


| Basic Information | |
|---|---|
| Family ID | F009145 |
| Family Type | Metagenome |
| Number of Sequences | 322 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MGTAAKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 322 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.22 % |
| % of genes near scaffold ends (potentially truncated) | 12.42 % |
| % of genes from short scaffolds (< 2000 bps) | 66.77 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.460 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (14.907 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.280 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.907 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.38% β-sheet: 0.00% Coil/Unstructured: 65.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 322 Family Scaffolds |
|---|---|---|
| PF01329 | Pterin_4a | 4.97 |
| PF04023 | FeoA | 4.04 |
| PF01471 | PG_binding_1 | 3.11 |
| PF01223 | Endonuclease_NS | 1.86 |
| PF01764 | Lipase_3 | 1.86 |
| PF01832 | Glucosaminidase | 1.55 |
| PF00149 | Metallophos | 1.24 |
| PF13715 | CarbopepD_reg_2 | 1.24 |
| PF10263 | SprT-like | 1.24 |
| PF04024 | PspC | 0.93 |
| PF11655 | DUF2589 | 0.93 |
| PF00085 | Thioredoxin | 0.93 |
| PF07715 | Plug | 0.62 |
| PF13517 | FG-GAP_3 | 0.62 |
| PF02675 | AdoMet_dc | 0.62 |
| PF11697 | DUF3293 | 0.62 |
| PF01370 | Epimerase | 0.62 |
| PF12385 | Peptidase_C70 | 0.62 |
| PF13645 | YkuD_2 | 0.31 |
| PF03976 | PPK2 | 0.31 |
| PF10908 | DUF2778 | 0.31 |
| PF01541 | GIY-YIG | 0.31 |
| PF00534 | Glycos_transf_1 | 0.31 |
| PF07691 | PA14 | 0.31 |
| PF00059 | Lectin_C | 0.31 |
| PF13578 | Methyltransf_24 | 0.31 |
| PF13459 | Fer4_15 | 0.31 |
| PF05050 | Methyltransf_21 | 0.31 |
| PF13385 | Laminin_G_3 | 0.31 |
| PF00160 | Pro_isomerase | 0.31 |
| PF01521 | Fe-S_biosyn | 0.31 |
| PF00166 | Cpn10 | 0.31 |
| PF16861 | Carbam_trans_C | 0.31 |
| PF02678 | Pirin | 0.31 |
| PF12850 | Metallophos_2 | 0.31 |
| PF00551 | Formyl_trans_N | 0.31 |
| PF01592 | NifU_N | 0.31 |
| PF00670 | AdoHcyase_NAD | 0.31 |
| COG ID | Name | Functional Category | % Frequency in 322 Family Scaffolds |
|---|---|---|---|
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 4.97 |
| COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 4.04 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 1.86 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.62 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.31 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.31 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.31 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.31 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.31 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.31 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.31 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.46 % |
| All Organisms | root | All Organisms | 33.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10047604 | All Organisms → Viruses → Predicted Viral | 2478 | Open in IMG/M |
| 3300000882|FwDRAFT_10132323 | Not Available | 948 | Open in IMG/M |
| 3300000929|NpDRAFT_10385413 | Not Available | 765 | Open in IMG/M |
| 3300001844|RCM35_1069821 | Not Available | 615 | Open in IMG/M |
| 3300001847|RCM41_1034989 | Not Available | 1788 | Open in IMG/M |
| 3300001848|RCM47_1147220 | Not Available | 718 | Open in IMG/M |
| 3300001848|RCM47_1162353 | Not Available | 507 | Open in IMG/M |
| 3300001849|RCM26_1287165 | Not Available | 629 | Open in IMG/M |
| 3300002098|JGI24219J26650_1012222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1364 | Open in IMG/M |
| 3300002408|B570J29032_108840002 | Not Available | 521 | Open in IMG/M |
| 3300002408|B570J29032_109060070 | Not Available | 581 | Open in IMG/M |
| 3300002408|B570J29032_109861831 | Not Available | 1737 | Open in IMG/M |
| 3300002408|B570J29032_109958730 | Not Available | 14672 | Open in IMG/M |
| 3300002835|B570J40625_100284307 | Not Available | 1691 | Open in IMG/M |
| 3300003798|Ga0007842_1001106 | Not Available | 2404 | Open in IMG/M |
| 3300004240|Ga0007787_10628032 | Not Available | 538 | Open in IMG/M |
| 3300005517|Ga0070374_10148453 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1217 | Open in IMG/M |
| 3300005527|Ga0068876_10027484 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 3555 | Open in IMG/M |
| 3300005580|Ga0049083_10105002 | Not Available | 978 | Open in IMG/M |
| 3300005582|Ga0049080_10022576 | Not Available | 2197 | Open in IMG/M |
| 3300005662|Ga0078894_10007017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8754 | Open in IMG/M |
| 3300005662|Ga0078894_10016957 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 5830 | Open in IMG/M |
| 3300005662|Ga0078894_10022698 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028 | 5097 | Open in IMG/M |
| 3300005662|Ga0078894_10026288 | Not Available | 4757 | Open in IMG/M |
| 3300005662|Ga0078894_10106500 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2481 | Open in IMG/M |
| 3300005662|Ga0078894_10708874 | Not Available | 887 | Open in IMG/M |
| 3300005662|Ga0078894_10823590 | Not Available | 810 | Open in IMG/M |
| 3300005662|Ga0078894_11638956 | Not Available | 530 | Open in IMG/M |
| 3300005662|Ga0078894_11745146 | Not Available | 509 | Open in IMG/M |
| 3300005805|Ga0079957_1004901 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 11018 | Open in IMG/M |
| 3300005805|Ga0079957_1025910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3972 | Open in IMG/M |
| 3300006072|Ga0007881_1163167 | Not Available | 541 | Open in IMG/M |
| 3300006108|Ga0007862_1014771 | Not Available | 1779 | Open in IMG/M |
| 3300006484|Ga0070744_10003104 | All Organisms → cellular organisms → Bacteria | 4997 | Open in IMG/M |
| 3300006484|Ga0070744_10097080 | Not Available | 852 | Open in IMG/M |
| 3300006484|Ga0070744_10153941 | Not Available | 659 | Open in IMG/M |
| 3300006802|Ga0070749_10697240 | Not Available | 543 | Open in IMG/M |
| 3300007547|Ga0102875_1229730 | Not Available | 570 | Open in IMG/M |
| 3300007548|Ga0102877_1215945 | Not Available | 540 | Open in IMG/M |
| 3300007549|Ga0102879_1137530 | Not Available | 750 | Open in IMG/M |
| 3300007555|Ga0102817_1015316 | Not Available | 1716 | Open in IMG/M |
| 3300007560|Ga0102913_1129761 | Not Available | 815 | Open in IMG/M |
| 3300007562|Ga0102915_1298833 | Not Available | 520 | Open in IMG/M |
| 3300007630|Ga0102903_1092669 | Not Available | 837 | Open in IMG/M |
| 3300007639|Ga0102865_1122516 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 778 | Open in IMG/M |
| 3300007706|Ga0102899_1088799 | Not Available | 749 | Open in IMG/M |
| 3300007974|Ga0105747_1024401 | Not Available | 1676 | Open in IMG/M |
| 3300007992|Ga0105748_10554082 | Not Available | 505 | Open in IMG/M |
| 3300008021|Ga0102922_1260087 | Not Available | 544 | Open in IMG/M |
| 3300008107|Ga0114340_1033735 | Not Available | 2329 | Open in IMG/M |
| 3300008107|Ga0114340_1037117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2198 | Open in IMG/M |
| 3300008107|Ga0114340_1072449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3898 | Open in IMG/M |
| 3300008107|Ga0114340_1085672 | Not Available | 1291 | Open in IMG/M |
| 3300008107|Ga0114340_1089845 | Not Available | 1249 | Open in IMG/M |
| 3300008107|Ga0114340_1097654 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1180 | Open in IMG/M |
| 3300008107|Ga0114340_1124474 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 992 | Open in IMG/M |
| 3300008107|Ga0114340_1164796 | Not Available | 797 | Open in IMG/M |
| 3300008108|Ga0114341_10478237 | Not Available | 570 | Open in IMG/M |
| 3300008110|Ga0114343_1070210 | Not Available | 2085 | Open in IMG/M |
| 3300008110|Ga0114343_1075691 | Not Available | 1222 | Open in IMG/M |
| 3300008110|Ga0114343_1104934 | Not Available | 972 | Open in IMG/M |
| 3300008111|Ga0114344_1025035 | All Organisms → Viruses → Predicted Viral | 2401 | Open in IMG/M |
| 3300008113|Ga0114346_1002795 | Not Available | 12469 | Open in IMG/M |
| 3300008113|Ga0114346_1024181 | Not Available | 3236 | Open in IMG/M |
| 3300008113|Ga0114346_1145909 | Not Available | 1017 | Open in IMG/M |
| 3300008113|Ga0114346_1184936 | Not Available | 850 | Open in IMG/M |
| 3300008116|Ga0114350_1027426 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2950 | Open in IMG/M |
| 3300008116|Ga0114350_1054326 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1437 | Open in IMG/M |
| 3300008116|Ga0114350_1075609 | Not Available | 1134 | Open in IMG/M |
| 3300008117|Ga0114351_1259635 | Not Available | 855 | Open in IMG/M |
| 3300008261|Ga0114336_1127782 | Not Available | 1156 | Open in IMG/M |
| 3300008262|Ga0114337_1127502 | Not Available | 1139 | Open in IMG/M |
| 3300008266|Ga0114363_1037232 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1 | 2010 | Open in IMG/M |
| 3300008267|Ga0114364_1000304 | Not Available | 29685 | Open in IMG/M |
| 3300008267|Ga0114364_1000606 | Not Available | 37362 | Open in IMG/M |
| 3300008267|Ga0114364_1114969 | Not Available | 811 | Open in IMG/M |
| 3300008448|Ga0114876_1083587 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300008448|Ga0114876_1089119 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1259 | Open in IMG/M |
| 3300008448|Ga0114876_1102878 | Not Available | 1133 | Open in IMG/M |
| 3300008448|Ga0114876_1199106 | Not Available | 678 | Open in IMG/M |
| 3300008996|Ga0102831_1009949 | All Organisms → Viruses → Predicted Viral | 3362 | Open in IMG/M |
| 3300008996|Ga0102831_1160437 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 745 | Open in IMG/M |
| 3300008999|Ga0102816_1081145 | Not Available | 982 | Open in IMG/M |
| 3300009026|Ga0102829_1021364 | Not Available | 1851 | Open in IMG/M |
| 3300009026|Ga0102829_1232855 | Not Available | 603 | Open in IMG/M |
| 3300009026|Ga0102829_1300403 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1 | 534 | Open in IMG/M |
| 3300009050|Ga0102909_1141874 | Not Available | 578 | Open in IMG/M |
| 3300009051|Ga0102864_1121893 | Not Available | 712 | Open in IMG/M |
| 3300009059|Ga0102830_1033685 | Not Available | 1581 | Open in IMG/M |
| 3300009068|Ga0114973_10051290 | Not Available | 2435 | Open in IMG/M |
| 3300009068|Ga0114973_10108751 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300009068|Ga0114973_10419644 | Not Available | 699 | Open in IMG/M |
| 3300009068|Ga0114973_10514064 | Not Available | 619 | Open in IMG/M |
| 3300009086|Ga0102812_10511283 | Not Available | 656 | Open in IMG/M |
| 3300009151|Ga0114962_10013048 | Not Available | 6057 | Open in IMG/M |
| 3300009151|Ga0114962_10063377 | All Organisms → Viruses → Predicted Viral | 2390 | Open in IMG/M |
| 3300009151|Ga0114962_10067681 | All Organisms → Viruses → Predicted Viral | 2296 | Open in IMG/M |
| 3300009151|Ga0114962_10082876 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
| 3300009151|Ga0114962_10176989 | Not Available | 1262 | Open in IMG/M |
| 3300009151|Ga0114962_10299474 | Not Available | 898 | Open in IMG/M |
| 3300009151|Ga0114962_10682903 | Not Available | 526 | Open in IMG/M |
| 3300009152|Ga0114980_10137937 | Not Available | 1449 | Open in IMG/M |
| 3300009158|Ga0114977_10002282 | All Organisms → Viruses | 12357 | Open in IMG/M |
| 3300009158|Ga0114977_10005037 | All Organisms → cellular organisms → Bacteria | 8398 | Open in IMG/M |
| 3300009158|Ga0114977_10037816 | All Organisms → Viruses → Predicted Viral | 3013 | Open in IMG/M |
| 3300009158|Ga0114977_10649214 | Not Available | 565 | Open in IMG/M |
| 3300009159|Ga0114978_10002895 | Not Available | 14102 | Open in IMG/M |
| 3300009159|Ga0114978_10010937 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 6978 | Open in IMG/M |
| 3300009159|Ga0114978_10011573 | All Organisms → cellular organisms → Bacteria | 6772 | Open in IMG/M |
| 3300009159|Ga0114978_10253138 | Not Available | 1093 | Open in IMG/M |
| 3300009159|Ga0114978_10357958 | Not Available | 882 | Open in IMG/M |
| 3300009160|Ga0114981_10407528 | Not Available | 732 | Open in IMG/M |
| 3300009161|Ga0114966_10683713 | Not Available | 563 | Open in IMG/M |
| 3300009161|Ga0114966_10691620 | Not Available | 559 | Open in IMG/M |
| 3300009164|Ga0114975_10016668 | All Organisms → cellular organisms → Bacteria | 4488 | Open in IMG/M |
| 3300009165|Ga0105102_10242508 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 915 | Open in IMG/M |
| 3300009169|Ga0105097_10088246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1690 | Open in IMG/M |
| 3300009170|Ga0105096_10561462 | Not Available | 597 | Open in IMG/M |
| 3300009180|Ga0114979_10329177 | Not Available | 903 | Open in IMG/M |
| 3300009181|Ga0114969_10322099 | Not Available | 906 | Open in IMG/M |
| 3300009182|Ga0114959_10609941 | Not Available | 521 | Open in IMG/M |
| 3300009183|Ga0114974_10000105 | Not Available | 68321 | Open in IMG/M |
| 3300009187|Ga0114972_10833049 | Not Available | 504 | Open in IMG/M |
| 3300009419|Ga0114982_1007385 | Not Available | 4040 | Open in IMG/M |
| 3300009419|Ga0114982_1016289 | All Organisms → Viruses → Predicted Viral | 2526 | Open in IMG/M |
| 3300009419|Ga0114982_1076742 | Not Available | 1039 | Open in IMG/M |
| 3300009419|Ga0114982_1096687 | Not Available | 913 | Open in IMG/M |
| 3300010158|Ga0114960_10057402 | All Organisms → Viruses → Predicted Viral | 2282 | Open in IMG/M |
| 3300010354|Ga0129333_10025318 | All Organisms → cellular organisms → Bacteria → FCB group | 5623 | Open in IMG/M |
| 3300010354|Ga0129333_10100632 | Not Available | 2671 | Open in IMG/M |
| 3300010354|Ga0129333_10210174 | All Organisms → Viruses → Predicted Viral | 1767 | Open in IMG/M |
| 3300010885|Ga0133913_10003015 | Not Available | 41668 | Open in IMG/M |
| 3300010885|Ga0133913_10215020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5119 | Open in IMG/M |
| 3300010885|Ga0133913_10771389 | Not Available | 2509 | Open in IMG/M |
| 3300010885|Ga0133913_10799053 | Not Available | 2459 | Open in IMG/M |
| 3300010885|Ga0133913_10821561 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2420 | Open in IMG/M |
| 3300010885|Ga0133913_11428752 | Not Available | 1758 | Open in IMG/M |
| 3300010885|Ga0133913_11770446 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1548 | Open in IMG/M |
| 3300012017|Ga0153801_1000862 | All Organisms → cellular organisms → Bacteria | 6736 | Open in IMG/M |
| 3300012352|Ga0157138_1000328 | All Organisms → cellular organisms → Bacteria | 10663 | Open in IMG/M |
| 3300012352|Ga0157138_1003875 | Not Available | 2551 | Open in IMG/M |
| 3300012665|Ga0157210_1020289 | Not Available | 1078 | Open in IMG/M |
| 3300013004|Ga0164293_10015906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6316 | Open in IMG/M |
| 3300013004|Ga0164293_10027707 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 4705 | Open in IMG/M |
| 3300013004|Ga0164293_10036804 | Not Available | 4033 | Open in IMG/M |
| 3300013004|Ga0164293_10095663 | Not Available | 2291 | Open in IMG/M |
| 3300013004|Ga0164293_10291363 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1135 | Open in IMG/M |
| 3300013004|Ga0164293_10344746 | Not Available | 1018 | Open in IMG/M |
| 3300013005|Ga0164292_10063628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2862 | Open in IMG/M |
| 3300013005|Ga0164292_10095318 | Not Available | 2251 | Open in IMG/M |
| 3300013005|Ga0164292_10175098 | Not Available | 1547 | Open in IMG/M |
| 3300013005|Ga0164292_11012974 | Not Available | 518 | Open in IMG/M |
| 3300013093|Ga0164296_1100766 | Not Available | 1214 | Open in IMG/M |
| 3300013285|Ga0136642_1086087 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1 | 821 | Open in IMG/M |
| 3300013286|Ga0136641_1004552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5181 | Open in IMG/M |
| 3300013295|Ga0170791_12131145 | Not Available | 698 | Open in IMG/M |
| 3300013372|Ga0177922_10276972 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1598 | Open in IMG/M |
| 3300017766|Ga0181343_1131959 | Not Available | 699 | Open in IMG/M |
| 3300019784|Ga0181359_1092432 | Not Available | 1120 | Open in IMG/M |
| 3300019784|Ga0181359_1121049 | Not Available | 935 | Open in IMG/M |
| 3300019784|Ga0181359_1215684 | Not Available | 607 | Open in IMG/M |
| 3300020141|Ga0211732_1241490 | Not Available | 19009 | Open in IMG/M |
| 3300020141|Ga0211732_1336038 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
| 3300020141|Ga0211732_1375949 | Not Available | 713 | Open in IMG/M |
| 3300020141|Ga0211732_1380751 | Not Available | 760 | Open in IMG/M |
| 3300020141|Ga0211732_1484541 | All Organisms → Viruses | 21744 | Open in IMG/M |
| 3300020151|Ga0211736_10310099 | Not Available | 1157 | Open in IMG/M |
| 3300020151|Ga0211736_10429320 | Not Available | 3177 | Open in IMG/M |
| 3300020151|Ga0211736_10579233 | Not Available | 573 | Open in IMG/M |
| 3300020159|Ga0211734_10080783 | Not Available | 580 | Open in IMG/M |
| 3300020159|Ga0211734_10089355 | Not Available | 1016 | Open in IMG/M |
| 3300020159|Ga0211734_10123718 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1332 | Open in IMG/M |
| 3300020159|Ga0211734_10235698 | Not Available | 1537 | Open in IMG/M |
| 3300020159|Ga0211734_10235881 | Not Available | 612 | Open in IMG/M |
| 3300020159|Ga0211734_10531818 | Not Available | 586 | Open in IMG/M |
| 3300020159|Ga0211734_10550486 | Not Available | 522 | Open in IMG/M |
| 3300020159|Ga0211734_10759710 | All Organisms → cellular organisms → Bacteria | 5650 | Open in IMG/M |
| 3300020159|Ga0211734_11249078 | Not Available | 566 | Open in IMG/M |
| 3300020160|Ga0211733_10837831 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2933 | Open in IMG/M |
| 3300020160|Ga0211733_10997477 | Not Available | 1144 | Open in IMG/M |
| 3300020160|Ga0211733_11176294 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1915 | Open in IMG/M |
| 3300020161|Ga0211726_10788454 | Not Available | 1058 | Open in IMG/M |
| 3300020161|Ga0211726_10801440 | Not Available | 2060 | Open in IMG/M |
| 3300020162|Ga0211735_10926338 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1920 | Open in IMG/M |
| 3300020162|Ga0211735_11141171 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1067 | Open in IMG/M |
| 3300020172|Ga0211729_10568096 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2715 | Open in IMG/M |
| 3300020172|Ga0211729_10600196 | Not Available | 500 | Open in IMG/M |
| 3300020172|Ga0211729_10814500 | Not Available | 642 | Open in IMG/M |
| 3300020205|Ga0211731_10516747 | Not Available | 976 | Open in IMG/M |
| 3300020205|Ga0211731_10854952 | All Organisms → Viruses → Predicted Viral | 3311 | Open in IMG/M |
| 3300020205|Ga0211731_10855134 | Not Available | 927 | Open in IMG/M |
| 3300020205|Ga0211731_11328888 | Not Available | 523 | Open in IMG/M |
| 3300020205|Ga0211731_11711418 | Not Available | 1134 | Open in IMG/M |
| 3300020490|Ga0208052_121147 | Not Available | 540 | Open in IMG/M |
| 3300020506|Ga0208091_1011560 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1091 | Open in IMG/M |
| 3300020527|Ga0208232_1013872 | Not Available | 1211 | Open in IMG/M |
| 3300020527|Ga0208232_1023192 | Not Available | 876 | Open in IMG/M |
| 3300020539|Ga0207941_1017652 | Not Available | 1084 | Open in IMG/M |
| 3300020548|Ga0208856_1028240 | Not Available | 784 | Open in IMG/M |
| 3300020558|Ga0208362_1043211 | Not Available | 735 | Open in IMG/M |
| 3300020564|Ga0208719_1019357 | Not Available | 1408 | Open in IMG/M |
| 3300020723|Ga0214249_1035028 | Not Available | 751 | Open in IMG/M |
| 3300021141|Ga0214163_1013546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2625 | Open in IMG/M |
| 3300021141|Ga0214163_1035007 | Not Available | 1399 | Open in IMG/M |
| 3300021354|Ga0194047_10045859 | Not Available | 2006 | Open in IMG/M |
| 3300021519|Ga0194048_10099595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1120 | Open in IMG/M |
| 3300021519|Ga0194048_10121867 | Not Available | 993 | Open in IMG/M |
| 3300021602|Ga0194060_10050085 | Not Available | 2437 | Open in IMG/M |
| 3300021956|Ga0213922_1125782 | Not Available | 502 | Open in IMG/M |
| 3300021961|Ga0222714_10030626 | All Organisms → Viruses → Predicted Viral | 4010 | Open in IMG/M |
| 3300021961|Ga0222714_10034698 | Not Available | 3696 | Open in IMG/M |
| 3300021961|Ga0222714_10087611 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2009 | Open in IMG/M |
| 3300021961|Ga0222714_10384735 | Not Available | 745 | Open in IMG/M |
| 3300021962|Ga0222713_10141657 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1670 | Open in IMG/M |
| 3300021962|Ga0222713_10168232 | Not Available | 1495 | Open in IMG/M |
| 3300021962|Ga0222713_10216124 | Not Available | 1271 | Open in IMG/M |
| 3300021962|Ga0222713_10337514 | Not Available | 947 | Open in IMG/M |
| 3300021962|Ga0222713_10426772 | Not Available | 809 | Open in IMG/M |
| 3300021962|Ga0222713_10797270 | Not Available | 528 | Open in IMG/M |
| 3300021963|Ga0222712_10044064 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 3388 | Open in IMG/M |
| 3300021963|Ga0222712_10054624 | Not Available | 2961 | Open in IMG/M |
| 3300021963|Ga0222712_10184662 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300021963|Ga0222712_10726595 | Not Available | 556 | Open in IMG/M |
| 3300022179|Ga0181353_1042472 | Not Available | 1200 | Open in IMG/M |
| 3300022179|Ga0181353_1164298 | Not Available | 504 | Open in IMG/M |
| 3300022190|Ga0181354_1162031 | Not Available | 692 | Open in IMG/M |
| 3300022592|Ga0236342_1014144 | Not Available | 2393 | Open in IMG/M |
| 3300023174|Ga0214921_10011123 | Not Available | 10991 | Open in IMG/M |
| 3300023174|Ga0214921_10336850 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1 | 813 | Open in IMG/M |
| 3300023184|Ga0214919_10000672 | All Organisms → cellular organisms → Bacteria | 58104 | Open in IMG/M |
| 3300023184|Ga0214919_10126942 | Not Available | 2087 | Open in IMG/M |
| 3300023184|Ga0214919_10144501 | All Organisms → Viruses → Predicted Viral | 1903 | Open in IMG/M |
| 3300023184|Ga0214919_10289528 | Not Available | 1139 | Open in IMG/M |
| 3300023184|Ga0214919_10332624 | Not Available | 1025 | Open in IMG/M |
| 3300023184|Ga0214919_10421754 | Not Available | 855 | Open in IMG/M |
| 3300023184|Ga0214919_10470543 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 786 | Open in IMG/M |
| 3300024289|Ga0255147_1000469 | Not Available | 11563 | Open in IMG/M |
| 3300024289|Ga0255147_1106023 | Not Available | 515 | Open in IMG/M |
| 3300024343|Ga0244777_10537723 | Not Available | 714 | Open in IMG/M |
| 3300024343|Ga0244777_10707749 | Not Available | 602 | Open in IMG/M |
| 3300024346|Ga0244775_10025180 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5345 | Open in IMG/M |
| 3300024346|Ga0244775_10088930 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2634 | Open in IMG/M |
| 3300024346|Ga0244775_10100457 | Not Available | 2460 | Open in IMG/M |
| 3300024346|Ga0244775_10498091 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 995 | Open in IMG/M |
| 3300024346|Ga0244775_10585931 | Not Available | 906 | Open in IMG/M |
| 3300024346|Ga0244775_10973904 | Not Available | 671 | Open in IMG/M |
| 3300024348|Ga0244776_10070147 | All Organisms → Viruses → Predicted Viral | 2679 | Open in IMG/M |
| 3300024348|Ga0244776_10660209 | Not Available | 651 | Open in IMG/M |
| 3300024507|Ga0255176_1094360 | Not Available | 512 | Open in IMG/M |
| 3300025357|Ga0208383_1004164 | Not Available | 2003 | Open in IMG/M |
| 3300025372|Ga0207957_1008678 | Not Available | 1454 | Open in IMG/M |
| 3300025389|Ga0208257_1000562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10409 | Open in IMG/M |
| 3300025426|Ga0208739_1075755 | Not Available | 525 | Open in IMG/M |
| 3300026478|Ga0255156_1076475 | Not Available | 596 | Open in IMG/M |
| 3300027193|Ga0208800_1040644 | Not Available | 629 | Open in IMG/M |
| 3300027193|Ga0208800_1051149 | Not Available | 561 | Open in IMG/M |
| 3300027387|Ga0208311_1144021 | Not Available | 501 | Open in IMG/M |
| 3300027396|Ga0255146_1100297 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 594 | Open in IMG/M |
| 3300027396|Ga0255146_1100332 | Not Available | 594 | Open in IMG/M |
| 3300027541|Ga0255158_1112841 | Not Available | 589 | Open in IMG/M |
| 3300027693|Ga0209704_1200340 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300027710|Ga0209599_10001689 | Not Available | 10002 | Open in IMG/M |
| 3300027710|Ga0209599_10009237 | All Organisms → Viruses → Predicted Viral | 3093 | Open in IMG/M |
| 3300027710|Ga0209599_10154102 | Not Available | 613 | Open in IMG/M |
| 3300027721|Ga0209492_1244168 | Not Available | 609 | Open in IMG/M |
| 3300027733|Ga0209297_1013744 | Not Available | 3920 | Open in IMG/M |
| 3300027733|Ga0209297_1033715 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2376 | Open in IMG/M |
| 3300027733|Ga0209297_1054958 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1789 | Open in IMG/M |
| 3300027746|Ga0209597_1369034 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1 | 531 | Open in IMG/M |
| 3300027749|Ga0209084_1015665 | Not Available | 4280 | Open in IMG/M |
| 3300027749|Ga0209084_1067024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1667 | Open in IMG/M |
| 3300027759|Ga0209296_1030164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2997 | Open in IMG/M |
| 3300027798|Ga0209353_10125303 | Not Available | 1154 | Open in IMG/M |
| 3300027804|Ga0209358_10154864 | Not Available | 1222 | Open in IMG/M |
| 3300027804|Ga0209358_10474421 | Not Available | 574 | Open in IMG/M |
| 3300027973|Ga0209298_10237743 | Not Available | 730 | Open in IMG/M |
| 3300028025|Ga0247723_1008108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4377 | Open in IMG/M |
| 3300028025|Ga0247723_1034339 | Not Available | 1566 | Open in IMG/M |
| 3300028393|Ga0304728_1072216 | All Organisms → Viruses → Predicted Viral | 1375 | Open in IMG/M |
| 3300031758|Ga0315907_10200744 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1671 | Open in IMG/M |
| 3300031758|Ga0315907_10212119 | Not Available | 1618 | Open in IMG/M |
| 3300031758|Ga0315907_10262118 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1430 | Open in IMG/M |
| 3300031759|Ga0316219_1008482 | Not Available | 6274 | Open in IMG/M |
| 3300031784|Ga0315899_10786825 | Not Available | 872 | Open in IMG/M |
| 3300031784|Ga0315899_11353926 | Not Available | 606 | Open in IMG/M |
| 3300031787|Ga0315900_10450888 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 994 | Open in IMG/M |
| 3300031787|Ga0315900_10550486 | Not Available | 859 | Open in IMG/M |
| 3300031787|Ga0315900_10667602 | Not Available | 744 | Open in IMG/M |
| 3300031857|Ga0315909_10001161 | Not Available | 35739 | Open in IMG/M |
| 3300031857|Ga0315909_10036995 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 4656 | Open in IMG/M |
| 3300031857|Ga0315909_10200435 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1 | 1582 | Open in IMG/M |
| 3300031857|Ga0315909_10512672 | Not Available | 825 | Open in IMG/M |
| 3300031951|Ga0315904_10409151 | Not Available | 1227 | Open in IMG/M |
| 3300032116|Ga0315903_10052613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4135 | Open in IMG/M |
| 3300032665|Ga0316221_1040313 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1968 | Open in IMG/M |
| 3300033978|Ga0334977_0242064 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 889 | Open in IMG/M |
| 3300033984|Ga0334989_0515647 | Not Available | 591 | Open in IMG/M |
| 3300033992|Ga0334992_0326619 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1 | 710 | Open in IMG/M |
| 3300033994|Ga0334996_0215271 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1014 | Open in IMG/M |
| 3300033996|Ga0334979_0030591 | Not Available | 3586 | Open in IMG/M |
| 3300034012|Ga0334986_0030513 | Not Available | 3567 | Open in IMG/M |
| 3300034013|Ga0334991_0023515 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 3548 | Open in IMG/M |
| 3300034061|Ga0334987_0535407 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 706 | Open in IMG/M |
| 3300034061|Ga0334987_0650788 | Not Available | 613 | Open in IMG/M |
| 3300034096|Ga0335025_0003466 | All Organisms → cellular organisms → Bacteria | 12048 | Open in IMG/M |
| 3300034101|Ga0335027_0424936 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 855 | Open in IMG/M |
| 3300034101|Ga0335027_0427056 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 852 | Open in IMG/M |
| 3300034101|Ga0335027_0851346 | Not Available | 523 | Open in IMG/M |
| 3300034102|Ga0335029_0406326 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1 | 820 | Open in IMG/M |
| 3300034104|Ga0335031_0096977 | Not Available | 2083 | Open in IMG/M |
| 3300034104|Ga0335031_0430955 | Not Available | 820 | Open in IMG/M |
| 3300034104|Ga0335031_0455989 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 789 | Open in IMG/M |
| 3300034104|Ga0335031_0790990 | Not Available | 532 | Open in IMG/M |
| 3300034106|Ga0335036_0853958 | Not Available | 521 | Open in IMG/M |
| 3300034108|Ga0335050_0093139 | All Organisms → Viruses → Predicted Viral | 1760 | Open in IMG/M |
| 3300034284|Ga0335013_0756660 | Not Available | 548 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 14.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.11% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.39% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.39% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.35% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.11% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.17% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.17% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.55% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.55% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.24% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.24% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.93% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.62% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.62% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.62% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.62% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.62% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.62% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.31% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.31% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.31% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001844 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003798 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020490 | Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020558 | Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020723 | Freshwater microbial communities from Trout Bog Lake, WI - 23JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022592 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3 | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027387 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027541 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_100476042 | 3300000882 | Freshwater And Marine | MGTRPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG* |
| FwDRAFT_101323232 | 3300000882 | Freshwater And Marine | TRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG* |
| NpDRAFT_103854132 | 3300000929 | Freshwater And Marine | MGTAPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG* |
| RCM35_10698212 | 3300001844 | Marine Plankton | MAHAAKKPRPMRSRRSGLKKLKQIKQNLEILEKFKK* |
| RCM41_10349892 | 3300001847 | Marine Plankton | MGTAAKKPRPMRSRRSGVKKLEIMKKNLEILKKFKKEYVS* |
| RCM47_11472203 | 3300001848 | Marine Plankton | MGTAAKKPRAMRSRRSGVKKLRLIKQNLEILNKYK* |
| RCM47_11623532 | 3300001848 | Marine Plankton | MGTAAKKPRAMRSRRSGVKKLELVKKNLEILNKLKSI* |
| RCM26_12871652 | 3300001849 | Marine Plankton | MGSAPAKPRPMRSRRSGIKKLRIVQQNLEILKKLKAN* |
| JGI24219J26650_10024757 | 3300002098 | Lentic | MCLKNKTMGSAASKKRPMRSKRSGVKKLELVKVNLDILKKSR* |
| JGI24219J26650_10122223 | 3300002098 | Lentic | MGTATKKKRPMRSRRSGIKKSELVKANLEILKKAN* |
| B570J29032_1088400021 | 3300002408 | Freshwater | MGAAAKKKRPMRSRRSGVKKLTLIKSNREILNKIK* |
| B570J29032_1090600702 | 3300002408 | Freshwater | MGTAAKKKRPMRSKRSGVKKLEQVKKNLLILQKLK* |
| B570J29032_1098618311 | 3300002408 | Freshwater | MGTAAPKPRAMRSRRSGIKKLEIVKKNLEILKKLKGN* |
| B570J29032_10995873011 | 3300002408 | Freshwater | MGTAAKKPRAMRSRRSGVKSFNIVKKNLEILKKLKG* |
| B570J40625_1002843071 | 3300002835 | Freshwater | MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLVKE* |
| Ga0007842_10011061 | 3300003798 | Freshwater | YINMGTAAPKPRPMRSRRSGIKKLVLVQKNLEILKRLKG* |
| Ga0007787_106280322 | 3300004240 | Freshwater Lake | MVTAAKKPRAMRSRRSGIKKAELVRKNQEILKKLINDKVK* |
| Ga0069718_143287933 | 3300004481 | Sediment | ARMVKKDYLKNKIMGTAAKKKRPMRSRRSGVKKLTLVKSNLGILSKLK* |
| Ga0070374_101484532 | 3300005517 | Freshwater Lake | MAHAKPKKRAMRSRRSGVKKLEQLKANLAVLSKLK* |
| Ga0068876_100274842 | 3300005527 | Freshwater Lake | MGSKAKKPRAMRSRRSGIKKAEQIKKNLAILNKLK* |
| Ga0049083_101050022 | 3300005580 | Freshwater Lentic | MGTAPKKKRAMRSRRSGVKKSEQMKKNLAILQKIK* |
| Ga0049080_100225762 | 3300005582 | Freshwater Lentic | MGTRPKKPRAMRSRRSGIKKLEIVKKNLEILKKLKGN* |
| Ga0078894_1000701714 | 3300005662 | Freshwater Lake | MGTSSKKPRAMRSRRSGIKSLNVVKKNLEILKKLKG* |
| Ga0078894_1001695711 | 3300005662 | Freshwater Lake | MGTKAKKPRAMRSRRSGIKKAELVRKNQEILKKLINDKV |
| Ga0078894_100226985 | 3300005662 | Freshwater Lake | MGTAAKKPRAMRSKRSGLKNFIRTHKNLTIINRLIKELKSK* |
| Ga0078894_100262888 | 3300005662 | Freshwater Lake | MGTRAKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG* |
| Ga0078894_101065004 | 3300005662 | Freshwater Lake | MGTAAKKPRAMRSRRSGVKKAELVRKNQEILKKLINDKVK* |
| Ga0078894_107088742 | 3300005662 | Freshwater Lake | MGSKAKKPRAMRSRRSGVKKAEQMKKNLAILNKLK* |
| Ga0078894_108235903 | 3300005662 | Freshwater Lake | KAKKPRAMRSVKSGVKNALRTKSNQEILNRLIKELKKQ* |
| Ga0078894_116389562 | 3300005662 | Freshwater Lake | TAAKKPRAMRSVRSGRKKMEIYKKNQEIIKKYLKLVKE* |
| Ga0078894_117451462 | 3300005662 | Freshwater Lake | MGSKAKKPRAMRSRRSGVKKAELVRKNQEILKKLINDKVK* |
| Ga0079957_100490113 | 3300005805 | Lake | MGTAAKKPRPMRSRRSGIKKMRLIKNNLEILKKIEKGV* |
| Ga0079957_10259105 | 3300005805 | Lake | MATAAKKKRPMRSRKSGIKTLSLVKSNLALLAKTK* |
| Ga0007881_11631673 | 3300006072 | Freshwater | MGSAAPKPRPMRSRRSGIKKLKLVNANLAILKKLK |
| Ga0007862_10147713 | 3300006108 | Freshwater | MGTAAPKPRPIRSRRSGIKKLVLVQKNLEILKRLKG* |
| Ga0070744_100031043 | 3300006484 | Estuarine | MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG* |
| Ga0070744_100970802 | 3300006484 | Estuarine | MAHAKPKKRAMRSRRSGVKKVEQLKANLAVLSKLK* |
| Ga0070744_101539411 | 3300006484 | Estuarine | MGTKSNKPRAMRSRRSGVKSLNIVKKNLEILKKLKG* |
| Ga0070749_106972401 | 3300006802 | Aqueous | MGSKAKKPRAMRSRRSGVKKMKLIKQNLEVLKRLENDKIK* |
| Ga0102875_12297302 | 3300007547 | Estuarine | MGTAPKKKRAMRSRRSGVKKTEQMKKNLAILQKLK* |
| Ga0102877_12159452 | 3300007548 | Estuarine | MGTKPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG* |
| Ga0102879_11375302 | 3300007549 | Estuarine | MGTAPKKKRAMRSRRSGVKKAEQMKKNLAILQKLK* |
| Ga0102817_10153163 | 3300007555 | Estuarine | MGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG* |
| Ga0102913_11297612 | 3300007560 | Estuarine | MGTAPKKKRAMRSRRSGVKKAEQMKKNLAILQKIK* |
| Ga0102915_12988332 | 3300007562 | Estuarine | MGTASKKPRAKRSVRSGRKKMEIFQKNQEIINRLIKELKK* |
| Ga0102903_10926693 | 3300007630 | Estuarine | MAAAPKKKRAMRSRRSGVKKAEQIKKNLAILQKLK* |
| Ga0102865_11225162 | 3300007639 | Estuarine | MGTAPKKKRAMRSRRSGVKKLTLIKSNLEILNKVKC* |
| Ga0102899_10887991 | 3300007706 | Estuarine | ASKKPRAKRSVRSGRKKMEIFQKNQEIINRLIKELKK* |
| Ga0105747_10244013 | 3300007974 | Estuary Water | MGTRPKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG* |
| Ga0105748_105540821 | 3300007992 | Estuary Water | MSLPWYLLETKNMGTAAPKPRAMRSRRSGVKSLNIVKKNLEILKKLQG* |
| Ga0102922_12600871 | 3300008021 | Estuarine | EMGTAPKKKRAMRSRRSGVKKAEQMKKNLAILQKLK* |
| Ga0114340_10337352 | 3300008107 | Freshwater, Plankton | MGTKAKKKRAMRSRKSGLKTVAQISKNLAILSKLK* |
| Ga0114340_10371171 | 3300008107 | Freshwater, Plankton | MGSKAKKPRAMRSRRSGVKKKELVDANLVILKKLQNDKVK* |
| Ga0114340_107244911 | 3300008107 | Freshwater, Plankton | MGTKAKKKRAMRSRKSGLKTVAQINKNLLILSKLK* |
| Ga0114340_10856724 | 3300008107 | Freshwater, Plankton | MGTKAKKKRAMRSRKSGLKSVAQINKNLAILSKLK* |
| Ga0114340_10898453 | 3300008107 | Freshwater, Plankton | MGSAAKKKRPMRSRRSGVKKLTLVKSNLEILNKAR* |
| Ga0114340_10976542 | 3300008107 | Freshwater, Plankton | MGSKAKKPRAMRSRRSGIKKLELVKANLAILKKLESDKTN* |
| Ga0114340_11244741 | 3300008107 | Freshwater, Plankton | MGSKAKKPRAMRSRRSGVKKAELVKKNNEILKKLINDKVK* |
| Ga0114340_11647964 | 3300008107 | Freshwater, Plankton | KKPRAMRSRRSGVKKKELVDANLVILKKLQNDKVK* |
| Ga0114341_104782372 | 3300008108 | Freshwater, Plankton | MGSKAKKPRAMRSRRSGVKKKELVDANLVILKKLQND |
| Ga0114343_10702102 | 3300008110 | Freshwater, Plankton | MGTAAKKPRPMRSRRSGIKSKTIVDNNLTVLKKYTKK* |
| Ga0114343_10756912 | 3300008110 | Freshwater, Plankton | MGSAAKKKKPMRSKRSGVKKLTLVKSNLEILNKAR* |
| Ga0114343_11049342 | 3300008110 | Freshwater, Plankton | MGSAAKKPRAMRSRRSGVKKKELVDANLVILKKLQNDKVK* |
| Ga0114344_10250351 | 3300008111 | Freshwater, Plankton | MGSKAKKPRAMRSRRSGVKKAELVRKNNEILKKLINDKVK* |
| Ga0114346_10027958 | 3300008113 | Freshwater, Plankton | MGTAAKKKRPMRSRRSGIKKAEQLKKNLVILSKLK* |
| Ga0114346_10241817 | 3300008113 | Freshwater, Plankton | MGTAAKKKRPMRSKRSGVKKAEQLKKNLAILSKLK* |
| Ga0114346_11459091 | 3300008113 | Freshwater, Plankton | MGTKAKKKRAMRSRKSGLKTVAQINKNLAILSKLK* |
| Ga0114346_11849362 | 3300008113 | Freshwater, Plankton | MGTAAKKPRPMRSRRSGIKSKSIVDSNLTVLKKYIKK* |
| Ga0114350_10274263 | 3300008116 | Freshwater, Plankton | MGTAAKKKRAMRSRRSGVKKMELIKNNLRILQKLK* |
| Ga0114350_10543262 | 3300008116 | Freshwater, Plankton | MGTAAKKKRAMRSRRSGVKKMELVKNNLRILQNLK* |
| Ga0114350_10756092 | 3300008116 | Freshwater, Plankton | MGSKAKKPRAMRSRRSGVKKKELVDANLVILKKLQNDKAK* |
| Ga0114351_12596351 | 3300008117 | Freshwater, Plankton | MGSKAKKPRAMRSRRSGLKKKKLVDANLVILNKLINDKTK* |
| Ga0114336_11277822 | 3300008261 | Freshwater, Plankton | MGSKAKKPKAMRSRRSGVKKAEQMKKNLAILNKLK* |
| Ga0114337_11275023 | 3300008262 | Freshwater, Plankton | MGRAAKKPRAMRSRRSGLKKKKLVDANLVILNKLINDKTK* |
| Ga0114363_10372324 | 3300008266 | Freshwater, Plankton | MGTASKKPRPMRSRRSGIKSKTLIDNNLSILKKYIKK* |
| Ga0114364_10003049 | 3300008267 | Freshwater, Plankton | MGTAAPKKRPMRSRRSGIKKLELVKKNLDILKKLKG* |
| Ga0114364_10006062 | 3300008267 | Freshwater, Plankton | MGTAAKKKRPMRSKRSGVKKLEQVKKNLAILSKLK* |
| Ga0114364_11149692 | 3300008267 | Freshwater, Plankton | MGTAEKKKRPMRSRRSGIKKFELVKANQEVLQKAK* |
| Ga0114876_10835873 | 3300008448 | Freshwater Lake | MGSAAKKKRPMRSRRSGIKKLTLVKSNLEILNKSR* |
| Ga0114876_10891192 | 3300008448 | Freshwater Lake | MGTAAKKKRPMRSRRSGLKTIAQVNKNLAILSKLK* |
| Ga0114876_11028782 | 3300008448 | Freshwater Lake | MGSAAKKKRPMRSRRSGIKKAELVKANQELLKKAK* |
| Ga0114876_11991061 | 3300008448 | Freshwater Lake | KIMGTAAKKKRPMRSKRSGVKKLEQVKKNLLILQKLK* |
| Ga0102831_10099494 | 3300008996 | Estuarine | MGTSPKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG* |
| Ga0102831_11604371 | 3300008996 | Estuarine | MGTAVKKKRAMRSRRSGVKKVEQLKANLAVLSKLK* |
| Ga0102816_10811452 | 3300008999 | Estuarine | MGTAPKKKRAMRSRRSGVKKSEQMKKNLVILQKIK* |
| Ga0102829_10213641 | 3300009026 | Estuarine | KYMGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG* |
| Ga0102829_12328551 | 3300009026 | Estuarine | MGTAPKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG* |
| Ga0102829_13004032 | 3300009026 | Estuarine | MGTAPKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG* |
| Ga0102909_11418741 | 3300009050 | Estuarine | KYMGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLQG* |
| Ga0102864_11218931 | 3300009051 | Estuarine | KHMGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG* |
| Ga0102830_10336852 | 3300009059 | Estuarine | MGTAAKKPRAMRSRRSGVKSLNIVKKNLEILKKLQG* |
| Ga0114973_100512903 | 3300009068 | Freshwater Lake | MYLQKIKTKYMGTASKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG* |
| Ga0114973_101087512 | 3300009068 | Freshwater Lake | MGTAPKKPRAMRSVRSGRKKMELFKKNQEILKKVTKDTTK* |
| Ga0114973_104196442 | 3300009068 | Freshwater Lake | MGTAAPKPRAMRSRRSGVKKLELIKKNLEILKKLKGN* |
| Ga0114973_105140642 | 3300009068 | Freshwater Lake | MGTAPKKKRAMRSRRSGVKKAELVKANQVLLNKIKA* |
| Ga0102812_105112832 | 3300009086 | Estuarine | MGTSPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG* |
| Ga0114962_100130489 | 3300009151 | Freshwater Lake | MGTAPKKKRAMRSVRSGVKKLALVKSNLEILNKIKA* |
| Ga0114962_100633776 | 3300009151 | Freshwater Lake | MGTAAPKKRAMRSVRSGRKKMELFKKNQEIIKKVTKDTTK* |
| Ga0114962_100676812 | 3300009151 | Freshwater Lake | MGTAPKKPRAMRSRRSGVKSLDIVKKNLEVLKKLKG* |
| Ga0114962_100828763 | 3300009151 | Freshwater Lake | MGTATKKKRPMRSKKSGAKKLALVKNNQEILNKIK* |
| Ga0114962_101769893 | 3300009151 | Freshwater Lake | MGTAPKKPRAMRSRRSGIKSLNIVKNNLEVLKKLKG* |
| Ga0114962_102994742 | 3300009151 | Freshwater Lake | MGTAAKKKRPMKSKRSGVKKLELVKNNLRVLQNLK* |
| Ga0114962_106829031 | 3300009151 | Freshwater Lake | MGTAPKKKRSMRSKKSGVKKLALVKSNLEILNKIKA* |
| Ga0114980_101379372 | 3300009152 | Freshwater Lake | MGTAAKKPRAMRSRRSGVKSLNIVKKNLEVLKKLKG* |
| Ga0114977_100022828 | 3300009158 | Freshwater Lake | MGTAPKKKRAMRSRRSGVKKLNLVKSNLEILNKVKC* |
| Ga0114977_100050379 | 3300009158 | Freshwater Lake | MGTAAPKPRAMRSRRSGIKKLILIQKNLEILKKLKGN* |
| Ga0114977_100378166 | 3300009158 | Freshwater Lake | MGTAPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG* |
| Ga0114977_106492142 | 3300009158 | Freshwater Lake | TRPKKPRAMRSRRSGVKSLNIVKNNLEILKKLKG* |
| Ga0114978_1000289513 | 3300009159 | Freshwater Lake | MGTAPKKKRSMRSKKSGVKKAELVKANQVILNKIKA* |
| Ga0114978_100109379 | 3300009159 | Freshwater Lake | MAHAKPKKRAMRSRRSGVKKLEQLKANLVVLSKLK* |
| Ga0114978_100115735 | 3300009159 | Freshwater Lake | MGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLQG* |
| Ga0114978_102531381 | 3300009159 | Freshwater Lake | TKTKYMGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG* |
| Ga0114978_103579582 | 3300009159 | Freshwater Lake | MGTTSKKPRAMRSVRSGRKKMEQYKKNQEILKRLIKQA |
| Ga0114981_104075282 | 3300009160 | Freshwater Lake | MGTRPKKPRAMRSRRSGVKSLNIVKKNLEVLKKLKG* |
| Ga0114966_106837132 | 3300009161 | Freshwater Lake | MAHAKQKKRAMRSRRSGVKKLEQLKANLVVLSKLK* |
| Ga0114966_106916202 | 3300009161 | Freshwater Lake | MGTAPKKPRAMRSRRSGVKSLNIVKNNLEVLKKIKG* |
| Ga0114975_100166688 | 3300009164 | Freshwater Lake | MGTASKKPRAMRSRRSGVKSLNIVKNNLEILKKLKG* |
| Ga0105102_102425082 | 3300009165 | Freshwater Sediment | MGTAAKKKRPMRSRRSGVKKLNLVKSNLEILNKIK* |
| Ga0105097_100882461 | 3300009169 | Freshwater Sediment | MGTAAKKKRPMRSRRSGVKKAELVKANQIVLNKIK* |
| Ga0105096_105614622 | 3300009170 | Freshwater Sediment | MGTKVKKKRAIRSRKSGLKTVAQISKNLAILSKLK* |
| Ga0114979_103291772 | 3300009180 | Freshwater Lake | MGTTSKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG* |
| Ga0114969_103220993 | 3300009181 | Freshwater Lake | MGTAAKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG* |
| Ga0114959_106099412 | 3300009182 | Freshwater Lake | IFIINNLIMGTAPKKPRAMRSRRSGVKSLDIVKKNLEVLKKLKG* |
| Ga0114974_1000010541 | 3300009183 | Freshwater Lake | MGTAAPKKRAMRSRRSGVKKLTLVKKNLEILNKVK* |
| Ga0114972_108330491 | 3300009187 | Freshwater Lake | KIKTKYMGTAPKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG* |
| Ga0114982_10073853 | 3300009419 | Deep Subsurface | MGTALKKKRAMRSRRSGVKKMELIKNNLRILQKLK* |
| Ga0114982_10162894 | 3300009419 | Deep Subsurface | MGSKAKKPRAMRSRRSGVKKAEQIKKNLAVLNKLK* |
| Ga0114982_10767422 | 3300009419 | Deep Subsurface | MGTAPKKKRAMRSRRSGVKKTEQIKKNLAILQKLK* |
| Ga0114982_10966872 | 3300009419 | Deep Subsurface | MGTAAKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG* |
| Ga0114960_100574025 | 3300010158 | Freshwater Lake | MGTAAPKKRAMRSRRSGIKKFELVKTNLDILKKIKGN* |
| Ga0129333_1002531811 | 3300010354 | Freshwater To Marine Saline Gradient | MGTAAKKPRPMRSRRSGIKKLELVKKNNEILKKFLEYSKK* |
| Ga0129333_101006325 | 3300010354 | Freshwater To Marine Saline Gradient | MGSAAKKKRPMRSRRSGVKKLTLVKSNLEILNKVR* |
| Ga0129333_102101744 | 3300010354 | Freshwater To Marine Saline Gradient | MGTAAKKPRPMRSRRSGIKSKTLIDKNLSILKKYIKK* |
| Ga0129333_105036981 | 3300010354 | Freshwater To Marine Saline Gradient | TNIMGSAQKKPRAMRSKRSGVKKMEQVKRNLEILKKFLTKKG* |
| Ga0133913_100030157 | 3300010885 | Freshwater Lake | MGTTSKKPRAMRSVRSGRKKMEQYKKNQEILKRLIKQATK* |
| Ga0133913_102150201 | 3300010885 | Freshwater Lake | MGTAAKKPRAMRSRRSGIKSLNIVKNNLEVLKKLKG* |
| Ga0133913_107713894 | 3300010885 | Freshwater Lake | MGTAAPKPRAMRSRRSGIKKLTLVKKNLEILKKLKDN* |
| Ga0133913_107990531 | 3300010885 | Freshwater Lake | MGRAAKKPRAMRSVRSGRKKMEQYKKNQEILKRLLKETTK* |
| Ga0133913_108215612 | 3300010885 | Freshwater Lake | LLKIKIMGTAPKKKRAMRSRRSGVKKLTQVKNNLAILSKLK* |
| Ga0133913_114287524 | 3300010885 | Freshwater Lake | MGTAASKPRAMRSRRSGIKKLELIKKNLEILKKLKGN* |
| Ga0133913_117704463 | 3300010885 | Freshwater Lake | MGTAPKKKRAMRSRRSGVKKLTLVKSNLEILNKVKC* |
| Ga0153800_10199462 | 3300011995 | Freshwater | MRKNNNMANTAPKKRPMRSRRSGIKKAEQVKKNLAILSKLK* |
| Ga0153801_10008624 | 3300012017 | Freshwater | MGTASKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG* |
| Ga0157138_10003286 | 3300012352 | Freshwater | MGTKAKKPRAMRSVRSGRKKMELFKRNLAILKKLLKK* |
| Ga0157138_10038754 | 3300012352 | Freshwater | MGTKAKKPRAMRSVRSGRKKMELYKSNLAILKKLLKK* |
| Ga0157210_10202892 | 3300012665 | Freshwater | MGSKAKKPRAMRSRRSGVKKAELVRKNNEILNKLINDKVK* |
| Ga0164293_100159062 | 3300013004 | Freshwater | MGTKAKKKRPMRSRKSGLKSVAQINKNLAILSKLK* |
| Ga0164293_100277074 | 3300013004 | Freshwater | MGTSAKKPRAMRSRRSGIKSLNIVKKNLEILKKLKK* |
| Ga0164293_100368044 | 3300013004 | Freshwater | MGTAPKKKRAMRSRRSGVKKLTQVKSNLEILNKVKC* |
| Ga0164293_100956633 | 3300013004 | Freshwater | MGSKAKKQKAMRSRRSGVKKAEQIKKNLAILNKLK* |
| Ga0164293_102913632 | 3300013004 | Freshwater | MGTAPKKKKPMRSRRSGVKKLTLVKSNLEILNIVKC* |
| Ga0164293_103447462 | 3300013004 | Freshwater | MGTAAKKPRAMRSVRSGKKKMEQFKKNLEIINRLIKGFKK* |
| Ga0164292_100636281 | 3300013005 | Freshwater | LYNIKKNNMGTRAKKPRAMRSRRSGIKSLNIVKKNLEI |
| Ga0164292_100953183 | 3300013005 | Freshwater | MGSKAKKPKAMRSRRSGVKKAEQIKKNLAILNKLK* |
| Ga0164292_101750982 | 3300013005 | Freshwater | MGSAAKKKRPMRSKRSGVKKLTQINKNLAILSKLK* |
| Ga0164292_110129742 | 3300013005 | Freshwater | MGTAAKKKRPMRSKRSGVKKLEQVKKNLAILNKVK* |
| Ga0164296_11007663 | 3300013093 | Freshwater | MGTAAKKPRPKRSRRSGIKTKKLVDNNLKVLSKLKTS* |
| Ga0136642_10860872 | 3300013285 | Freshwater | MGTAAPKPRAMRSRRSGIKKLTLVQKNLDVLKKLKGN* |
| Ga0136641_10045526 | 3300013286 | Freshwater | MGTAIKKKRPMKSKRSGVKKLNLVKANLTVLNKIK* |
| Ga0170791_121311451 | 3300013295 | Freshwater | MATAKKKPVAMRSRRSGVKKLELVKHNLEVLKKYK* |
| Ga0177922_102769721 | 3300013372 | Freshwater | MGTAAKKKRPMRSRRSGVKKLTLIKSNQEILNKIK* |
| Ga0181343_11319592 | 3300017766 | Freshwater Lake | MGTRAKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG |
| Ga0181359_10924323 | 3300019784 | Freshwater Lake | MGIAAKKKRAMRSRRSGVKKAELVKANQVILTKCK |
| Ga0181359_11210492 | 3300019784 | Freshwater Lake | MGTAAKKKRAMRSRRSGVKKAELVKANQVILTKCK |
| Ga0181359_12156841 | 3300019784 | Freshwater Lake | MAHAKPKKRAMRSRRSGVKKLEQLKANLAVLSKLK |
| Ga0211732_12414909 | 3300020141 | Freshwater | MGTSPKKPRAKRSVRSGRKKMELFKKNQDILKKVTKGL |
| Ga0211732_13360382 | 3300020141 | Freshwater | MGSKAKKPRAMRSRRSGVKKAEQMKKNLAILNKLK |
| Ga0211732_13759492 | 3300020141 | Freshwater | MGTAAKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG |
| Ga0211732_13807512 | 3300020141 | Freshwater | MGTAAKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG |
| Ga0211732_148454121 | 3300020141 | Freshwater | MGTAAKKKRPMRSKRSGVKKAELVKANQVILAKCR |
| Ga0211736_103100992 | 3300020151 | Freshwater | MGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG |
| Ga0211736_104293203 | 3300020151 | Freshwater | MGTAAKKKRPMRSRKSGVKKLTLVKSNQEILNKIK |
| Ga0211736_105792332 | 3300020151 | Freshwater | VYLKINQMGTKPKKKRSMRSKRSGVKKVEQINKNLAILSKLK |
| Ga0211734_100807831 | 3300020159 | Freshwater | MGTAPKKKRAMRSRRSGVKKAEQMKKNLAILQKIK |
| Ga0211734_100893552 | 3300020159 | Freshwater | MGTKPKKPRAMRSVRSGRKKMELFKNNLAVLKKFLKK |
| Ga0211734_101237183 | 3300020159 | Freshwater | MGTAPKKKRSMRSRRSGVKKLNLVKSNQEILNKIK |
| Ga0211734_102356981 | 3300020159 | Freshwater | MGTAPKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKL |
| Ga0211734_102358811 | 3300020159 | Freshwater | MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKL |
| Ga0211734_105318182 | 3300020159 | Freshwater | MGSAAKKKRPMRSKRSGVKKAELVKANQVILAKYR |
| Ga0211734_105504861 | 3300020159 | Freshwater | MGTAPKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG |
| Ga0211734_107597102 | 3300020159 | Freshwater | MAHAKQKKRAMRSRRSGVKKLEQLKANLAVLSKLK |
| Ga0211734_112490781 | 3300020159 | Freshwater | KKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG |
| Ga0211733_108378312 | 3300020160 | Freshwater | MGTAAKKPRAMRSKRSGRKKQEIFKANQAIIKKLIKEATA |
| Ga0211733_109974772 | 3300020160 | Freshwater | MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLK |
| Ga0211733_111762941 | 3300020160 | Freshwater | AAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG |
| Ga0211726_107884542 | 3300020161 | Freshwater | MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLTKG |
| Ga0211726_108014404 | 3300020161 | Freshwater | MGSKAKKPRAMRSRRSGIKKAEQMKKNLAILNKLK |
| Ga0211735_109263382 | 3300020162 | Freshwater | MGTAAKKPRAMRSKRSGRKKQEIFKANQAIIKKLVKEATA |
| Ga0211735_111411713 | 3300020162 | Freshwater | MGTAPKKKRAMRSRRSGVKKLSLVKSNLEILNKVKC |
| Ga0211729_105680964 | 3300020172 | Freshwater | MGTAAKKKRPMRSKRSGVKKLEQVKKNLAILSKLK |
| Ga0211729_106001961 | 3300020172 | Freshwater | MGSKAKKPRAMRSRRSGVKKAEQIKKNLAILNKLK |
| Ga0211729_108145002 | 3300020172 | Freshwater | MGTAAKKKRPMRSRRSGVKKLTLVKSNQEILNKIK |
| Ga0211731_105167472 | 3300020205 | Freshwater | MGTAPKKKRAMRSVRSGVKKLTLVKSNLEILNKVKC |
| Ga0211731_108549521 | 3300020205 | Freshwater | MGTSPKKPRAKRSVRSGRKKMELFKKNQDILKKVTKG |
| Ga0211731_108551343 | 3300020205 | Freshwater | MGTAPKKPRAKRSVRSGRKKMELFKKNQDILKKVTKG |
| Ga0211731_113288881 | 3300020205 | Freshwater | MGTAAPKKRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG |
| Ga0211731_117114182 | 3300020205 | Freshwater | MAHAKPKKRAMRSRRSGVKKLEQLKANFAVLSKLK |
| Ga0208052_1211472 | 3300020490 | Freshwater | MGSKAKKPRAMRSRRSGVKKMELVKNNLRILQNLK |
| Ga0208091_10115602 | 3300020506 | Freshwater | MGTKAKKKRAMRSRKSGLKTVAQINKNLAILSKLK |
| Ga0208232_10138723 | 3300020527 | Freshwater | MGSKAKKPRAMRSRRSGIKKAEQIKKNLAILNKLK |
| Ga0208232_10231922 | 3300020527 | Freshwater | MGTKPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG |
| Ga0207941_10176521 | 3300020539 | Freshwater | MGTAAPKPRAMRSRRSGIKKLEIVKKNLEILKKLKGN |
| Ga0208856_10282402 | 3300020548 | Freshwater | MGTRAKKPRAMRSRRSGVKSFNIVKKNLEILKKLKG |
| Ga0208362_10432112 | 3300020558 | Freshwater | MGTKPKKKRAMRSRRSGVKKAEQIKKNLAILQNLK |
| Ga0208719_10193572 | 3300020564 | Freshwater | MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLVKE |
| Ga0214249_10350282 | 3300020723 | Freshwater | MGTAAKKKRPMRSRRSGVKKTELVKNNLEILKKLSTFVLVV |
| Ga0214163_10135464 | 3300021141 | Freshwater | LYNIKKKNNMGTRAKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG |
| Ga0214163_10350073 | 3300021141 | Freshwater | MGTKAKKKRAMRSKKSGLKTVAQINKNLAILSKLK |
| Ga0194047_100458592 | 3300021354 | Anoxic Zone Freshwater | MGTRAKKPRAMRSRKSGVKTADLIKKNHEVLKKLKS |
| Ga0194048_100995952 | 3300021519 | Anoxic Zone Freshwater | MGTAPKKPRAMRSRRSGIKSLNIVKNNLEVLKKLKG |
| Ga0194048_101218673 | 3300021519 | Anoxic Zone Freshwater | MGTAPKKKRAMRSKRSGVKTAEQIKKNLAILQKIK |
| Ga0194060_100500854 | 3300021602 | Anoxic Zone Freshwater | MGTAAPKKRAMRSRRSGVKKLTLVKKNQEILNKVKC |
| Ga0213922_11257821 | 3300021956 | Freshwater | MGTAAKKKRPMRSRRSGVKKLELVKSNLEILNKIKA |
| Ga0222714_100306265 | 3300021961 | Estuarine Water | MGTASKKPRAKRSVRSGRKKMEIFQKNQEIINRLIKELKK |
| Ga0222714_100346984 | 3300021961 | Estuarine Water | MGTAAKKKRPMRSRKSGLKTVAQINKNLAILSKLK |
| Ga0222714_100876112 | 3300021961 | Estuarine Water | MGTAAKKKRPMRSKRSGVKKLEQVKKNLLILQKLK |
| Ga0222714_103847353 | 3300021961 | Estuarine Water | MGSAAKKPRAMRSRRSGVKKKKLVDANLAILNKLINDKTK |
| Ga0222713_101416571 | 3300021962 | Estuarine Water | MGTAAKKPRAMRSRRSGVKKAELVRKNQEILKKLI |
| Ga0222713_101682323 | 3300021962 | Estuarine Water | MGTAAKKPRAMRSKRSGRKKQEIFKANQAILKKLMKEATA |
| Ga0222713_102161242 | 3300021962 | Estuarine Water | MGTAAKKPRAKRSVRSGRKKMEIFQKNQEIINRLIKELKK |
| Ga0222713_103375142 | 3300021962 | Estuarine Water | MGTAAKKPRAMRSRRSGIKSLKIVKNNLEILKKLKG |
| Ga0222713_104267723 | 3300021962 | Estuarine Water | KKPRAKRSVRSGRKKMEIFQKNQEIINRLIKELKK |
| Ga0222713_107972702 | 3300021962 | Estuarine Water | MGTAAKKPRAMRSRRSGVKKLELIKKNIGILKKYLEYYKK |
| Ga0222712_100440645 | 3300021963 | Estuarine Water | MGTAAKKPRAMRSKRSGLKNFIRTHKNLTIINRLIKELKSK |
| Ga0222712_100546244 | 3300021963 | Estuarine Water | MGTAAKKKRPMRSRRSGVKKAELVKKNQEILNKIK |
| Ga0222712_101846623 | 3300021963 | Estuarine Water | MGSKAKKPRAMRSRRSGVKKKRLLDANLAILNKLAK |
| Ga0222712_107265952 | 3300021963 | Estuarine Water | MGTRAKKPRPMRSKRSGVKKANLVKSNLEILKKLK |
| Ga0181353_10424721 | 3300022179 | Freshwater Lake | LIKMGTAAKKKRPMRSRKSGLKTVAQINKNLAILSKLK |
| Ga0181353_11642981 | 3300022179 | Freshwater Lake | MGSAAKKKRPMRSKRSGVKKLEQVKKNLLILQKLK |
| Ga0181354_11620312 | 3300022190 | Freshwater Lake | MAAAKPKKRAMRSRRSGVKKLEQLKANLAVLSKLK |
| Ga0236342_10141442 | 3300022592 | Freshwater | MGTAAKKKRPMRSRRSGVKKLNLVKSNLEILSKLK |
| Ga0214921_100111235 | 3300023174 | Freshwater | MGTRPKKPRAMRSVKSGVKSLNIVKKNLEILKKLKV |
| Ga0214921_103368502 | 3300023174 | Freshwater | MGSAPAKPRAMRSRRSGIKKLELVKKNIEVLKRLKGN |
| Ga0214919_1000067257 | 3300023184 | Freshwater | MGTAAKKPRAMRSRRSGVKSLNIVKKNLEILKRLKG |
| Ga0214919_101269423 | 3300023184 | Freshwater | MGTAAKKPRAMRSRRSGVKKKELVDANLVILKKLQNDKAK |
| Ga0214919_101445012 | 3300023184 | Freshwater | MGTAPKKPRAMRSVRSGRKKMELFKKNQEIIKKVTKDTTK |
| Ga0214919_102895282 | 3300023184 | Freshwater | MGTAASKPRAMRSRRSGIKKLELVKKNLEILKKLKGN |
| Ga0214919_103326242 | 3300023184 | Freshwater | MGTAPKKKRAMRSRKSGVKKLELVKNNLRILQNLK |
| Ga0214919_104217542 | 3300023184 | Freshwater | MAAAPKKKRAMRSRRSGVKKAEQMKKNLVILQNLK |
| Ga0214919_104705434 | 3300023184 | Freshwater | MGTAAKKKRAMRSRRSGIKKKELVDANLAILKKLQNDKAK |
| Ga0255147_100046911 | 3300024289 | Freshwater | MGSAAKKPRAMRSRRSGVKKKKLIDANLAILKKLENDKTK |
| Ga0255147_11060232 | 3300024289 | Freshwater | MGSAAKKPRPMRSRRSGVKKKQLVDANLAILKKCTTK |
| Ga0244777_105377232 | 3300024343 | Estuarine | MGTAPKKKRAMRSRRSGVKKAEQMKKNLAILQKLK |
| Ga0244777_107077492 | 3300024343 | Estuarine | MGTSSKKPRAMRSRRSGIKSLNVVKKNLEILKKLKG |
| Ga0244775_100251806 | 3300024346 | Estuarine | MGTKPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG |
| Ga0244775_100889302 | 3300024346 | Estuarine | MGTRPKKPRSMRSRRSGIKSLDIVKKNLEILKKLKG |
| Ga0244775_101004573 | 3300024346 | Estuarine | MGSKAKKPKAMRSRRSGVKKAEQMKKNLAILNKLK |
| Ga0244775_104980911 | 3300024346 | Estuarine | MGTAPKKKRAMRSRRSGVKKSEQMKKNLAILQKIK |
| Ga0244775_105859313 | 3300024346 | Estuarine | MGTKPQKPRAMRSRRSGVKSLNIVKKNLEILKKLKG |
| Ga0244775_109739042 | 3300024346 | Estuarine | MGTKSNKPRAMRSRRSGVKSLNIVKKNLEILKKLKG |
| Ga0244776_100701472 | 3300024348 | Estuarine | MGTRPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG |
| Ga0244776_106602091 | 3300024348 | Estuarine | MGTAAPKPRAMRSRRSGVKKLELIKKNLEILKKLKGN |
| Ga0255176_10943601 | 3300024507 | Freshwater | MGTAAKKPKAMRSRRSGVKKKKLVDANLAILNKLINDKTK |
| Ga0208383_10041641 | 3300025357 | Freshwater | MGTAAPKPRPIRSRRSGIKKLVLVQKNLEILKRLKG |
| Ga0207957_10086782 | 3300025372 | Freshwater | MGTAAPKPRPMRSRRSGIKKLVLVQKNLEILKRLKG |
| Ga0208257_10005626 | 3300025389 | Freshwater | MGTAAKKPRAMRSRRSGVKKLKLVNKNLEILRSLRG |
| Ga0208739_10757553 | 3300025426 | Freshwater | MGSAAPKPRPMRSRRSGIKKLKLVNANLAILKKLKA |
| Ga0255156_10764753 | 3300026478 | Freshwater | MGTAAKKPRPMRSRRSGVKKKQLVDANLAILKKCTTK |
| Ga0208800_10406442 | 3300027193 | Estuarine | LKRYLHKIKFIQMGTAPKKKRAMRSRRSGVKKSEQMKKNLAILQKIK |
| Ga0208800_10511491 | 3300027193 | Estuarine | MGTAPKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG |
| Ga0208311_11440211 | 3300027387 | Estuarine | MGTSSKKPRAMRSRRSGIKSLNVVKKNLEILKKLK |
| Ga0255146_11002973 | 3300027396 | Freshwater | MGSAAKKPRAMRSRRSGVKKKKLVDANLAILKKLESDKIK |
| Ga0255146_11003321 | 3300027396 | Freshwater | MGTAAKKPRAMRSRRSGVKKLRLIKQNLEILKKIEKGS |
| Ga0255158_11128413 | 3300027541 | Freshwater | MGSAAKKPRPMKSRRSGVKKKQLVDANLAILKKCTTK |
| Ga0209704_12003402 | 3300027693 | Freshwater Sediment | MGSAAKKKRPMRSRRSGIKKLTLVKSNLEILNKSR |
| Ga0209599_100016898 | 3300027710 | Deep Subsurface | MGTALKKKRAMRSRRSGVKKMELIKNNLRILQKLK |
| Ga0209599_100092373 | 3300027710 | Deep Subsurface | MGSKAKKPRAMRSRRSGVKKAEQIKKNLAVLNKLK |
| Ga0209599_101541022 | 3300027710 | Deep Subsurface | MGTAPKKKRAMRSRRSGVKKTEQIKKNLAILQKLK |
| Ga0209492_12441682 | 3300027721 | Freshwater Sediment | MGTAAKKKRPMRSRRSGVKKAELVKANQIVLNKIK |
| Ga0209297_10137447 | 3300027733 | Freshwater Lake | MGTAPKKKRAMRSRRSGVKKLNLVKSNLEILNKVKC |
| Ga0209297_10337155 | 3300027733 | Freshwater Lake | MGTAPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG |
| Ga0209297_10549583 | 3300027733 | Freshwater Lake | MGTAAPKPRAMRSRRSGIKKLILIQKNLEILKKLKGN |
| Ga0209597_13690342 | 3300027746 | Freshwater Lake | MGTAPKKPRAMRSVRSGRKKMELFKKNQEILKKVTKDTTK |
| Ga0209084_10156652 | 3300027749 | Freshwater Lake | MGTAPKKKRSMRSKKSGVKKLALVKSNLEILNKIKA |
| Ga0209084_10670243 | 3300027749 | Freshwater Lake | MGTAPKKPRAMRSRRSGVKSLDIVKKNLEVLKKLKG |
| Ga0209084_13137693 | 3300027749 | Freshwater Lake | DKKKYIYKIMGTAAKKKRPMKSKRSGVKKLELVKNNLRVLQNLK |
| Ga0209296_10301642 | 3300027759 | Freshwater Lake | MGTASKKPRAMRSRRSGVKSLNIVKNNLEILKKLKG |
| Ga0209353_101253034 | 3300027798 | Freshwater Lake | MGTKPKKKRAMKSRRSGVKSATQIKKNLAILEKLK |
| Ga0209358_101548642 | 3300027804 | Freshwater Lake | MGTAAKKPRAMRSRRSGVKKAELVRKNQEILKKLINDKTK |
| Ga0209358_104744211 | 3300027804 | Freshwater Lake | MGTKATKPKAMRSRRSGVKKAELVKKNQEILKKLINDKVK |
| Ga0209298_102377432 | 3300027973 | Freshwater Lake | MGTAAKKPRAMRSRRSGVKSLNIVKKNLEVLKKLKG |
| Ga0247723_10081082 | 3300028025 | Deep Subsurface Sediment | MGTAPKKPRAMRSRRSGRKKQEIFKANQAILKKLMKEATA |
| Ga0247723_10343394 | 3300028025 | Deep Subsurface Sediment | MGTAPKKKRAMRSRRSGVKKTEQIKKNLAILEKLK |
| Ga0304728_10722162 | 3300028393 | Freshwater Lake | MGTAAPKKRAMRSRRSGIKKFELVKTNLDILKKIKGN |
| Ga0315907_102007441 | 3300031758 | Freshwater | MGSKAKKPRAMRSRRSGVKKAELVKKNNEILKKLINDKVK |
| Ga0315907_102121192 | 3300031758 | Freshwater | MGTAAKKKRPMRSRRSGIKKAEQLKKNLVILSKLK |
| Ga0315907_102621183 | 3300031758 | Freshwater | MGTAAKKKRAMRSRRSGVKKMELIKNNLRILQKLK |
| Ga0316219_100848210 | 3300031759 | Freshwater | MGTAAKKPRPKRSRRSGIKTKKLVDNNLKVLSKLKTS |
| Ga0315899_107868251 | 3300031784 | Freshwater | MGSKAKKPRAMRSRRSGVKKAELVRKNNEILKKLINDKVK |
| Ga0315899_113539262 | 3300031784 | Freshwater | MGSKAKKPRAMRSRRSGVKKKELVDANLVILKKLQNDKVK |
| Ga0315900_104508882 | 3300031787 | Freshwater | MGTKAKKKRAMRSRKSGLKTVAQINKNLLILSKLK |
| Ga0315900_105504862 | 3300031787 | Freshwater | MGTKAKKPRPMRSKRSGVKKLNLVKSNLAILSKLK |
| Ga0315900_106676024 | 3300031787 | Freshwater | MGTAAKKPRAMRSRRSGVKKKKLIDANLAILKKLESGKVK |
| Ga0315909_1000116175 | 3300031857 | Freshwater | MGTAAKKKRPMRSRRSGIKKAEQLKKNLLILSKLK |
| Ga0315909_100369953 | 3300031857 | Freshwater | MGTAAKKKRAMRSRRSGVKKMELVKNNLRILQNLK |
| Ga0315909_102004352 | 3300031857 | Freshwater | MGTAAKKPRPMRSRRSGIKSKTLIDNNLSILKKYIKK |
| Ga0315909_105126723 | 3300031857 | Freshwater | MGTAAKKPRAMRSRRSGVKKKKLVDANLAILKKLESGKVK |
| Ga0315904_104091511 | 3300031951 | Freshwater | MGSAAKKPRAMRSRRSGLKKKKLVDANLVILNKLINDKTK |
| Ga0315903_100526131 | 3300032116 | Freshwater | KNKIMGTAAKKKRPMRSRRSGIKKAEQLKKNLVILSKLK |
| Ga0316221_10403134 | 3300032665 | Freshwater | KKAYSLNNMGTAAKKPRPKRSRRSGIKTKKLVDNNLKVLSKLKTS |
| Ga0334977_0242064_35_142 | 3300033978 | Freshwater | MAAAPKKKRAMRSRRSGVKKSEQMKKNLAILQKIK |
| Ga0334989_0515647_483_590 | 3300033984 | Freshwater | PKKRAMRSVRSGRKKMEIYKKNQEILKKYLKLVKE |
| Ga0334992_0326619_235_357 | 3300033992 | Freshwater | MGTAAPKKRAMRSVRSGRKKMEIYKKNQEILKKYLKLVKE |
| Ga0334996_0215271_855_962 | 3300033994 | Freshwater | MGTKAKKKRPMRSKRSGLKTVAQVNKNLAILSKLK |
| Ga0334979_0030591_2100_2207 | 3300033996 | Freshwater | MGSKAKKPKAMRSRRSGVKKAEQIKKNLAILNKLK |
| Ga0334986_0030513_3133_3243 | 3300034012 | Freshwater | MGSAAKKPRPMRSRRSGVKKDKLIKNNTLILSKYTK |
| Ga0334991_0023515_3254_3364 | 3300034013 | Freshwater | MGTKAKKPHAMRSRRSGVKSLNIVKKNLEILKKLKG |
| Ga0334991_0028370_684_803 | 3300034013 | Freshwater | MGSAPKKPRAMRSKRSGVKKMEQIKRNLEILKKFLTKKG |
| Ga0334987_0535407_599_706 | 3300034061 | Freshwater | GTAPKKKKPMRSRRSGVKKLTLVKSNLEILNKVKC |
| Ga0334987_0650788_211_318 | 3300034061 | Freshwater | MGTAAKKKRPMRSRRSGLKTIAQINKNLVILSKLK |
| Ga0335025_0003466_9734_9844 | 3300034096 | Freshwater | MGTSAKKPRAMRSRRSGIKSLNIVKKNLEILKKLKK |
| Ga0335027_0424936_490_597 | 3300034101 | Freshwater | MGTAPKKKRAMRSRRSGVKKLTLVKKNQEILSKLK |
| Ga0335027_0427056_428_538 | 3300034101 | Freshwater | MGSAAKKKRPMRSRRSGVKKLTLVKSNLEILNKVKC |
| Ga0335027_0851346_276_386 | 3300034101 | Freshwater | MGTAAKKPRAMRSRRSGIKSLNIVKNNLEILKKLKG |
| Ga0335029_0406326_317_439 | 3300034102 | Freshwater | MGTATPKKRAMRSVRSGRKKMEIYKKNQEILKKYLKLVKE |
| Ga0335031_0096977_1683_1805 | 3300034104 | Freshwater | MGTAPKKTRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG |
| Ga0335031_0430955_578_685 | 3300034104 | Freshwater | MAHAKPKKRAMRSRRSGVKKVEQLKANLAVLSKLK |
| Ga0335031_0455989_494_601 | 3300034104 | Freshwater | MGTAPKKKRPMRSRRSGVKKLTLVKKNQEILSKLK |
| Ga0335031_0790990_135_248 | 3300034104 | Freshwater | MGTAAKKKRAMRSRRSGVKKMELVKNNLRILQKCSAK |
| Ga0335036_0853958_210_317 | 3300034106 | Freshwater | MANATKKPKPMRSRRSGIKTQTQINKNLAILSKLK |
| Ga0335050_0093139_1654_1758 | 3300034108 | Freshwater | MGSAPKKPRAMRSKRSGVKKMEQIKRNLEILKKFL |
| Ga0335013_0756660_350_472 | 3300034284 | Freshwater | MGTAAKKPRAMRSVRSGKKKMEQFKKNLEIINRLIKGFKK |
| ⦗Top⦘ |