|Ga0318563_10621671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 582 | Open in IMG/M |
| 3300032261|Ga0306920_104472474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300032828|Ga0335080_12193794 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300033402|Ga0326728_11144336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.27% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.63% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.63% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.32% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.32% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.32% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.32% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.32% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.32% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_04771861 | 2228664022 | Soil | ESIAKAERLIYLKLMEKYQNTDPFKYILYSAKIGEQTPPMAENK |
| INPhiseqgaiiFebDRAFT_1016272141 | 3300000364 | Soil | RFGRTESIAKAERLIYLKLMXKYQNTDPFKXILYSAKIGEQTPPMAENK* |
| F14TC_1049940551 | 3300000559 | Soil | VYLKLMEKHQNSDPFKFIIYAAQAGEQVPQMSAAN* |
| JGI1027J12803_1014814881 | 3300000955 | Soil | RFGRTESIAKAERLIYLKLMEKYQNTDPFKYILYSAKIGEQTPPMAENK* |
| JGI1027J12803_1086970773 | 3300000955 | Soil | TRLVYLKLMEQYQNSDPFKFLLFSAKAKEQTPQMPR* |
| JGIcombinedJ26739_1005200872 | 3300002245 | Forest Soil | ASLLESSGSRFEHRTSVANAKRLVYLKLMENYQNTDPFKFIIYSGKIGEQTPQLASGK* |
| JGIcombinedJ51221_102398821 | 3300003505 | Forest Soil | LLESSGSRFEHSSSVADAKRLVYLKLMEENQNTDPFKFIIYSGKIGEQTPQMATGR* |
| JGI25404J52841_100055204 | 3300003659 | Tabebuia Heterophylla Rhizosphere | DRFAPSASXTNARRLVYLKLMEKHQNTDPFKFIIYSAKAGEQTPQIATPK* |
| Ga0062387_1009938541 | 3300004091 | Bog Forest Soil | STSVANAKRLIYLKLMEKNQNTDPFKFIIYSGKISEQTPQMATAK* |
| Ga0066680_100643303 | 3300005174 | Soil | VAKAKRLVYLKLMEKNQNTDPFKFIVYSAKSGEQTPQMSRGN* |
| Ga0066388_1016154672 | 3300005332 | Tropical Forest Soil | ASSLLESSGDRFLRSESIGRAKRLVYLKLMEKNQNTDPFKFIIYSAKIGEQTPPITLGN* |
| Ga0066388_1043790653 | 3300005332 | Tropical Forest Soil | SGDRFSHSGPVAHAKRLVYLKLIEKHQNTDPFKFIIYSAKIGEQTPQMAAPR* |
| Ga0070733_104102551 | 3300005541 | Surface Soil | RLVYLKLMEKNQNTDPFKFIIYSGQIGEQTPRLEGK* |
| Ga0070762_107475951 | 3300005602 | Soil | RFEHSTSVANAKRLVYLKLMENYQNTDPFKFIIYSGKIGEQTPQMAGDK* |
| Ga0066905_1011116611 | 3300005713 | Tropical Forest Soil | SGPVANAKRLVYLKLIEKHQNTDPFKFIIYSAKIGEQTPQMATPK* |
| Ga0066903_1005971072 | 3300005764 | Tropical Forest Soil | VAKAERLVYLKLMEQYQNTDPFKFIIYSSKAREQVPQMAALKE* |
| Ga0066903_1016063763 | 3300005764 | Tropical Forest Soil | NAKRLVYLKLIEKHQNTDPFKFIIYSAKIGEQTPQMAASK* |
| Ga0066903_1019035752 | 3300005764 | Tropical Forest Soil | LKLMEKHQNTDPFKFIIYSAKIGEQTPQMAVTNK* |
| Ga0066903_1025032853 | 3300005764 | Tropical Forest Soil | AKRLVYLKLMEKNQNTDPFKFIIYSARIGEQTPQINPSK* |
| Ga0066903_1029945572 | 3300005764 | Tropical Forest Soil | VYLKLMEKHQNTDPFKFIIYSAQIGEKTPQIAAPK* |
| Ga0066903_1032010412 | 3300005764 | Tropical Forest Soil | VRGASVTNAKRLVYLKLMEKHQNTDPFKFIIYSANIGEQTPQMAEPK* |
| Ga0066903_1079338711 | 3300005764 | Tropical Forest Soil | LEWSATRFGHTESIAKAEHLVYLKLMEKYQNTDPFKYFLYSSKIGEETPVMSGRPMDPK* |
| Ga0066903_1084419661 | 3300005764 | Tropical Forest Soil | FAKSEAVAKAERLVYLKLMEQYQNTDPFKFIIYSSKAREQVPQMAVRKE* |
| Ga0068863_1024484351 | 3300005841 | Switchgrass Rhizosphere | GRVVYLKLMEQYQNTDPFKFLLYSAKAGEQTPPKR* |
| Ga0070766_109350221 | 3300005921 | Soil | FGRTESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQPPAMAVSK* |
| Ga0070766_109351061 | 3300005921 | Soil | FGRTESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAVNK* |
| Ga0070717_108998752 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VANAKRLVYLKLMEKNQNTDPFKFILYSGKIGEQTPQMAATK* |
| Ga0066696_105614161 | 3300006032 | Soil | LVYLKLMEKYQNTDPFKYILYSAKISEQTPAMTASK* |
| Ga0075028_1000721981 | 3300006050 | Watersheds | VANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMTTAKR* |
| Ga0070715_107364472 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ASAARFGRTESIAKAQQLVYLKLMEKYQNTDPFKYILYSAKIGEQTPALAVSK* |
| Ga0070765_1001060511 | 3300006176 | Soil | KRLVYLKLMEKHQNTDPFKFIIYSGKIGERTPQMTATK* |
| Ga0075021_101621932 | 3300006354 | Watersheds | VYLKLMEKHQNTDPFKFIIYSGKIREQTPQMTATK* |
| Ga0066659_107625322 | 3300006797 | Soil | KAEHLVYVKLMEKYQNTDPFKYFLYSAKIGEETPPMSSK* |
| Ga0066659_117190111 | 3300006797 | Soil | KAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAASK* |
| Ga0066660_109123701 | 3300006800 | Soil | VYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMSATK* |
| Ga0075433_111677172 | 3300006852 | Populus Rhizosphere | ANAKRLVYLKLMEKNQNTDQFKFILYSGKIAEQTPQMAATK* |
| Ga0075425_1030618331 | 3300006854 | Populus Rhizosphere | SLLESSGDRFARSASVTGAKRLVYLKLMEKHQNTDPFKFIIYSSKIGEQTPQIAMPK* |
| Ga0075434_1017599072 | 3300006871 | Populus Rhizosphere | SLLESSGDRFDHSPAVANAKRLVYLKLMEQNQNTDPFKFILYSGKIAEQTPQMAATK* |
| Ga0073928_105900951 | 3300006893 | Iron-Sulfur Acid Spring | RLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAASK* |
| Ga0099791_102040232 | 3300007255 | Vadose Zone Soil | VYLKLMEKYQNTDPFKYILYSAKIGEHTPAMATGK* |
| Ga0099793_106633991 | 3300007258 | Vadose Zone Soil | FERSASVANAKRLVYLKLVEKHQNTDPFKFIIYSGKIGEQTPQMAAGK* |
| Ga0099793_107297611 | 3300007258 | Vadose Zone Soil | ECSSSVANAKRLVYLKLMEKHQNTDPFKFIIYSGRIGEQTPQMSYGR* |
| Ga0099794_104443072 | 3300007265 | Vadose Zone Soil | AKAERLVYFKLMEKYQNTDPFKYILYSAKIGEQTPPIVAIK* |
| Ga0099794_104995931 | 3300007265 | Vadose Zone Soil | ERLVYLKLMEKYQNTDPFKYILYSAKIGEHTPAMATGK* |
| Ga0099795_102355672 | 3300007788 | Vadose Zone Soil | VYLKLMEKTQNTDPFKFILYSAKIGEQVPQMGSATSQRLK* |
| Ga0066710_1017107132 | 3300009012 | Grasslands Soil | SVAKAERLIYLKLMEQYQNTDPFKFLLYSAKARKQTPQMAPGK |
| Ga0099829_102848881 | 3300009038 | Vadose Zone Soil | FEHSTSVANAKRLVYLKPMEKNQDTDPFKFIIYSGKISEQTPQMASGK* |
| Ga0099829_104971141 | 3300009038 | Vadose Zone Soil | RLVYLKLMEGNQNTDPFKFIIYSGKIGEQTPQMASGK* |
| Ga0099829_105061362 | 3300009038 | Vadose Zone Soil | VYLKLMEKYQNIDPFKYILYSAAIGEQTPAMAQASDHLMQQ* |
| Ga0099829_106819502 | 3300009038 | Vadose Zone Soil | SVANAKRLVYLKLMEENQNTDPFKFIIYSGKIGEQTPQMASGK* |
| Ga0099829_116047301 | 3300009038 | Vadose Zone Soil | VANAQRLVYLKLMEKHQNTDPFKFIVYSGKIGEQTPQMPTTK* |
| Ga0099829_117786151 | 3300009038 | Vadose Zone Soil | TESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMATGK* |
| Ga0099830_108926761 | 3300009088 | Vadose Zone Soil | SLLETAGKRFADSPSVGNERRLVYLKLMEKHENTDPFKFIIYSSRIGEQVPPMASGK* |
| Ga0099830_116640152 | 3300009088 | Vadose Zone Soil | RLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMTATK* |
| Ga0099828_100446371 | 3300009089 | Vadose Zone Soil | HSTSVANAKRLVYLKLMEKHQNTDPFKFIIYSGKISEQTPQMASGK* |
| Ga0099828_100607091 | 3300009089 | Vadose Zone Soil | STSVANAKRLIYLKLMEKNQNTDPFKFIIYSGKIGEQTPQMTSGK* |
| Ga0099828_114586322 | 3300009089 | Vadose Zone Soil | SASVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMATTK* |
| Ga0099827_106794532 | 3300009090 | Vadose Zone Soil | SLLESSGSRFEHSTSVANAKRLVYLKLMENYQNTDPFKFIIYSGKIGEQTTQMTRGK* |
| Ga0066709_1002595365 | 3300009137 | Grasslands Soil | AKAERLVYLKLMEKYQNTDPSKYILYSAKIGEQTPAMAAGK* |
| Ga0099792_101735863 | 3300009143 | Vadose Zone Soil | GSVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEHTPQMTATR* |
| Ga0105237_117565002 | 3300009545 | Corn Rhizosphere | LLESSGDRFSRSGPVANAKRLVYLKLIEKHQNTDPFKFIIYAAKIHQQVTQMPSGK* |
| Ga0126374_103378471 | 3300009792 | Tropical Forest Soil | KRLVYLKLMEKNQNTDPFKFIIYSAKIGEETPQINPAK* |
| Ga0126374_105166621 | 3300009792 | Tropical Forest Soil | IAKAEQLVYEKLMEKYQNTDPFKYILYSAKIGEETPAMSSK* |
| Ga0126380_104725281 | 3300010043 | Tropical Forest Soil | ASLLEASGDKFASSARVTNAKRFVYLKLMEKHQNTDPFKFIIYSAKAGEQTPQIATPK* |
| Ga0126380_112978211 | 3300010043 | Tropical Forest Soil | AEQLVYEKLMEKYQNTDPFKYILYSAKIGEQTPAMSSK* |
| Ga0126380_116510982 | 3300010043 | Tropical Forest Soil | SSADRFARTASVTDAKRLVYLKLMEKHQNTDPFKFIIYSSKIGEQTPQINPGR* |
| Ga0126384_102640011 | 3300010046 | Tropical Forest Soil | TSGDRFAPSAPVANAKRFVYLKLMEKHQNTDPFKFIIYSAKAGEQTPQIATPK* |
| Ga0126384_109156782 | 3300010046 | Tropical Forest Soil | RRLVYLKLMEKYQNIDPFKYILYSAAIGEQTPSMAARG* |
| Ga0126384_109548892 | 3300010046 | Tropical Forest Soil | RLVYLKLMEKNQNTDPFKFIIYSAKIGEQTPQINSSK* |
| Ga0126384_109791541 | 3300010046 | Tropical Forest Soil | LAARFGRTESIAKAERLVYLKLMEKYQNADPFKYFLYSAKIG |
| Ga0126384_115774581 | 3300010046 | Tropical Forest Soil | SEAVAKAERLIYMKLMEQYQNTDPFKFIIYSSKAREQVPQMPSRQD* |
| Ga0126382_102779793 | 3300010047 | Tropical Forest Soil | GSDSVKRAKRFAYLKLMEKNQITDPFKFINYSGKSGE* |
| Ga0126373_100853661 | 3300010048 | Tropical Forest Soil | AASLLESSGDRFEHSESVAKAKRLIYLKLMEKNQNTDRFKFMLDSAKIGEQTPRMSGGK* |
| Ga0126373_100890981 | 3300010048 | Tropical Forest Soil | LLESTGNRFAGSQSIARAKKLVYLKLMEKNQNTDPFKFIIYSGKIGQQTPPMIEGK* |
| Ga0099796_105392512 | 3300010159 | Vadose Zone Soil | GKRFEGSSSVANAKRLVYLKLMEENQNTDPFKFIIYSGKIGEQTPQMPTTK* |
| Ga0134111_105312692 | 3300010329 | Grasslands Soil | VANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQLAATK* |
| Ga0126370_102941231 | 3300010358 | Tropical Forest Soil | TNAKRLIYLKLMEKHQNTDPFKFIIYSAKIGEQTPQMASPK* |
| Ga0126370_122868351 | 3300010358 | Tropical Forest Soil | QFVYEKLMEKYQNTDLFKYILYSAKIGEQTLAMSGK* |
| Ga0126376_122201582 | 3300010359 | Tropical Forest Soil | FPDSAPLAEARRMVYLKLIEKYENTDPFKFIIYSSKIGEQLV* |
| Ga0126376_123621911 | 3300010359 | Tropical Forest Soil | ANARRLVYLKLMEKHRNTDPFKFIIYSAKIGEQTPQIAAPK* |
| Ga0126376_128642361 | 3300010359 | Tropical Forest Soil | AKRLVYLKLMEKNQNTDPFKFIIYSGKIGEQTPQVAIGK* |
| Ga0126372_125367801 | 3300010360 | Tropical Forest Soil | SHSVTNAKRLVYLKLMEKHQNTDPFKFIIYSAKIGEQTSQMASPK* |
| Ga0126378_103154363 | 3300010361 | Tropical Forest Soil | SASVTNAKRLIYLKLMEKHQNTDPFKFIIYSAKIGEQTPQIASPE* |
| Ga0126378_103863933 | 3300010361 | Tropical Forest Soil | LLESSGDRFARSASVANARRLVYLKLMEKHQNTDPFKFIIYSAKIGEQTPQIAVPK* |
| Ga0126378_106008012 | 3300010361 | Tropical Forest Soil | LESSGDRFKNSESVAKAKRLVYLKLMEKNQNTDPLKFILYSAKSGEQTPQMSSGN* |
| Ga0126378_116164351 | 3300010361 | Tropical Forest Soil | ASLLESSGDRFEHSESVAKAKRLIYLKLMEKNQNTDRFKFMLDSAKIGEQTPRMSGGK* |
| Ga0126378_116791802 | 3300010361 | Tropical Forest Soil | SESAGKRFADNASVDDARRLVYLKLMEKHENTDPFKFIVYSSRIAEQVPPMAAGK* |
| Ga0126378_119175581 | 3300010361 | Tropical Forest Soil | IAKAEHLVYLKLMEKYQNTDPFKYFLYSAKIGEETPVMSSK* |
| Ga0126378_122046501 | 3300010361 | Tropical Forest Soil | ESTGDRFAGSESIARAKKLVYLKLMEKNQNTDPFKFIIYSAKAAEKTPPTTGP* |
| Ga0126377_131068111 | 3300010362 | Tropical Forest Soil | AKRLVYLKLMEKNQNTDPFKFILYSAKIEEQTPQMSSGN* |
| Ga0126379_100140741 | 3300010366 | Tropical Forest Soil | VYEKLMEKYQNTDPFKYILYSAKIGEQTPAMSSK* |
| Ga0126379_106800903 | 3300010366 | Tropical Forest Soil | LVYLKLIEKHQNMDPFKFIIYSAKIGEQTPQMAAPK* |
| Ga0126379_115786451 | 3300010366 | Tropical Forest Soil | VYLKLIEKHQNTDPFKFIIYSAKAGEQTPQIAAPK* |
| Ga0126379_122868291 | 3300010366 | Tropical Forest Soil | SLLESSGDRFSRSGPVARAKRLVYLKLIEKHQNTDPFKFIIYSAKIGEQTPQMAAPK* |
| Ga0126379_136734542 | 3300010366 | Tropical Forest Soil | SADRFARSASVNNAKRLVYLKLIEKHQNTDPFKFIIYSAKIGEQTPQMTAPK* |
| Ga0126381_1002030631 | 3300010376 | Tropical Forest Soil | MEKYQNTDPFKYFLYSAKIGEETPVMSSKMSDSKEGKNAK* |
| Ga0126381_1005691804 | 3300010376 | Tropical Forest Soil | GRTDSIAKAEQLVYEKLMEKYQNTDPFKYILYSAKIGEQTPAMSSK* |
| Ga0126381_1008862221 | 3300010376 | Tropical Forest Soil | KRLVYLKLMEKHQNTDPFKFIIYSSKIGEQTPQMAAPK* |
| Ga0126381_1021021511 | 3300010376 | Tropical Forest Soil | NAKRLVYLKLMEKHQNTDPFKFIIYSAKIGEQTPQIATPK* |
| Ga0126381_1026838162 | 3300010376 | Tropical Forest Soil | ARRLVYLKLMEKHQNTDPFKFIIYSAKIGEQTPQMASRNK* |
| Ga0126381_1029836401 | 3300010376 | Tropical Forest Soil | KNSESVAKAKRLVYLKLMEKNQNTDPFKFIIYSAKSGEQTPQMSSGN* |
| Ga0126381_1038054122 | 3300010376 | Tropical Forest Soil | SGDRFARSASVTNAKRLVYLKLMEKHQNTDPFKFIIYSAKIGEQTPQMAAPK* |
| Ga0126381_1042490221 | 3300010376 | Tropical Forest Soil | SSLLETAGKRFADSPSVGNARRLVYLKLMEKHENTDTFKFIIYSSRINEQVPPMLNGK* |
| Ga0126383_110198982 | 3300010398 | Tropical Forest Soil | YLKLMEKHQNTDPFKFIIYSAKIGEQTPQMPAPQ* |
| Ga0126383_116594431 | 3300010398 | Tropical Forest Soil | KAEHLVYEKLMEKYQNTDPFKYILYSAKIGEQTPAMSSK* |
| Ga0126383_120608582 | 3300010398 | Tropical Forest Soil | SSADRFARTASVTDAKRLVYLKLMEKHQNTDPFKFIIYSSKIGEQTPQMAAPK* |
| Ga0126383_136015551 | 3300010398 | Tropical Forest Soil | KRLVYLKLMEKHQNTDPFKFIIYSSRIGEQTPQIAGDK* |
| Ga0137392_108307701 | 3300011269 | Vadose Zone Soil | NAKRLVYLKLMEKHQNTDPFKFIIYSGKISEQTPQMASGK* |
| Ga0137391_100128561 | 3300011270 | Vadose Zone Soil | AKRLVYLKLMEKHQNTDPFKFIIYSGKISEQTPQMTATK* |
| Ga0137391_100981622 | 3300011270 | Vadose Zone Soil | GDRFERSASVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMAATK* |
| Ga0137391_102203181 | 3300011270 | Vadose Zone Soil | ESSGSRFEQSTSVANAKRLIYLKLMEKNQNTDPFKFIIYSGKIGEQTPQMTSGK* |
| Ga0137391_103617902 | 3300011270 | Vadose Zone Soil | TESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMASGK* |
| Ga0137391_103796221 | 3300011270 | Vadose Zone Soil | LESSGDRFERSASVANAKRLVYLKLMEKHQNTDPFKFIIYSRKIGEQTPQLAATK* |
| Ga0137391_106404742 | 3300011270 | Vadose Zone Soil | SVANAKRLVYLKLMENYQNTDPFKFIIYSGKIGEQTPQMAIGR* |
| Ga0137391_114922382 | 3300011270 | Vadose Zone Soil | AKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMASGK* |
| Ga0137391_115532391 | 3300011270 | Vadose Zone Soil | ANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEHTPQMTATK* |
| Ga0137393_101612582 | 3300011271 | Vadose Zone Soil | LGRTESIAKAERFVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAVSK* |
| Ga0137393_104521851 | 3300011271 | Vadose Zone Soil | AKRLVYLKLMEKHQNTDPFKFIIYSGKISEQTPQVTATK* |
| Ga0137393_105075071 | 3300011271 | Vadose Zone Soil | KRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMATGK* |
| Ga0137393_110808241 | 3300011271 | Vadose Zone Soil | ESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMATGK* |
| Ga0137393_113510201 | 3300011271 | Vadose Zone Soil | RLVYLKLMEKYQNTDPFKYILYSAKIGEQTPALATGK* |
| Ga0137393_114133201 | 3300011271 | Vadose Zone Soil | RFGHTESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMATGK* |
| Ga0137389_106685112 | 3300012096 | Vadose Zone Soil | YLKLMEKYQNTDPFKYILYSAKIGEQTPAMAASK* |
| Ga0137389_113681262 | 3300012096 | Vadose Zone Soil | SVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMATTK* |
| Ga0137388_100713525 | 3300012189 | Vadose Zone Soil | SSSVANAKRLVYLELMEKHQNTDPFKFIIYSGKIGEQTPQMPTTK* |
| Ga0137388_100819511 | 3300012189 | Vadose Zone Soil | RLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMATTK* |
| Ga0137388_101456053 | 3300012189 | Vadose Zone Soil | LLESAGARFGRTESIAKAERFVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAVRK* |
| Ga0137388_102677782 | 3300012189 | Vadose Zone Soil | LVYLKLMEKYQNTDPFKYILYSAKIGEQTPATATGQ* |
| Ga0137388_119859852 | 3300012189 | Vadose Zone Soil | ERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMATGK* |
| Ga0137383_103407392 | 3300012199 | Vadose Zone Soil | VAKAKRLVYLKLMEKNQNTDPFKFIVYSAKSGEQTPQMSGGN* |
| Ga0137383_104474511 | 3300012199 | Vadose Zone Soil | SVADAKRLIYLKLMEKSQNTDPFKFIIYSRKIGEQTPQMASK* |
| Ga0137383_105683092 | 3300012199 | Vadose Zone Soil | VYLKLMEKYQNTDPFKYILYSAKIGEQTPQMANGK* |
| Ga0137383_108965632 | 3300012199 | Vadose Zone Soil | LESSGDRFEHSGSVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQLAATK* |
| Ga0137365_112198761 | 3300012201 | Vadose Zone Soil | KRLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMTSTK* |
| Ga0137363_100861551 | 3300012202 | Vadose Zone Soil | AEQLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMTTSK* |
| Ga0137363_104753102 | 3300012202 | Vadose Zone Soil | AKAERLIYRKLMEQYQNYDPFKFILYSAKAGEQTPQMTPAK* |
| Ga0137399_101535631 | 3300012203 | Vadose Zone Soil | LVYLKLMEENQNTDPFKFIIYSGKISEQTPQMASGK* |
| Ga0137399_102091671 | 3300012203 | Vadose Zone Soil | LVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAASK* |
| Ga0137399_103970072 | 3300012203 | Vadose Zone Soil | FEHSTSVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMASGKR* |
| Ga0137362_111199202 | 3300012205 | Vadose Zone Soil | VYLKLMEKYQNTDPFKYILYSAKIGEQTPAMATGK* |
| Ga0137362_111787082 | 3300012205 | Vadose Zone Soil | ASVANAKRLVYLKLVEKHQNTDPFKFIIYSGKIGEQTPQMAAGK* |
| Ga0137380_101253602 | 3300012206 | Vadose Zone Soil | VAKAKRLVYLKLMEKNHNTDPFKFIVYSAKSGEQTPQMSRGN* |
| Ga0137380_103778513 | 3300012206 | Vadose Zone Soil | VYLKLMEKHQNTDPFKFIIYSGKIREQTPQMTSTK* |
| Ga0137381_108081261 | 3300012207 | Vadose Zone Soil | RLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQLAATK* |
| Ga0137381_108397771 | 3300012207 | Vadose Zone Soil | SLLESSGDRFERSASVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQLAATK* |
| Ga0137379_101029733 | 3300012209 | Vadose Zone Soil | AKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMAATK* |
| Ga0137379_108985511 | 3300012209 | Vadose Zone Soil | LESSGDRFERSASVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMAATK* |
| Ga0137378_104313081 | 3300012210 | Vadose Zone Soil | SSSVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMTATK* |
| Ga0137378_114928821 | 3300012210 | Vadose Zone Soil | RLIYLKLMEQYQNTDPFKFLLYSAKAREQTPQMAPGK* |
| Ga0137377_1000677411 | 3300012211 | Vadose Zone Soil | YLKLMEKHQNTDPFKFIIYSGKIREQTPQMTSTK* |
| Ga0137377_107619563 | 3300012211 | Vadose Zone Soil | YLKLMEQYQNTDPFKFILYSAKAREQTPQMAPGK* |
| Ga0137377_112241251 | 3300012211 | Vadose Zone Soil | GSRFAHSTPVAKARRLIYLKLIEKHQNLDPFKFIIYSGQIGEHVPQMDSGK* |
| Ga0137387_107020982 | 3300012349 | Vadose Zone Soil | YLKLMEKHQNTDPFKFIIYSGKIGEQTPQLAATK* |
| Ga0137386_100886592 | 3300012351 | Vadose Zone Soil | VAKAKRVVYLKLMEKNQNTDPFKFIVYSAKSGEQTPQMSRGN* |
| Ga0137386_103651423 | 3300012351 | Vadose Zone Soil | EHSTSVANAKRLVYFKLMEKHQNTDPFKFIIYSGKISDQTPQMASGQ* |
| Ga0137366_104560891 | 3300012354 | Vadose Zone Soil | VANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMAATK* |
| Ga0137366_107420931 | 3300012354 | Vadose Zone Soil | RLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAAGK* |
| Ga0137371_103144873 | 3300012356 | Vadose Zone Soil | SARFGRTESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMASGK* |
| Ga0137384_104374711 | 3300012357 | Vadose Zone Soil | SVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQLAATK* |
| Ga0137384_106314961 | 3300012357 | Vadose Zone Soil | NAKRLVYLKLMEKYQNTDPFKFIIYSAKIGEQTPQMTTGK* |
| Ga0137385_102579191 | 3300012359 | Vadose Zone Soil | NAKRLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMAATK* |
| Ga0137360_104079632 | 3300012361 | Vadose Zone Soil | VYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAAGK* |
| Ga0137361_102987491 | 3300012362 | Vadose Zone Soil | RSASVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQLAATK* |
| Ga0137361_116132071 | 3300012362 | Vadose Zone Soil | AERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMTASK* |
| Ga0137361_118985721 | 3300012362 | Vadose Zone Soil | ARFGRTASIAKAERLVSLILMEKYQNTDPFKYILYSAKIGEQTPAMPASK* |
| Ga0137390_120060931 | 3300012363 | Vadose Zone Soil | VANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMATTK* |
| Ga0137373_107890573 | 3300012532 | Vadose Zone Soil | ESSGNRFEGSATVAKAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMVVRTR* |
| Ga0137358_105064781 | 3300012582 | Vadose Zone Soil | LLESSSARFGHTESIGKAERLVYLKLREKYQNTDPFKYILYSAKIGERTPAMATGK* |
| Ga0137358_106929281 | 3300012582 | Vadose Zone Soil | NAKRLVYLKLMEKHQNTDPFKFIIYSGKISEQTPQMASGQ* |
| Ga0137358_109711432 | 3300012582 | Vadose Zone Soil | ESSGDRFERSASVANAKRLVYLKLVEKHQNTDPFKFIIYSGKIGEQTPQMAAGK* |
| Ga0137398_108317362 | 3300012683 | Vadose Zone Soil | LGTTETIAKAEQLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMTTSK* |
| Ga0137394_104967373 | 3300012922 | Vadose Zone Soil | FGRTESIAKAERFVYLKLMEKYQNTDPFKYILYSAKIGEQTPDMAASK* |
| Ga0137394_105239522 | 3300012922 | Vadose Zone Soil | LESPGDRFEHSSSVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMTTTR* |
| Ga0137359_107134792 | 3300012923 | Vadose Zone Soil | SAARFGRTESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPPIVAIK* |
| Ga0137413_100837071 | 3300012924 | Vadose Zone Soil | KRLVYLKLMEKNQNTDPFKFIIYSGKISEQTAQMASGK* |
| Ga0137419_107984901 | 3300012925 | Vadose Zone Soil | TESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEHTPAMATGK* |
| Ga0137416_107044551 | 3300012927 | Vadose Zone Soil | SIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEHTPAMATGK* |
| Ga0137416_116550231 | 3300012927 | Vadose Zone Soil | TSVANARRLVYLKLMEENQNTDPFKFIIYSGKISEQTPQMASGK* |
| Ga0137404_104517712 | 3300012929 | Vadose Zone Soil | SIAKAKRLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAAGK* |
| Ga0164302_108043282 | 3300012961 | Soil | AKRLVYLKLMEKHQNTDPFKFIIYSSRISEQTPQIAGGK* |
| Ga0126369_109105861 | 3300012971 | Tropical Forest Soil | AKRLVYLKLIEKHQNTDPFKFIIYSAKIGEQTPQMAAPK* |
| Ga0126369_124870611 | 3300012971 | Tropical Forest Soil | LVYLKLMEKHQNTDPFKFIIYSAQIGEQTPQITAPK* |
| Ga0164305_108639772 | 3300012989 | Soil | SIAKTERFVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMTANK* |
| Ga0164305_115686971 | 3300012989 | Soil | MVDCPFRRTESIAKAEHLVYEKLMEKYQNTDPFKYILYSAKIGEQTPAMSSK* |
| Ga0182024_108340772 | 3300014501 | Permafrost | LSYVASTLMEEHQNTDPFKFIIYSGKIGEQTPQMTATK* |
| Ga0182024_109918571 | 3300014501 | Permafrost | RFEHSTSVANAKRLVYLKLMEKNQNTDPFKFIIYSGKIGEQTPQMASGK* |
| Ga0181522_109756511 | 3300014657 | Bog | VYLKLMEKNQNTDPFKYILYSAKIGEPTQQMGTGK* |
| Ga0137414_10937091 | 3300015051 | Vadose Zone Soil | ERSASVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMAATK* |
| Ga0137420_14586873 | 3300015054 | Vadose Zone Soil | VANARRLVYLKLMEENQNMDPFKFIIYSGKISEQTPQMASGKWMKS* |
| Ga0137403_108801841 | 3300015264 | Vadose Zone Soil | KRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTSQITSGR* |
| Ga0134089_105187971 | 3300015358 | Grasslands Soil | ESSGDRFERSASVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMATTK* |
| Ga0182033_112971801 | 3300016319 | Soil | VAKAERLVYLKLMEQYQNTDPFKFIIYSSRAHEQVPQIATRQE |
| Ga0182034_110254621 | 3300016371 | Soil | AERLVYLKLMEQYQNTDPFKFIIYSSRAHEQVPQMAARSE |
| Ga0182037_111419831 | 3300016404 | Soil | VANARRLVYLKLMEKHQNTDPFKFIIYSAKIGEQTPQIAGGK |
| Ga0182038_115830803 | 3300016445 | Soil | ERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAK |
| Ga0187819_104960302 | 3300017943 | Freshwater Sediment | LVYLKLMEKHLNTDPFKFIIYSGKIGEQTPQMTAPK |
| Ga0187816_103040701 | 3300017995 | Freshwater Sediment | KRLVYLKLMEKHQNTDPFKFIIYSAKIGEQTPQMTAPK |
| Ga0187765_106578231 | 3300018060 | Tropical Peatland | KIASAVFYLKLIEKHQNTDPFKFIIYSAKIGEQTPQMAAPK |
| Ga0187770_103894221 | 3300018090 | Tropical Peatland | SKIHFGQTESITKAERLVYLKLMEKHQNIDPFKFILYSAKIGEQTHAIESNDEDRIL |
| Ga0066655_110329661 | 3300018431 | Grasslands Soil | RFGRTESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAAGK |
| Ga0182025_10543621 | 3300019786 | Permafrost | SSSVANGFGSSSSVANVKRLVYLKLMEEHQNTDPFKFIIYSGKIGEQTPQMTAPR |
| Ga0193733_11889241 | 3300020022 | Soil | SLLESAGDRFERSSSVANVKRLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMTSTK |
| Ga0210407_108924742 | 3300020579 | Soil | SLLESSGDRFEHSASVANAKRLVYLKLMEKNQNTDPFKFIIYSGKIGERTPQMPTTK |
| Ga0210407_113636291 | 3300020579 | Soil | LESASARFGRTASIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAASN |
| Ga0210403_107911571 | 3300020580 | Soil | KRLVYLKLMEKNQNTDPFKFILYSGKIGEQTPQMAAAK |
| Ga0210399_100581911 | 3300020581 | Soil | ANAKRFVYLKLMEKNQNTDPFKFIIYSGKIGEQTPQMAATK |
| Ga0210399_104484651 | 3300020581 | Soil | RRLVYLKLMEKHQNTDPFKFIIYSGKINEQTPEMAATK |
| Ga0210399_113201512 | 3300020581 | Soil | VYLKLMEKYQNADPFKYILYSEKIGEQTPAMTGGK |
| Ga0210395_111520402 | 3300020582 | Soil | SSVANAKRLVYLKLMEKHQNTDPFKFIIYSGEIGEPTPQMTTPK |
| Ga0179596_104484931 | 3300021086 | Vadose Zone Soil | LVAKAERLVYLKLMEKTQNTDPFKFILYSAKIGEQVPQMGVLSPSVQ |
| Ga0210406_112728411 | 3300021168 | Soil | MAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTSSMAANK |
| Ga0210400_113136331 | 3300021170 | Soil | LVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMSTPK |
| Ga0210408_103439732 | 3300021178 | Soil | NAKRLVYLKLMENYQNTDPFKFIIYSGKIGEQTPQMASDK |
| Ga0210393_107415272 | 3300021401 | Soil | VAGAKRLVYLKLMEKHQNTDPFKFIIYSGEISEQPPQMASGT |
| Ga0210397_102126821 | 3300021403 | Soil | VANAKRLVYLKLMERNQNTDPFKFILYSGKIGEQTPQMAAAK |
| Ga0210397_113929571 | 3300021403 | Soil | RLVYLKLMEKNQNTDPFKFILYSAKIGEQTPQISGSR |
| Ga0210383_109205871 | 3300021407 | Soil | LVYLKLMEKYQNIDPFKYILYSAKIGEQTPAMAVNK |
| Ga0187846_103220761 | 3300021476 | Biofilm | ELSGDRFEGSASVAHAKRLVYLKLMEKHQNTDAFKFIIYSGKIGEQTPQMAATQ |
| Ga0210402_113251041 | 3300021478 | Soil | ESITRAKKLVYLKLVEKNQNTDPFKFIIYSGKIGEQTPPMIN |
| Ga0210409_110741052 | 3300021559 | Soil | ETAGKRFADRPSVGNARRLVYLKLMEKHENTDPFKFIIYSSRIGEQVPPMASGK |
| Ga0126371_102671541 | 3300021560 | Tropical Forest Soil | IYLKLMEKHQNTDPFKFIIYSAKIGEQTPQIASPE |
| Ga0212123_105803601 | 3300022557 | Iron-Sulfur Acid Spring | ANAKRLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMTATK |
| Ga0224551_10403812 | 3300023259 | Soil | SRFEHSTSVANAKRLVYLKLMEENQNTDPFKFIIYSGKIGEQTPQMASGR |
| Ga0247677_10635732 | 3300024245 | Soil | SSSAKFPHSNALVQARQLVYLKLMEKNQNTDPFKFIIYSGQIGAQTPPAAGEK |
| Ga0247667_10498382 | 3300024290 | Soil | LVYLKLMEKNQNTDPFKFIIYSGQIGAQTPPAAGEK |
| Ga0207685_107307602 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TESIAKAQQLVYLKLMEKYQNTDPFKYILYSAKIGEQTPALAVSK |
| Ga0207699_107495292 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVYLKLMEKNQNTDPFKFILYSAKIDEQTLQMSTGK |
| Ga0207693_102094971 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPQMTTPK |
| Ga0209471_10935941 | 3300026318 | Soil | LVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAASK |
| Ga0209647_10090731 | 3300026319 | Grasslands Soil | IAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEHTPAMATGK |
| Ga0209802_10629061 | 3300026328 | Soil | IAKAERFVYLKLMEKYQSTDPFKYILYSAKIGEHTPPMATGK |
| Ga0209802_13331852 | 3300026328 | Soil | VAKAKRLVYLKLMEKNQNTDPFKFIVYSAKSGEQTPQMSRGN |
| Ga0257176_10399441 | 3300026361 | Soil | FEQSTSVANAKRIVYLRLMEKYQNTDPFKFIIYSGKISEQTPQMASGK |
| Ga0257171_10382143 | 3300026377 | Soil | TESIAKAERFVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAVSK |
| Ga0257172_11029001 | 3300026482 | Soil | SASVTNAKRLVYLKLIEKSQNTDPFKVIIYSATIGEQLPQMAAPK |
| Ga0257159_10210321 | 3300026494 | Soil | LTADGKYELAASLLQSSGNRFAGSASVTNAKRLVYLKLIEKSQNTDPFKVIIYSATIGEQLPQMAAPK |
| Ga0257168_10735621 | 3300026514 | Soil | LLESSSARFGHTESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEHTPAMATGK |
| Ga0209378_12113263 | 3300026528 | Soil | SRFEHRTSVANAKRLVYLKLMEKHQNTDPFKYIIYSAKISEQTPQLASGQ |
| Ga0209648_10000012108 | 3300026551 | Grasslands Soil | SIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMATGK |
| Ga0209648_104879681 | 3300026551 | Grasslands Soil | DRFEGSSSVANAERLVYLKLMEKHQNTDPFKFIIYSGKIREQSPQMTATK |
| Ga0179587_106533011 | 3300026557 | Vadose Zone Soil | VYLKLMEKYQSTDPFKYILYSAKIGEHTPAMATGK |
| Ga0209731_10129151 | 3300027326 | Forest Soil | RLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMSATK |
| Ga0209529_10747981 | 3300027334 | Forest Soil | VYLKLMEENQNTDPFKFIIYSGKIGEQTPQMASGI |
| Ga0209179_11138432 | 3300027512 | Vadose Zone Soil | LVYLKLMEKYQNTDPFKYILYSAKIGEQTPPMVAIK |
| Ga0209523_11380151 | 3300027548 | Forest Soil | VYLKLMEKNQNTDPFKFILYSAKIDEQTLQMSTGK |
| Ga0209331_11380571 | 3300027603 | Forest Soil | EGSSSVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGERTPQMTATK |
| Ga0209221_10631042 | 3300027609 | Forest Soil | EHSTSVANAKRLVYLKLMEENQNTDPFKFIIYSGRIGEQTPQMVSGK |
| Ga0209528_10595092 | 3300027610 | Forest Soil | STSVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIGEQTPRMTAPK |
| Ga0209076_10107083 | 3300027643 | Vadose Zone Soil | AKRLVYLKLMEKHQNTDPFKFIIYSGKIGEHTPQMVAAK |
| Ga0209009_10322681 | 3300027667 | Forest Soil | VYLKLMEKYQNTDPFKFTLYSGKIGEQTPQMANGK |
| Ga0207862_12585911 | 3300027703 | Tropical Forest Soil | LLESTGGRFDGSASVANARRFVYRKLMEEYQNTDPFKFIRYSGRIGEQTPQMALPK |
| Ga0209180_100037605 | 3300027846 | Vadose Zone Soil | VYLKLMEKHQNTDPFKFIIYSGKISEQTPQMASGK |
| Ga0209180_100078581 | 3300027846 | Vadose Zone Soil | LVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMATGK |
| Ga0209180_100456641 | 3300027846 | Vadose Zone Soil | LLEWSGSRFEQSTSVANAKRLIYLKLMEKNQNTDPFKFIIYSGKIGEQTPLMTSGK |
| Ga0209701_104003092 | 3300027862 | Vadose Zone Soil | GHTESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGERTTAMATGK |
| Ga0209701_105924841 | 3300027862 | Vadose Zone Soil | GHTESIAKAERLVYLKLMEKYQNTDPFKYILYSAKIGEHTPAMATGK |
| Ga0209167_107290132 | 3300027867 | Surface Soil | RLVYLKLMEKNQNTDPFKFIIYSGQIGEQTPRLEGK |
| Ga0209283_100397691 | 3300027875 | Vadose Zone Soil | SVANAQRLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMTVSK |
| Ga0209624_103816141 | 3300027895 | Forest Soil | LKLMEKNQNTDPFKYILYSAKIGEQTQQMTTTPHP |
| Ga0209069_108772921 | 3300027915 | Watersheds | AERLVYLKLMEKYQNTDPFKFIIYSGKIGEQTPQMPATK |
| Ga0209069_109776212 | 3300027915 | Watersheds | LKLMEKYQNTDPFKFILYSAKIGEQTPQMAQQMAAGK |
| Ga0209526_101596284 | 3300028047 | Forest Soil | RLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMVASK |
| Ga0209526_102816682 | 3300028047 | Forest Soil | DHSPAVANAKRLVYLKLMEKNQNTDPFKFILYSGKIAEQTPQMAATK |
| Ga0137415_103240401 | 3300028536 | Vadose Zone Soil | SAARFGRTESIAKAERLVYLKLMEKYQNTQPFKYILYSAKIGEQTPAMAASK |
| Ga0137415_112358181 | 3300028536 | Vadose Zone Soil | TSVANAKRLIYLKLMEKNQNTDPFKFIIYSGKIGEQTPQMASGK |
| Ga0307311_101143502 | 3300028716 | Soil | VSVINAKRLVYLKLMEKHQNTDPFKFIIYSSKIGEQAP |
| Ga0307317_102732452 | 3300028720 | Soil | VSVINAKRLVYLKLMEKHQNTDPFKFIIYSSKIGEQAPQMVAPK |
| Ga0307286_103330961 | 3300028876 | Soil | LLESSGDRFARSVSVINAKRLVYLKLMEKHQNTDPFKFIIYSAKIGEQTSQMVAPK |
| Ga0308309_115446421 | 3300028906 | Soil | SRSIPGTSVANAKRLVYLKLMEKHQNTDPFKFIIYSGKIREQTPQMNVTR |
| Ga0311352_104221931 | 3300029944 | Palsa | SGYKFEHSTSVANARRLVYLKLMEENQNTDPFKFIIYSGKINEQIPQMASSK |
| Ga0311371_117873193 | 3300029951 | Palsa | AERLVYLKLMEKYQNTDPFKYILYSAKIGEEMPAMANG |
| Ga0311370_123025301 | 3300030503 | Palsa | VYLKLMEKNQNTDPFKFIIYSAKIGEQTPQMAIGK |
| Ga0311372_120610381 | 3300030520 | Palsa | VVKVKRLVYLKLMEKNQNTDPFKFIIYSAKIGEQTPQMAIGK |
| Ga0138301_12278342 | 3300031022 | Soil | RLIYLKLMEKNQNTDPFKFIIYSAKIGEQTPPMAGGK |
| Ga0302325_128005762 | 3300031234 | Palsa | VKVKRLVYLKLMEKNQNTDPFKFIIYSAKIGEQTPQMAIGK |
| Ga0170818_1061968272 | 3300031474 | Forest Soil | AKRMVYLKLMEKNQNTDPFKYIVYSAKIGEQTPAMSTGK |
| Ga0318541_101624811 | 3300031545 | Soil | ASLLEWSGDRFERSASVTNAKRLVYLKLMEKHQNTDAFKFIIYSGKIGEETPQMAASR |
| Ga0318541_103999632 | 3300031545 | Soil | GRTESIAKMERPAYPKLMEKYRNTDPFKYILYSAKIGEQTPAMAK |
| Ga0318541_107555342 | 3300031545 | Soil | KRFVYLKLMEKHQNTDPFKFIIYSAKAGEQTPQIAAPK |
| Ga0318561_101752462 | 3300031679 | Soil | GASVNNAKRLVYLKLMEKYQNTDPFKFIIYSTKIGEQTPQMPAPK |
| Ga0318574_101675861 | 3300031680 | Soil | RFAPSAPVANAKRFVYLKLMEKHQNTDPFKFIIYSAKAGEQTPQIAAPK |
| Ga0318560_108238692 | 3300031682 | Soil | ATRLVYLKLMEKHQNTDAFKFIIYSGKIGEQTPQMAATKSRV |
| Ga0310686_1016674331 | 3300031708 | Soil | STSVANAKRLVYLKLMEKNQNTDPFKFIIYSGKISEQTPQMAGGK |
| Ga0310686_1090820311 | 3300031708 | Soil | SVGDARRLVYLKLMEKYENTDPFKFIIYSSSIREQVPPMASGK |
| Ga0307476_110377482 | 3300031715 | Hardwood Forest Soil | SVKRLVYLKLMEKYQNTDPFKFIIYSSRIKEQTPQIAGSK |
| Ga0307474_100952361 | 3300031718 | Hardwood Forest Soil | MPKQSGSRSEHSTPVTNAKRLVYLKLMEENQNTDPFKFIIYSGKVSEQTPQMASGK |
| Ga0307474_101969541 | 3300031718 | Hardwood Forest Soil | LVYLKLMEKYQNTDPFKFIIYSGKISEQTPQMASGK |
| Ga0307474_102320981 | 3300031718 | Hardwood Forest Soil | RRLVYLKLMEENQNTDPFKFIIYSGKISEQTPQMASGK |
| Ga0307469_102294152 | 3300031720 | Hardwood Forest Soil | AKRLVYLKLIEKNQNTDPFKFILYSAKIDEPTLQMSTGK |
| Ga0318501_104540052 | 3300031736 | Soil | AKRLIYLKLMEKNQNTDPFKFMLYSAKIGEQTPRMSGGK |
| Ga0306918_102171471 | 3300031744 | Soil | VANATRLVYLKLMEKHQNTDAFKFIIYSGKIGEQTPQMAATKSRV |
| Ga0307477_100283341 | 3300031753 | Hardwood Forest Soil | LESSANRFDGSAPVAKAKRLVYLKLMEKNQNTDPFKFIIYSAKIGEQTSPIAPAK |
| Ga0307477_103070243 | 3300031753 | Hardwood Forest Soil | VANAKRLVYLKLMEKNQNTDPFKLILYSGKIGEQTPQMAAAK |
| Ga0318546_105958601 | 3300031771 | Soil | VRARGASVNNAKRLVYLKLMEKYQNTDPFKFIIYSTKIGEQTPQMPAPK |
| Ga0318547_109562541 | 3300031781 | Soil | VYLKLMEQYQNTDPFKFIIYSSRAREQVPQMAARQQ |
| Ga0318503_100302111 | 3300031794 | Soil | SVASAKRLVYLKLMEKYQNTDPFKFIIYSGKIGEQTPQLALPK |
| Ga0318497_105121791 | 3300031805 | Soil | IVYLKLMEQYQNTDPFKFIIYSSRAREQVPQMAARQQ |
| Ga0306925_108481701 | 3300031890 | Soil | TGSIARAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAK |
| Ga0306921_116794071 | 3300031912 | Soil | PSAPVANAKRFVYLKLMEKHQNTDPFKFIIYSAKAGEQTPQIAAPK |
| Ga0310913_102252851 | 3300031945 | Soil | LVYLKLMEKHQNTDAFKFIIYSGKIGEETPQMAASR |
| Ga0310913_103302871 | 3300031945 | Soil | ANATRLVYLKLMEKHQNTDAFKFIIYSGKIGEQTPQMAATKSRV |
| Ga0310913_108580611 | 3300031945 | Soil | ANAKRLVYLKLMEKHQNTDPFKFIIYSSRIGEQTPQIAAGK |
| Ga0310910_102217361 | 3300031946 | Soil | ARAERLVYLKLMEKYQNTDPFKYILYSAKIGEQTPAMAK |
| Ga0310910_110682961 | 3300031946 | Soil | AKRLVYLKLMEKHQNTDPFKFIIYSGKINEQTPQMAATK |
| Ga0310910_113048101 | 3300031946 | Soil | GDRFERSASVTNAKRLVYLKLMEKHQNTDAFKFIIYSGKIGEQTPQMAATKSRV |
| Ga0306926_129941991 | 3300031954 | Soil | MNSPASLVESSGDRFAHSASVTNAKRLIYLKLMEKHQNTDPFKFIIYSAKIGEQTPQM |
| Ga0306926_130004171 | 3300031954 | Soil | MFEHSSSVARARRLIYLKLMEKHQNTDPFKFVICSLQAAEQTQQMAQAK |
| Ga0307479_112224171 | 3300031962 | Hardwood Forest Soil | HSAPVANAKRLVYLKLMEKHQNTDPFKFIIYSAKIGEQTPQMAAGK |
| Ga0306922_106612013 | 3300032001 | Soil | VRKLERLVYLKLMEQYQNTDPFKFLLYSARAGEQTPQMAR |
| Ga0306922_120192551 | 3300032001 | Soil | ARFGRTESIAKMERPAYLKLMEKYRNTDPFKYILYSAKIGEQTPAIAK |
| Ga0318563_106216711 | 3300032009 | Soil | IYLKLMEKNQNTDPFKFMLYSAKIGEQTPRMSGGK |
| Ga0318549_102417122 | 3300032041 | Soil | CSLVAGIVRARGASVNNAKRLVYLKLMEKYQNTDPFKFIIYSTKIGEQTPQMPAPK |
| Ga0318545_103797652 | 3300032042 | Soil | SLVAGIVRARGASVNNAKRLVYLKLMEKYQNTDPFKFIIYSTKIGEQTPQMPAPK |
| Ga0306920_1044724742 | 3300032261 | Soil | RLVYLKLMEKSQNTDPFKFIIYADRAGERLPQMSLPRQASQQR |
| Ga0335080_121937941 | 3300032828 | Soil | AVGDARRLVYLKLMEKYENTDPFKFIIYSSRIGEQVPAMAGGK |
| Ga0326728_111443361 | 3300033402 | Peat Soil | MEKHQNTDPFKFIIYSAKIGEQTPQMTAPKGGVARRP |
| ⦗Top⦘ |