


| Basic Information | |
|---|---|
| Family ID | F009082 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 323 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MRAWMVGIAVVVAIGLIWSVAAMSNLVPVDGSEMSLAAISRPAE |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 323 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 61.37 % |
| % of genes near scaffold ends (potentially truncated) | 42.11 % |
| % of genes from short scaffolds (< 2000 bps) | 84.21 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.012 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (22.910 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.368 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.873 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 323 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 2.17 |
| PF00890 | FAD_binding_2 | 1.86 |
| PF12307 | DUF3631 | 1.24 |
| PF00072 | Response_reg | 0.62 |
| PF04851 | ResIII | 0.62 |
| PF06411 | HdeA | 0.62 |
| PF00816 | Histone_HNS | 0.62 |
| PF02566 | OsmC | 0.62 |
| PF08867 | FRG | 0.62 |
| PF00690 | Cation_ATPase_N | 0.62 |
| PF00083 | Sugar_tr | 0.62 |
| PF00126 | HTH_1 | 0.62 |
| PF12833 | HTH_18 | 0.62 |
| PF03401 | TctC | 0.31 |
| PF13191 | AAA_16 | 0.31 |
| PF03976 | PPK2 | 0.31 |
| PF00196 | GerE | 0.31 |
| PF13458 | Peripla_BP_6 | 0.31 |
| PF07452 | CHRD | 0.31 |
| PF07369 | DUF1488 | 0.31 |
| PF00534 | Glycos_transf_1 | 0.31 |
| PF04209 | HgmA_C | 0.31 |
| PF08281 | Sigma70_r4_2 | 0.31 |
| PF00903 | Glyoxalase | 0.31 |
| PF07681 | DoxX | 0.31 |
| PF05050 | Methyltransf_21 | 0.31 |
| PF14255 | Cys_rich_CPXG | 0.31 |
| PF07045 | DUF1330 | 0.31 |
| PF04347 | FliO | 0.31 |
| PF08308 | PEGA | 0.31 |
| PF00872 | Transposase_mut | 0.31 |
| PF13398 | Peptidase_M50B | 0.31 |
| PF13467 | RHH_4 | 0.31 |
| PF13414 | TPR_11 | 0.31 |
| PF00654 | Voltage_CLC | 0.31 |
| PF06823 | DUF1236 | 0.31 |
| PF00239 | Resolvase | 0.31 |
| PF13546 | DDE_5 | 0.31 |
| PF13560 | HTH_31 | 0.31 |
| PF13533 | Biotin_lipoyl_2 | 0.31 |
| PF05869 | Dam | 0.31 |
| PF13358 | DDE_3 | 0.31 |
| PF14415 | DUF4424 | 0.31 |
| PF02738 | MoCoBD_1 | 0.31 |
| PF08734 | GYD | 0.31 |
| PF11185 | DUF2971 | 0.31 |
| PF07508 | Recombinase | 0.31 |
| PF01068 | DNA_ligase_A_M | 0.31 |
| PF00536 | SAM_1 | 0.31 |
| COG ID | Name | Functional Category | % Frequency in 323 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.17 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.62 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.62 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.62 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.62 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.62 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.31 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.31 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.31 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.31 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.31 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.31 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.31 |
| COG3190 | Flagellar biogenesis protein FliO | Cell motility [N] | 0.31 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.31 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.31 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.31 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.31 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.01 % |
| All Organisms | root | All Organisms | 47.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16474082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1509 | Open in IMG/M |
| 2228664022|INPgaii200_c0840164 | Not Available | 505 | Open in IMG/M |
| 3300000156|NODE_c0604445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1653 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1017373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1084 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1058453 | Not Available | 566 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10022416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1728 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10033054 | Not Available | 1391 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10043555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1182 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1025449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 944 | Open in IMG/M |
| 3300000955|JGI1027J12803_100583139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1522 | Open in IMG/M |
| 3300000955|JGI1027J12803_105734122 | Not Available | 623 | Open in IMG/M |
| 3300004267|Ga0066396_10014241 | Not Available | 1001 | Open in IMG/M |
| 3300004268|Ga0066398_10008144 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300004633|Ga0066395_10150913 | Not Available | 1177 | Open in IMG/M |
| 3300004633|Ga0066395_10203697 | Not Available | 1037 | Open in IMG/M |
| 3300005184|Ga0066671_10044130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2206 | Open in IMG/M |
| 3300005187|Ga0066675_10746079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300005332|Ga0066388_100173083 | All Organisms → cellular organisms → Bacteria | 2761 | Open in IMG/M |
| 3300005332|Ga0066388_100250651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2409 | Open in IMG/M |
| 3300005332|Ga0066388_100256994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2387 | Open in IMG/M |
| 3300005332|Ga0066388_100268308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2348 | Open in IMG/M |
| 3300005332|Ga0066388_100301903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2246 | Open in IMG/M |
| 3300005332|Ga0066388_100305615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2236 | Open in IMG/M |
| 3300005332|Ga0066388_100423211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1975 | Open in IMG/M |
| 3300005332|Ga0066388_100626980 | Not Available | 1694 | Open in IMG/M |
| 3300005332|Ga0066388_100906038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1459 | Open in IMG/M |
| 3300005332|Ga0066388_101374466 | Not Available | 1224 | Open in IMG/M |
| 3300005332|Ga0066388_101613747 | Not Available | 1142 | Open in IMG/M |
| 3300005332|Ga0066388_101826306 | Not Available | 1082 | Open in IMG/M |
| 3300005332|Ga0066388_101918151 | Not Available | 1058 | Open in IMG/M |
| 3300005332|Ga0066388_102775518 | Not Available | 894 | Open in IMG/M |
| 3300005332|Ga0066388_103884837 | Not Available | 762 | Open in IMG/M |
| 3300005332|Ga0066388_103981214 | Not Available | 753 | Open in IMG/M |
| 3300005332|Ga0066388_104974593 | Not Available | 675 | Open in IMG/M |
| 3300005332|Ga0066388_105030301 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005332|Ga0066388_105606711 | Not Available | 635 | Open in IMG/M |
| 3300005332|Ga0066388_106055775 | Not Available | 611 | Open in IMG/M |
| 3300005332|Ga0066388_106097320 | Not Available | 609 | Open in IMG/M |
| 3300005332|Ga0066388_107470373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300005332|Ga0066388_107577149 | Not Available | 544 | Open in IMG/M |
| 3300005332|Ga0066388_107949562 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005363|Ga0008090_15743944 | Not Available | 1032 | Open in IMG/M |
| 3300005434|Ga0070709_10006279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6472 | Open in IMG/M |
| 3300005434|Ga0070709_10797417 | Not Available | 741 | Open in IMG/M |
| 3300005435|Ga0070714_100383385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1326 | Open in IMG/M |
| 3300005436|Ga0070713_100876360 | Not Available | 863 | Open in IMG/M |
| 3300005437|Ga0070710_10071865 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300005445|Ga0070708_102166887 | Not Available | 514 | Open in IMG/M |
| 3300005467|Ga0070706_100309525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1473 | Open in IMG/M |
| 3300005471|Ga0070698_100063448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3725 | Open in IMG/M |
| 3300005546|Ga0070696_101711893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300005556|Ga0066707_10829996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300005560|Ga0066670_10208450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1176 | Open in IMG/M |
| 3300005560|Ga0066670_10315802 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300005587|Ga0066654_10583112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300005713|Ga0066905_100053197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2493 | Open in IMG/M |
| 3300005713|Ga0066905_100249795 | Not Available | 1362 | Open in IMG/M |
| 3300005713|Ga0066905_100306502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1249 | Open in IMG/M |
| 3300005713|Ga0066905_100503033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1008 | Open in IMG/M |
| 3300005713|Ga0066905_101474365 | Not Available | 618 | Open in IMG/M |
| 3300005713|Ga0066905_101529424 | Not Available | 608 | Open in IMG/M |
| 3300005713|Ga0066905_101689116 | Not Available | 581 | Open in IMG/M |
| 3300005713|Ga0066905_101701516 | Not Available | 579 | Open in IMG/M |
| 3300005713|Ga0066905_101707931 | Not Available | 578 | Open in IMG/M |
| 3300005713|Ga0066905_102274065 | Not Available | 506 | Open in IMG/M |
| 3300005713|Ga0066905_102315307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 502 | Open in IMG/M |
| 3300005764|Ga0066903_100503574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2053 | Open in IMG/M |
| 3300005764|Ga0066903_100979458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1542 | Open in IMG/M |
| 3300005764|Ga0066903_101005091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1525 | Open in IMG/M |
| 3300005764|Ga0066903_101391053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1317 | Open in IMG/M |
| 3300005764|Ga0066903_102382435 | Not Available | 1024 | Open in IMG/M |
| 3300005764|Ga0066903_102653544 | Not Available | 971 | Open in IMG/M |
| 3300005764|Ga0066903_102676046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 967 | Open in IMG/M |
| 3300005764|Ga0066903_103746583 | Not Available | 817 | Open in IMG/M |
| 3300005764|Ga0066903_103775003 | Not Available | 814 | Open in IMG/M |
| 3300005764|Ga0066903_103809406 | Not Available | 810 | Open in IMG/M |
| 3300005764|Ga0066903_103970166 | Not Available | 793 | Open in IMG/M |
| 3300005764|Ga0066903_104549013 | Not Available | 739 | Open in IMG/M |
| 3300005764|Ga0066903_104707090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300005764|Ga0066903_104893976 | Not Available | 711 | Open in IMG/M |
| 3300005764|Ga0066903_105260677 | Not Available | 684 | Open in IMG/M |
| 3300005764|Ga0066903_105443590 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005764|Ga0066903_107010790 | Not Available | 584 | Open in IMG/M |
| 3300005764|Ga0066903_107925160 | Not Available | 545 | Open in IMG/M |
| 3300005764|Ga0066903_108204328 | Not Available | 534 | Open in IMG/M |
| 3300005764|Ga0066903_108233262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300005764|Ga0066903_108552213 | Not Available | 521 | Open in IMG/M |
| 3300005764|Ga0066903_108718563 | Not Available | 515 | Open in IMG/M |
| 3300005764|Ga0066903_109143524 | Not Available | 501 | Open in IMG/M |
| 3300005842|Ga0068858_101412551 | Not Available | 686 | Open in IMG/M |
| 3300005937|Ga0081455_10011782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 8757 | Open in IMG/M |
| 3300005937|Ga0081455_10017828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6789 | Open in IMG/M |
| 3300005937|Ga0081455_10031027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4844 | Open in IMG/M |
| 3300005937|Ga0081455_10040318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4119 | Open in IMG/M |
| 3300005937|Ga0081455_10097361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2371 | Open in IMG/M |
| 3300005937|Ga0081455_10113578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2148 | Open in IMG/M |
| 3300005981|Ga0081538_10131378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1176 | Open in IMG/M |
| 3300005983|Ga0081540_1003704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11973 | Open in IMG/M |
| 3300006028|Ga0070717_10061177 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
| 3300006038|Ga0075365_10197114 | Not Available | 1410 | Open in IMG/M |
| 3300006046|Ga0066652_100351956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1326 | Open in IMG/M |
| 3300006177|Ga0075362_10540353 | Not Available | 599 | Open in IMG/M |
| 3300006844|Ga0075428_100360763 | Not Available | 1559 | Open in IMG/M |
| 3300006844|Ga0075428_100921785 | Not Available | 926 | Open in IMG/M |
| 3300006844|Ga0075428_101662398 | Not Available | 667 | Open in IMG/M |
| 3300006845|Ga0075421_100725580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1152 | Open in IMG/M |
| 3300006847|Ga0075431_100559906 | Not Available | 1130 | Open in IMG/M |
| 3300006847|Ga0075431_100689318 | Not Available | 1000 | Open in IMG/M |
| 3300006904|Ga0075424_101069721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300009094|Ga0111539_12492965 | Not Available | 600 | Open in IMG/M |
| 3300009100|Ga0075418_10913881 | Not Available | 949 | Open in IMG/M |
| 3300009792|Ga0126374_10059278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1990 | Open in IMG/M |
| 3300009792|Ga0126374_10514699 | Not Available | 866 | Open in IMG/M |
| 3300009792|Ga0126374_10590429 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300009792|Ga0126374_10600934 | Not Available | 812 | Open in IMG/M |
| 3300009792|Ga0126374_10902550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300010038|Ga0126315_10656071 | Not Available | 682 | Open in IMG/M |
| 3300010043|Ga0126380_10133365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1558 | Open in IMG/M |
| 3300010043|Ga0126380_10243530 | Not Available | 1239 | Open in IMG/M |
| 3300010043|Ga0126380_10356916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1067 | Open in IMG/M |
| 3300010043|Ga0126380_10986513 | Not Available | 708 | Open in IMG/M |
| 3300010043|Ga0126380_11480084 | Not Available | 600 | Open in IMG/M |
| 3300010046|Ga0126384_10001317 | All Organisms → cellular organisms → Bacteria | 14685 | Open in IMG/M |
| 3300010046|Ga0126384_10321659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1279 | Open in IMG/M |
| 3300010046|Ga0126384_10526286 | Not Available | 1023 | Open in IMG/M |
| 3300010046|Ga0126384_10550661 | Not Available | 1002 | Open in IMG/M |
| 3300010046|Ga0126384_10567464 | Not Available | 988 | Open in IMG/M |
| 3300010046|Ga0126384_11038644 | Not Available | 748 | Open in IMG/M |
| 3300010046|Ga0126384_11239575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300010046|Ga0126384_11676698 | Not Available | 600 | Open in IMG/M |
| 3300010046|Ga0126384_11814158 | Not Available | 579 | Open in IMG/M |
| 3300010046|Ga0126384_12234601 | Not Available | 527 | Open in IMG/M |
| 3300010047|Ga0126382_10146766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1608 | Open in IMG/M |
| 3300010047|Ga0126382_10345554 | Not Available | 1137 | Open in IMG/M |
| 3300010047|Ga0126382_10846861 | Not Available | 785 | Open in IMG/M |
| 3300010047|Ga0126382_11474231 | Not Available | 624 | Open in IMG/M |
| 3300010047|Ga0126382_11621035 | Not Available | 601 | Open in IMG/M |
| 3300010048|Ga0126373_10056845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3495 | Open in IMG/M |
| 3300010358|Ga0126370_10168018 | Not Available | 1620 | Open in IMG/M |
| 3300010358|Ga0126370_10400225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1128 | Open in IMG/M |
| 3300010358|Ga0126370_10762890 | Not Available | 858 | Open in IMG/M |
| 3300010358|Ga0126370_11570467 | Not Available | 628 | Open in IMG/M |
| 3300010358|Ga0126370_11785505 | Not Available | 595 | Open in IMG/M |
| 3300010358|Ga0126370_12458683 | Not Available | 518 | Open in IMG/M |
| 3300010359|Ga0126376_10303533 | Not Available | 1389 | Open in IMG/M |
| 3300010359|Ga0126376_10698006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
| 3300010359|Ga0126376_11759039 | Not Available | 656 | Open in IMG/M |
| 3300010359|Ga0126376_12770371 | Not Available | 540 | Open in IMG/M |
| 3300010360|Ga0126372_10005297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6240 | Open in IMG/M |
| 3300010360|Ga0126372_10007973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5402 | Open in IMG/M |
| 3300010360|Ga0126372_10785494 | Not Available | 941 | Open in IMG/M |
| 3300010360|Ga0126372_11117850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 807 | Open in IMG/M |
| 3300010361|Ga0126378_10524468 | Not Available | 1300 | Open in IMG/M |
| 3300010361|Ga0126378_10864250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1012 | Open in IMG/M |
| 3300010361|Ga0126378_12497551 | Not Available | 590 | Open in IMG/M |
| 3300010362|Ga0126377_10006054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9042 | Open in IMG/M |
| 3300010362|Ga0126377_10797882 | Not Available | 1002 | Open in IMG/M |
| 3300010362|Ga0126377_12783484 | Not Available | 564 | Open in IMG/M |
| 3300010366|Ga0126379_10135311 | Not Available | 2268 | Open in IMG/M |
| 3300010366|Ga0126379_11047375 | Not Available | 921 | Open in IMG/M |
| 3300010366|Ga0126379_11947161 | Not Available | 691 | Open in IMG/M |
| 3300010371|Ga0134125_12265354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300010376|Ga0126381_100312021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2158 | Open in IMG/M |
| 3300010376|Ga0126381_100954827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1236 | Open in IMG/M |
| 3300010376|Ga0126381_102142669 | Not Available | 805 | Open in IMG/M |
| 3300010376|Ga0126381_102436408 | Not Available | 750 | Open in IMG/M |
| 3300010376|Ga0126381_102894692 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300010376|Ga0126381_103695543 | Not Available | 599 | Open in IMG/M |
| 3300010398|Ga0126383_10700367 | Not Available | 1091 | Open in IMG/M |
| 3300010398|Ga0126383_11579240 | Not Available | 745 | Open in IMG/M |
| 3300010398|Ga0126383_13519330 | Not Available | 511 | Open in IMG/M |
| 3300010863|Ga0124850_1010978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2879 | Open in IMG/M |
| 3300010863|Ga0124850_1109746 | Not Available | 747 | Open in IMG/M |
| 3300012204|Ga0137374_10222229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 1607 | Open in IMG/M |
| 3300012205|Ga0137362_11119904 | Not Available | 669 | Open in IMG/M |
| 3300012211|Ga0137377_10694848 | Not Available | 952 | Open in IMG/M |
| 3300012350|Ga0137372_10250450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1393 | Open in IMG/M |
| 3300012469|Ga0150984_108333818 | Not Available | 617 | Open in IMG/M |
| 3300012948|Ga0126375_10256651 | Not Available | 1188 | Open in IMG/M |
| 3300012958|Ga0164299_10177079 | Not Available | 1209 | Open in IMG/M |
| 3300012958|Ga0164299_11591035 | Not Available | 514 | Open in IMG/M |
| 3300012961|Ga0164302_10097425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1615 | Open in IMG/M |
| 3300012971|Ga0126369_10014451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 6177 | Open in IMG/M |
| 3300012971|Ga0126369_10304483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WM6378 | 1596 | Open in IMG/M |
| 3300012971|Ga0126369_10408732 | Not Available | 1397 | Open in IMG/M |
| 3300012971|Ga0126369_10484652 | Not Available | 1292 | Open in IMG/M |
| 3300012971|Ga0126369_10505239 | Not Available | 1267 | Open in IMG/M |
| 3300012971|Ga0126369_11985564 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012971|Ga0126369_12079938 | Not Available | 655 | Open in IMG/M |
| 3300012971|Ga0126369_12201969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300013306|Ga0163162_11580818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300014154|Ga0134075_10472313 | Not Available | 559 | Open in IMG/M |
| 3300015371|Ga0132258_12272482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1361 | Open in IMG/M |
| 3300015372|Ga0132256_102878880 | Not Available | 578 | Open in IMG/M |
| 3300016270|Ga0182036_10061375 | Not Available | 2410 | Open in IMG/M |
| 3300016294|Ga0182041_10752854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 867 | Open in IMG/M |
| 3300016319|Ga0182033_11703903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300016357|Ga0182032_10423434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1082 | Open in IMG/M |
| 3300016357|Ga0182032_10450317 | Not Available | 1050 | Open in IMG/M |
| 3300016371|Ga0182034_11220438 | Not Available | 654 | Open in IMG/M |
| 3300016371|Ga0182034_11384766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300016387|Ga0182040_10923498 | Not Available | 725 | Open in IMG/M |
| 3300016404|Ga0182037_11429863 | Not Available | 612 | Open in IMG/M |
| 3300016422|Ga0182039_10048116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2884 | Open in IMG/M |
| 3300016422|Ga0182039_10746020 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300016422|Ga0182039_10973222 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300016422|Ga0182039_11827234 | Not Available | 557 | Open in IMG/M |
| 3300016445|Ga0182038_10510089 | Not Available | 1027 | Open in IMG/M |
| 3300016445|Ga0182038_10636070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 924 | Open in IMG/M |
| 3300016445|Ga0182038_11107673 | Not Available | 704 | Open in IMG/M |
| 3300018433|Ga0066667_11202215 | Not Available | 659 | Open in IMG/M |
| 3300018468|Ga0066662_10205761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1561 | Open in IMG/M |
| 3300018482|Ga0066669_10242975 | Not Available | 1417 | Open in IMG/M |
| 3300020580|Ga0210403_10882281 | Not Available | 706 | Open in IMG/M |
| 3300021168|Ga0210406_11299548 | Not Available | 524 | Open in IMG/M |
| 3300021178|Ga0210408_11305950 | Not Available | 550 | Open in IMG/M |
| 3300021476|Ga0187846_10118121 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300021560|Ga0126371_10217988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2011 | Open in IMG/M |
| 3300021560|Ga0126371_10507808 | Not Available | 1354 | Open in IMG/M |
| 3300021560|Ga0126371_11008623 | Not Available | 974 | Open in IMG/M |
| 3300021560|Ga0126371_11279390 | Not Available | 867 | Open in IMG/M |
| 3300021560|Ga0126371_12385642 | Not Available | 640 | Open in IMG/M |
| 3300021560|Ga0126371_13013865 | Not Available | 570 | Open in IMG/M |
| 3300021560|Ga0126371_13550874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300025906|Ga0207699_10509393 | Not Available | 869 | Open in IMG/M |
| 3300025910|Ga0207684_10102753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2444 | Open in IMG/M |
| 3300025916|Ga0207663_11723520 | Not Available | 504 | Open in IMG/M |
| 3300025928|Ga0207700_10004335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8345 | Open in IMG/M |
| 3300025929|Ga0207664_10290033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1438 | Open in IMG/M |
| 3300027874|Ga0209465_10102477 | Not Available | 1404 | Open in IMG/M |
| 3300027874|Ga0209465_10155059 | Not Available | 1137 | Open in IMG/M |
| 3300027909|Ga0209382_10318359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1750 | Open in IMG/M |
| 3300028047|Ga0209526_10090045 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
| 3300028768|Ga0307280_10315395 | Not Available | 572 | Open in IMG/M |
| 3300030986|Ga0308154_112420 | Not Available | 574 | Open in IMG/M |
| 3300031421|Ga0308194_10135520 | Not Available | 746 | Open in IMG/M |
| 3300031543|Ga0318516_10043692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2418 | Open in IMG/M |
| 3300031543|Ga0318516_10124659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1470 | Open in IMG/M |
| 3300031543|Ga0318516_10710964 | Not Available | 570 | Open in IMG/M |
| 3300031545|Ga0318541_10005069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5501 | Open in IMG/M |
| 3300031545|Ga0318541_10018956 | All Organisms → cellular organisms → Bacteria | 3261 | Open in IMG/M |
| 3300031561|Ga0318528_10103071 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300031561|Ga0318528_10205042 | Not Available | 1055 | Open in IMG/M |
| 3300031573|Ga0310915_10012778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4928 | Open in IMG/M |
| 3300031573|Ga0310915_10149969 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300031573|Ga0310915_10390360 | Not Available | 988 | Open in IMG/M |
| 3300031573|Ga0310915_10721289 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031573|Ga0310915_10789373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300031573|Ga0310915_10808071 | Not Available | 659 | Open in IMG/M |
| 3300031573|Ga0310915_10943767 | Not Available | 603 | Open in IMG/M |
| 3300031573|Ga0310915_11095173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300031640|Ga0318555_10593681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300031680|Ga0318574_10554537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300031719|Ga0306917_10080565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2285 | Open in IMG/M |
| 3300031719|Ga0306917_10453531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300031719|Ga0306917_11163554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300031736|Ga0318501_10357302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300031740|Ga0307468_100291626 | Not Available | 1178 | Open in IMG/M |
| 3300031748|Ga0318492_10382584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300031751|Ga0318494_10450943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 748 | Open in IMG/M |
| 3300031764|Ga0318535_10230741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 828 | Open in IMG/M |
| 3300031765|Ga0318554_10193838 | Not Available | 1156 | Open in IMG/M |
| 3300031765|Ga0318554_10605075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300031770|Ga0318521_10016966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3310 | Open in IMG/M |
| 3300031770|Ga0318521_10077861 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300031770|Ga0318521_10645547 | Not Available | 641 | Open in IMG/M |
| 3300031780|Ga0318508_1054436 | Not Available | 1064 | Open in IMG/M |
| 3300031781|Ga0318547_10781645 | Not Available | 594 | Open in IMG/M |
| 3300031793|Ga0318548_10389458 | Not Available | 683 | Open in IMG/M |
| 3300031798|Ga0318523_10219314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 950 | Open in IMG/M |
| 3300031819|Ga0318568_10657498 | Not Available | 652 | Open in IMG/M |
| 3300031821|Ga0318567_10420822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300031833|Ga0310917_10592402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 753 | Open in IMG/M |
| 3300031833|Ga0310917_10889251 | Not Available | 599 | Open in IMG/M |
| 3300031846|Ga0318512_10008565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3847 | Open in IMG/M |
| 3300031879|Ga0306919_10080722 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
| 3300031890|Ga0306925_10103101 | Not Available | 3038 | Open in IMG/M |
| 3300031890|Ga0306925_10267911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1840 | Open in IMG/M |
| 3300031890|Ga0306925_10717702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1044 | Open in IMG/M |
| 3300031890|Ga0306925_11203413 | Not Available | 759 | Open in IMG/M |
| 3300031896|Ga0318551_10301593 | Not Available | 901 | Open in IMG/M |
| 3300031910|Ga0306923_10096513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3332 | Open in IMG/M |
| 3300031910|Ga0306923_10131679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2845 | Open in IMG/M |
| 3300031910|Ga0306923_10421727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1516 | Open in IMG/M |
| 3300031910|Ga0306923_10446618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1467 | Open in IMG/M |
| 3300031910|Ga0306923_12032247 | Not Available | 582 | Open in IMG/M |
| 3300031912|Ga0306921_10403987 | Not Available | 1594 | Open in IMG/M |
| 3300031912|Ga0306921_11157845 | Not Available | 863 | Open in IMG/M |
| 3300031912|Ga0306921_11836937 | Not Available | 650 | Open in IMG/M |
| 3300031912|Ga0306921_12540659 | Not Available | 530 | Open in IMG/M |
| 3300031941|Ga0310912_10165324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1677 | Open in IMG/M |
| 3300031941|Ga0310912_10845918 | Not Available | 705 | Open in IMG/M |
| 3300031941|Ga0310912_10921252 | Not Available | 672 | Open in IMG/M |
| 3300031942|Ga0310916_10047148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3274 | Open in IMG/M |
| 3300031942|Ga0310916_10227603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1566 | Open in IMG/M |
| 3300031942|Ga0310916_10922426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300031942|Ga0310916_10931230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 727 | Open in IMG/M |
| 3300031947|Ga0310909_10500734 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300031947|Ga0310909_10979597 | Not Available | 691 | Open in IMG/M |
| 3300031947|Ga0310909_11030488 | Not Available | 671 | Open in IMG/M |
| 3300031954|Ga0306926_10015690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8564 | Open in IMG/M |
| 3300031954|Ga0306926_10480280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1529 | Open in IMG/M |
| 3300031954|Ga0306926_11710948 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300031959|Ga0318530_10013359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2681 | Open in IMG/M |
| 3300032001|Ga0306922_11212878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300032001|Ga0306922_11436017 | Not Available | 692 | Open in IMG/M |
| 3300032035|Ga0310911_10400045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 794 | Open in IMG/M |
| 3300032035|Ga0310911_10725175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300032035|Ga0310911_10817668 | Not Available | 538 | Open in IMG/M |
| 3300032059|Ga0318533_10144293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1681 | Open in IMG/M |
| 3300032059|Ga0318533_10296394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1173 | Open in IMG/M |
| 3300032076|Ga0306924_10248358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2043 | Open in IMG/M |
| 3300032076|Ga0306924_11481437 | Not Available | 720 | Open in IMG/M |
| 3300032076|Ga0306924_11861985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d | 625 | Open in IMG/M |
| 3300032076|Ga0306924_12627762 | Not Available | 502 | Open in IMG/M |
| 3300032180|Ga0307471_100429655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1456 | Open in IMG/M |
| 3300032205|Ga0307472_102205799 | Not Available | 556 | Open in IMG/M |
| 3300032261|Ga0306920_101262228 | Not Available | 1064 | Open in IMG/M |
| 3300032261|Ga0306920_101317254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1038 | Open in IMG/M |
| 3300033289|Ga0310914_10817450 | Not Available | 830 | Open in IMG/M |
| 3300033290|Ga0318519_10917989 | Not Available | 541 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 22.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 20.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.41% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.62% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.31% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.31% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.31% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.31% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.31% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.31% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300030986 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03470200 | 2088090014 | Soil | MRRRGNAKMLAWIIAVVLAIGLIWSVAAMSNLVPVVDSGSAAISRPAE |
| INPgaii200_08401641 | 2228664022 | Soil | RQVQRDMEGMQMRALTLGIAVVVAIGLIWSVAVMSNLVPLDGSEVTLAAVSRPAD |
| NODE_06044452 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MLAWIIAVVVAIGLIWSVAAMSNLLPVDGSDSAAISRPAE* |
| AP72_2010_repI_A01DRAFT_10173733 | 3300000579 | Forest Soil | MRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE* |
| AP72_2010_repI_A01DRAFT_10584533 | 3300000579 | Forest Soil | VNYLTLARRKNPYRQAQRDAEGMPMLAWIIAIIVAIGLIWSVAAMSNLLPMDGSDSAATSQPAK* |
| AF_2010_repII_A1DRAFT_100224165 | 3300000597 | Forest Soil | MRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASIS |
| AF_2010_repII_A1DRAFT_100330541 | 3300000597 | Forest Soil | MQIVGWIIAVVVAIGLIWSVAAMSNLLPVDGSISAAISRPAK* |
| AF_2010_repII_A1DRAFT_100435553 | 3300000597 | Forest Soil | MRAWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASIS |
| AP72_2010_repI_A001DRAFT_10254492 | 3300000893 | Forest Soil | MQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE* |
| JGI1027J12803_1005831392 | 3300000955 | Soil | MEGMQMRALTLGIAVVVAIGLIWSVAVMSNLVPLDGSEVTLAAVSRPAD* |
| JGI1027J12803_1057341222 | 3300000955 | Soil | AKNMRAPIRQAQREAEGMQMRAWMVGMAVVVAIGLIWSVAAMSKLVPVDGSEMSLAGTSRPAE* |
| Ga0066396_100142412 | 3300004267 | Tropical Forest Soil | AWIIGIVVAIGLIWSVAAMSNLVPVVADLDSAAISRPAG* |
| Ga0066398_100081441 | 3300004268 | Tropical Forest Soil | MLAWIIAVVVAIGLMWSVAAMSNLVPVVADSDSTGISQPAE* |
| Ga0066395_101509131 | 3300004633 | Tropical Forest Soil | MLARIAAIGIAVVVTIGLIWSVAAMSNLVPVVADSDSAAIAP* |
| Ga0066395_102036971 | 3300004633 | Tropical Forest Soil | MVAWIIAVVVAIGLIWSVAAMSNLLPVDGSDSAAISQPAE* |
| Ga0066671_100441302 | 3300005184 | Soil | MLAWIMAVVVAIGLIWSVAAMSNLVPVVDSGSAPLSGPAE* |
| Ga0066675_107460791 | 3300005187 | Soil | MKGPYRQAQRDMEGMQMRGWMLGIAVIVAVGLIWSVAVMSNLVPLDGSEVTLAAVSRPAE |
| Ga0066388_1001730832 | 3300005332 | Tropical Forest Soil | MDAWMVRITIAVVAMGLIWSVAAMSNLLPMDGSEVSLAGISRPAE* |
| Ga0066388_1002506511 | 3300005332 | Tropical Forest Soil | MLAWIIAVVVAIGLIWSVAAMSNLLPVDGSDSAAISQPAE* |
| Ga0066388_1002569942 | 3300005332 | Tropical Forest Soil | MHMLAWIIAVVVAIGLIWSVAAMSNLLPVDGSDSAAISQPAE* |
| Ga0066388_1002683081 | 3300005332 | Tropical Forest Soil | MRGLRLGIITVVLIGLIWSVAVMFNLVPLDGSEVTLAAVSRPAE* |
| Ga0066388_1003019031 | 3300005332 | Tropical Forest Soil | MQMRACMLGITVVVTIGLMWSVAAMSNLVPVDGSDSAAITRPAG* |
| Ga0066388_1003056151 | 3300005332 | Tropical Forest Soil | MLAWIIAVVVAIGLIWSFAAMSNLVPVDGSDAAAISRPAE* |
| Ga0066388_1004232112 | 3300005332 | Tropical Forest Soil | MLAWIMAVVVTIGLIWSVAAMSNLVPVVDSGSATIAGPAE* |
| Ga0066388_1006269804 | 3300005332 | Tropical Forest Soil | MRTPRQAQRDVEGMQMLAWIIAVVVAIGLIWSVAAMSNLLPVDGLVSAISRPAE* |
| Ga0066388_1009060383 | 3300005332 | Tropical Forest Soil | MRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISRPAE* |
| Ga0066388_1013744662 | 3300005332 | Tropical Forest Soil | MQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVNGSEMSLAGVSRPVE* |
| Ga0066388_1016137471 | 3300005332 | Tropical Forest Soil | MPMLAWIIGVVVAIGLTWSVAAMSNLVPVVADSDSTAISQPA |
| Ga0066388_1018263061 | 3300005332 | Tropical Forest Soil | MQMRVLMVGIAVVITIGLIWSVAAMSDLVPVVSDSVAIEAR* |
| Ga0066388_1019181512 | 3300005332 | Tropical Forest Soil | MLAWIIGVVVAIGLIWSVAAMSELVPIVADLDSTAISQPAG* |
| Ga0066388_1027755181 | 3300005332 | Tropical Forest Soil | MRAWIVGIAVVVAIGLIWSFASMSNLVPVDGSEMSLAGISRPAE* |
| Ga0066388_1038848372 | 3300005332 | Tropical Forest Soil | MRAWIMGIAVVVAIGLIWSIAAMSNLVPVDGSEMSLAGISRPAE* |
| Ga0066388_1039812143 | 3300005332 | Tropical Forest Soil | MHMRSISIAIAMVVAIGLIWSVAVMSKLVPVDGSEMALAGTSRPAQ* |
| Ga0066388_1049745932 | 3300005332 | Tropical Forest Soil | PYRQAQRDVEGMQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE* |
| Ga0066388_1050303012 | 3300005332 | Tropical Forest Soil | MGAWMVRITVAVVAIGLIWSVAVMSNLVPMDGSEVSLAAISQPAE* |
| Ga0066388_1056067111 | 3300005332 | Tropical Forest Soil | MVAWIIAVVVAIGLIWSVAVMSNLLPVDGSISAAISRPAK* |
| Ga0066388_1060557752 | 3300005332 | Tropical Forest Soil | MQRGKQMRAGMMAMTAVVAIGLIWSVAVMSKLVPVDGSEMRLAGTSRPAE* |
| Ga0066388_1060973201 | 3300005332 | Tropical Forest Soil | MQMWMVGVTVVVAIGLIWSIAAMSNLVPVDGSGSAAISQPAE* |
| Ga0066388_1074703731 | 3300005332 | Tropical Forest Soil | IEGMQMRAWMVGIAIVVAIGLIWSVAVMSDLIPVDGSQMSLAGISRPAD* |
| Ga0066388_1075771491 | 3300005332 | Tropical Forest Soil | MDVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLARISRPAE* |
| Ga0066388_1079495621 | 3300005332 | Tropical Forest Soil | MQMRACMLGITVVVTIGLMWSVAAMSNLVPVDGSDSAAITRPVE* |
| Ga0008090_157439442 | 3300005363 | Tropical Rainforest Soil | MCEPLSASSTRVEGIQMRAWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLVSISPPAE |
| Ga0070709_100062792 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAWIIAVVLAIGLIWSVAAMSNLVPVVDSGSAAISRPAE* |
| Ga0070709_107974172 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRALTLGIAVVVAIGLIWSVAVMSGLVPVVGSDVTLAAMSRPAE* |
| Ga0070714_1003833852 | 3300005435 | Agricultural Soil | MRALTLGIAVVAAIGLIWSVAVMSNLVPLVGSEVTLAAVSRPAE* |
| Ga0070713_1008763601 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWMVGIAVVVAIGLIWSVAAMSNLVPVDGSEMSLAAISRPAE* |
| Ga0070710_100718654 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRALTLGIAVVVAIGLIWSVAVMSDLVPVVGSDVTLAAMSRPAE* |
| Ga0070708_1021668872 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVWVMGIAVVVAIGLIWSVAVMFNLVPVDGSEMSLASISRPAE* |
| Ga0070706_1003095251 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MQMRAWMVGIAVVVAIGLIWSVAAMSNLVPVDGSEMSLAAISRPAE* |
| Ga0070698_1000634486 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQMRVWVMGIAVVVAIGLIWSVAVMFNLVPVDGSEMSLASISRPAE* |
| Ga0070696_1017118931 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGMQMRALTLGIAVVVAIGLIWSVAVMSDLVPVVGSDMTLAAMSRPAE* |
| Ga0066707_108299961 | 3300005556 | Soil | MRAWIVGIAVVVAIGLIWSVAAMSNLVPVDGSEMSLAAISRPAE* |
| Ga0066670_102084503 | 3300005560 | Soil | AKDRQAQPDVEGMQMLAWIMAVVVAIGLIWSVAAMSNLVPVVDSGSAPLSGPAE* |
| Ga0066670_103158022 | 3300005560 | Soil | MEGMQMRGWMLGIAVIVAVGLIWSVAVMSNLVPLDGSEVTLAAVSRPAE* |
| Ga0066654_105831122 | 3300005587 | Soil | MAVVVAIGLIWSVAAMSNLVPVVDSGSAPLSGPAE* |
| Ga0066905_1000531973 | 3300005713 | Tropical Forest Soil | MRSISVAIAMVVAIGLIWSVAVMSKVVPVDGSEMRLAGTSRPAQ* |
| Ga0066905_1002497951 | 3300005713 | Tropical Forest Soil | MRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRP |
| Ga0066905_1003065021 | 3300005713 | Tropical Forest Soil | MLAWIIGVVVAIGLVWSVAAMSNLVPVVDDSHSAAISQPAK* |
| Ga0066905_1005030332 | 3300005713 | Tropical Forest Soil | MRACMVVGIAVVVAIGLMWSVAAMSNLVPVVVDGSGSISRSAE* |
| Ga0066905_1014743652 | 3300005713 | Tropical Forest Soil | MVGMAVVVAVGLIWSVAAMSKWVPVQSAEMGLAATSRAAE* |
| Ga0066905_1015294241 | 3300005713 | Tropical Forest Soil | VGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE* |
| Ga0066905_1016891162 | 3300005713 | Tropical Forest Soil | GMQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLASISRPAE* |
| Ga0066905_1017015162 | 3300005713 | Tropical Forest Soil | MRAWMVGIAVVVGIGLIWSVAVMSNLVPVDGSEMSLAGISRPAE* |
| Ga0066905_1017079312 | 3300005713 | Tropical Forest Soil | VVAIGLIWSVAAMSNLVPVVDGDSNSAAISQPAE* |
| Ga0066905_1022740652 | 3300005713 | Tropical Forest Soil | RDVEGMQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE* |
| Ga0066905_1023153073 | 3300005713 | Tropical Forest Soil | AWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPTE* |
| Ga0066903_1005035742 | 3300005764 | Tropical Forest Soil | MCDALSASSTRVEGMQMRAWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISRPAE |
| Ga0066903_1009794581 | 3300005764 | Tropical Forest Soil | MRAGVVGIAVGVAIGLIWSFAAMSNLVPVDGSETSVAGISRP |
| Ga0066903_1010050913 | 3300005764 | Tropical Forest Soil | MRAWIVGIAVVVASGLIWSFAVMSNFVPVDGSGMSLAGISRPAEQLATG* |
| Ga0066903_1013910532 | 3300005764 | Tropical Forest Soil | MVAWIIAVVVAIGLIWSVAAMSNLLPVDGSISAAISRPAK* |
| Ga0066903_1023824353 | 3300005764 | Tropical Forest Soil | MRAWMVGMAVVVAVGLIWSVAAMSKWVPVQSAEMG |
| Ga0066903_1026535442 | 3300005764 | Tropical Forest Soil | MQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGVSRPVE* |
| Ga0066903_1026760462 | 3300005764 | Tropical Forest Soil | MRAWMVGIAVVVAIGLIWSFAVMSNLVPVDGSGMSLAGISRPAE* |
| Ga0066903_1037465831 | 3300005764 | Tropical Forest Soil | MRPPLGKLNADVEGMQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0066903_1037750033 | 3300005764 | Tropical Forest Soil | MQMLAWIIAVVVAIGLMWSVAAMSNLVPVVDDSHSAAISQPAE* |
| Ga0066903_1038094063 | 3300005764 | Tropical Forest Soil | MHMRSISIAIAMVVAVGLIWSVAVMSKLVPVDGSEMALAGTSRPAQ* |
| Ga0066903_1039701664 | 3300005764 | Tropical Forest Soil | GMHMRSISIAIAMVVAIGLIWSVAAMSKLVPLDGSEMRLAGTSRPAE* |
| Ga0066903_1045490132 | 3300005764 | Tropical Forest Soil | MCDALLASSTRVEGLQMRAWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLTSISQPAE |
| Ga0066903_1047070901 | 3300005764 | Tropical Forest Soil | RDVEGMQMRAWVVGIAVVVAIGLIWSFAVMSNFVPVDGSEMSLAGISRPAE* |
| Ga0066903_1048939761 | 3300005764 | Tropical Forest Soil | VRAWMAGIIAVVVTIGLIWSVAAMSNLIPVVSSNSDAIS |
| Ga0066903_1052606772 | 3300005764 | Tropical Forest Soil | MQMRVWMVGIAVVVAIGLIWSFAAMSDLVPVGSGMSLAGISRPAE* |
| Ga0066903_1054435902 | 3300005764 | Tropical Forest Soil | MHAWMGIAVVVAIGLIWSVAAMSKLVPVDGSEMRLAGTSQPAQ* |
| Ga0066903_1070107901 | 3300005764 | Tropical Forest Soil | MRSISIAIAMVVTIGLIWSVAVMSKLVPVDGSEMALAGTSRPAQ* |
| Ga0066903_1079251601 | 3300005764 | Tropical Forest Soil | MHMRSISIAIAMVVAIGLIWSVAAMSKLVPVDGSEMALAGTSRPAQ* |
| Ga0066903_1082043282 | 3300005764 | Tropical Forest Soil | MQMVAWIIAGVVTIGLIWSVAVMSNLLPVDGSISAAISRPAK* |
| Ga0066903_1082332621 | 3300005764 | Tropical Forest Soil | MQMRGCMVGIAVVVTIGLMWSVAAMANLVPIDGSVSAEILRPAE* |
| Ga0066903_1085522132 | 3300005764 | Tropical Forest Soil | YRQAQRDVEGMQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE* |
| Ga0066903_1087185631 | 3300005764 | Tropical Forest Soil | MRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPA |
| Ga0066903_1091435241 | 3300005764 | Tropical Forest Soil | MRALMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMS |
| Ga0068858_1014125513 | 3300005842 | Switchgrass Rhizosphere | MQLRAWIGIAVVVGIGLTWSVAAMSKLVPVDGSEMR |
| Ga0081455_100117826 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MWMVGIAVVVAIGLIWSIATMSNLVPVDGSASAAISQPAD* |
| Ga0081455_100178284 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MQMRASMGIAVVVAIGLIWSVAVMSKLVPVDGSEMRLAGTSRPVE* |
| Ga0081455_100310272 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MHMRSTSIAIAIVVGVGLIWSVAAMTKLVPVDGSEMSSAAISRPAE* |
| Ga0081455_100403184 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRAWIVAIAVVVAIGLIWSVAAMSNLVPVDGSDSAAISRSAE* |
| Ga0081455_100973615 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRSISIAIAMVVAIGLIWSVAVMSKLVPVDGSEMALAGTSRPAQ* |
| Ga0081455_101135781 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRSASIAIAIVVAIGLIWSVAAMSKLVPVDGSEMRLAGTSRPAQ* |
| Ga0081538_101313781 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MRTPYQQAQRDVEGMQMRAWMPAGIAVVVAIGLIWSVAAMSNLVPLDGSDSAAISRPAE* |
| Ga0081540_10037042 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MLAWIMAVVVAIGLIWSVAAMSNLVPMVASEQAAMLRPAE* |
| Ga0070717_100611774 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRALTLGIAVVVAIGLIWSVAVMSDLVPVVGSDMTLAAMSRPAE* |
| Ga0075365_101971143 | 3300006038 | Populus Endosphere | MRAGIVGITVVAIGLIWSVAVMSKLVPVDGSELRSAEISQPAE* |
| Ga0066652_1003519561 | 3300006046 | Soil | MRGWMLGIAVIVAVGLIWSVAVMSNLVPLDGSEVTLAAVSRPA |
| Ga0075362_105403532 | 3300006177 | Populus Endosphere | AIVVAIGLIWSVAVMSKLVPVDGSEMSSAAISRPAE* |
| Ga0075428_1003607631 | 3300006844 | Populus Rhizosphere | AVVVAIGLIWSVAAMSKWVPVQSAEMRLAATSRAAE* |
| Ga0075428_1009217852 | 3300006844 | Populus Rhizosphere | MRALTLGIAVVVAIGLIWSVAVMSNLVPLDGSEVTLAAVSAPAE* |
| Ga0075428_1016623982 | 3300006844 | Populus Rhizosphere | MGIAVVAIGLIWSVAVMSKLVPVDGSEMRLAGIAAC* |
| Ga0075421_1007255803 | 3300006845 | Populus Rhizosphere | AQRDMEGMQMRALTLGIAVVVAIGLIWSVAVMSNLVPLDGSEVTLAAVSAPAE* |
| Ga0075431_1005599062 | 3300006847 | Populus Rhizosphere | MEGMQMRALTLGIAVVVAIGLIWSVAVMSNLVPLDGSEVTLAAVSAPAE* |
| Ga0075431_1006893184 | 3300006847 | Populus Rhizosphere | MQMRAWMVGMAVVVAIGLIWSVAAMSKLVPVDGSEM |
| Ga0075431_1020728052 | 3300006847 | Populus Rhizosphere | MRASMVGMAVVVAIGLIWSVAAMSKLVPVDGSEMVGGDIAA* |
| Ga0075424_1010697212 | 3300006904 | Populus Rhizosphere | MKGPRQAQRDMEGMQMRALTLGIAVVVAIGLIWSVAVMSDLVPVVGSDVTLAAMSRPAE* |
| Ga0111539_124929652 | 3300009094 | Populus Rhizosphere | MRAWMGIAVVAIGLIWSVAVMSKLIPVDGSEMRLAGTSRPAE* |
| Ga0075418_109138813 | 3300009100 | Populus Rhizosphere | MRAWIGIAVVVAIGLIWSVAAMSKWVPVQSAEMRLAATSRAAE* |
| Ga0126374_100592782 | 3300009792 | Tropical Forest Soil | MLAWIIGIVVAIGLIWSVAAMSNLVPVVADLDSAAISRPAG* |
| Ga0126374_105146991 | 3300009792 | Tropical Forest Soil | MRAWMVGIAVVVAIGLIWSFAAMSNLIPVDGSEMSLAGISRPAE* |
| Ga0126374_105904292 | 3300009792 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLFWSVAVMSNLVPVDGSE |
| Ga0126374_106009342 | 3300009792 | Tropical Forest Soil | MRAWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISPPAE* |
| Ga0126374_109025501 | 3300009792 | Tropical Forest Soil | MAGIGIAVVVTIGLMWSVAAMSNLVPVVDDSHSAAISQPAE* |
| Ga0126315_106560711 | 3300010038 | Serpentine Soil | MGALISPSSRGDAEEIQMRIGIGIAVVVAIGLIWSVAAMSNLVPLDGSDSAAISRPAE* |
| Ga0126380_101333653 | 3300010043 | Tropical Forest Soil | GMPMLAWIIGIVVAIGLIWSVAAMSNLVPVVADSDSTAISQPAE* |
| Ga0126380_102435303 | 3300010043 | Tropical Forest Soil | MRAWMVGMAVVVAVGLIWSVAAMSKWVPVQSAEMGLAATSRAAE* |
| Ga0126380_103569163 | 3300010043 | Tropical Forest Soil | MQMRAWMVGIAIVVAIGLIWSVAVMSDLIPVDGSQMSLAGTSRPAD* |
| Ga0126380_109865131 | 3300010043 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLASISRPAE* |
| Ga0126380_114800842 | 3300010043 | Tropical Forest Soil | MLAWIVAVVVAIGLIWSFAAMSNLVPVDGSDAAAISRPAE* |
| Ga0126384_1000131717 | 3300010046 | Tropical Forest Soil | MRACMLGITVVVTIGLMWSVAAMSNLVPVDGSDSAAITRPAG* |
| Ga0126384_103216592 | 3300010046 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSVAAMSNLVPVDGSEMSLASISRPAE* |
| Ga0126384_105262862 | 3300010046 | Tropical Forest Soil | MQMRAWMVGIAIVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE* |
| Ga0126384_105506611 | 3300010046 | Tropical Forest Soil | MRAWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMS |
| Ga0126384_105674641 | 3300010046 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSFAAMSKLVPVDGSGMSLAGISRPAE* |
| Ga0126384_110386441 | 3300010046 | Tropical Forest Soil | MHMLAWIIAVVVAIGLIWSVAAMSNLLPVDGSISAAISRPAK* |
| Ga0126384_112395752 | 3300010046 | Tropical Forest Soil | AWIIAVMVVIGLIWSVAAMSNLLPVDGSDSAAISRPAE* |
| Ga0126384_116766983 | 3300010046 | Tropical Forest Soil | MVGIAVVVGIGLIWSVAVMSKLVPVDGSEMALAGTSRPAQ* |
| Ga0126384_118141582 | 3300010046 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSIAAMSNLVPVDGSEMSLAGISRPAE* |
| Ga0126384_122346012 | 3300010046 | Tropical Forest Soil | MQMRAWMVGIAVVVGIGLIWSVAVMSNLVPVDGSEMSLAGISRPAE* |
| Ga0126382_101467663 | 3300010047 | Tropical Forest Soil | MQMRASIVGIAVVVVIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE* |
| Ga0126382_103455543 | 3300010047 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLA |
| Ga0126382_108468611 | 3300010047 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISPPAE* |
| Ga0126382_114742312 | 3300010047 | Tropical Forest Soil | MQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAG |
| Ga0126382_116210351 | 3300010047 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSVAAMSNLVPVDGSDSAAISRPAG* |
| Ga0126373_100568455 | 3300010048 | Tropical Forest Soil | MRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE* |
| Ga0126370_101680184 | 3300010358 | Tropical Forest Soil | MVAWIIAGVVTIGLIWSVAVMSNLLPVDGSISAAISRPAK* |
| Ga0126370_104002252 | 3300010358 | Tropical Forest Soil | MRAWMAGIIAVVVTIGLIWSVAAMSNLIPVVSSNSDAISRPAE* |
| Ga0126370_107628901 | 3300010358 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSE |
| Ga0126370_115704671 | 3300010358 | Tropical Forest Soil | MDVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISPPAE* |
| Ga0126370_117855051 | 3300010358 | Tropical Forest Soil | MHMRSISIAIAMVVAVGLIWSVAVMSKFVPVDGSEMALAGTSRPAQ* |
| Ga0126370_124586832 | 3300010358 | Tropical Forest Soil | MLARIATIGIAVVVTIGLIWSVAAMSNLVPVVADSDS |
| Ga0126376_103035334 | 3300010359 | Tropical Forest Soil | MRSISIAIAMVVAVGLIWSVAVMSKLVPVDGSEMALAGTSRPAQ* |
| Ga0126376_106980061 | 3300010359 | Tropical Forest Soil | MQMWMVGTAVEVAIGLIWSIAAMSTLVPVDGSGPAAISQPAE* |
| Ga0126376_117590392 | 3300010359 | Tropical Forest Soil | MQMRAWIVGIAVVVAIGLIWSFASMSNLVPVDGSEMSLAGISRPAE |
| Ga0126376_127703712 | 3300010359 | Tropical Forest Soil | MRAWMGITVVVAIGLIWSVAVMSKLVPVDGSEMRLAGTSRPAE* |
| Ga0126372_100052971 | 3300010360 | Tropical Forest Soil | MLAWIIGIVVAIGLIWSVAAMSNLVPVVADSDSTAISQPAE* |
| Ga0126372_100079739 | 3300010360 | Tropical Forest Soil | GIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE* |
| Ga0126372_107854941 | 3300010360 | Tropical Forest Soil | MQMLARIAAIGIAVVVTIGLIWSVAAMSNLVPVVDSGSATISGPAE* |
| Ga0126372_111178502 | 3300010360 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLFWSVAVMSNLVPVDGSEMSLAGISRPAE* |
| Ga0126378_105244684 | 3300010361 | Tropical Forest Soil | MRAWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLVSISPPAE* |
| Ga0126378_108642502 | 3300010361 | Tropical Forest Soil | MQMWMVGVTVVVAIGLIWSIAAMSKVPVDGWGSAAISQPAE* |
| Ga0126378_124975511 | 3300010361 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSVAAMSNLLPVDGSDSAAISQPAE* |
| Ga0126377_100060543 | 3300010362 | Tropical Forest Soil | MLAWIIGIVVAIGLIWSVAAMSNLAPVVADSDSTAISQPAE* |
| Ga0126377_107978822 | 3300010362 | Tropical Forest Soil | MQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAEISRPAE* |
| Ga0126377_127834841 | 3300010362 | Tropical Forest Soil | PLFPQAQRDAEGMQMRAWMVGIAIVVAIGLIWSVAAMSKLVPVDGSEMTSAVISHPAE* |
| Ga0126379_101353113 | 3300010366 | Tropical Forest Soil | MRAWMGIAVVVAMGLIWSVAVMSKLVPVDGSEMRLAGTSRPAQ* |
| Ga0126379_110473751 | 3300010366 | Tropical Forest Soil | AVVVAIGLIWSVAVMSNLVPVDGSEMSLARISRPAE* |
| Ga0126379_119471612 | 3300010366 | Tropical Forest Soil | MQMLAWIIAVVVAIGLIWSVAAMSNLVPVVDDSASAAISRPAE* |
| Ga0134125_122653541 | 3300010371 | Terrestrial Soil | MRALTLGIAVVVAIGLIWSVAVMSNLVPLVGSEVTLAAVSRPAE* |
| Ga0126381_1003120213 | 3300010376 | Tropical Forest Soil | MDVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLAGISRPAE* |
| Ga0126381_1009548272 | 3300010376 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISRPAE* |
| Ga0126381_1021426691 | 3300010376 | Tropical Forest Soil | MRAWMVGIAIVVAIGLIWSVDVMSNLVPVDGSQMSLAGISRPAE* |
| Ga0126381_1024364081 | 3300010376 | Tropical Forest Soil | VKKYASPYQQAQRDVEGMQMRAWVVGIAIVVAIGLIWSFAAMSNLVPVDGSETSVAGIPAE* |
| Ga0126381_1028946921 | 3300010376 | Tropical Forest Soil | LGGEKICKPLSASSTRREGMQMWMVGIAVVVAVGLIWSIAAMSNLVPVDGSGPAAISQPAE* |
| Ga0126381_1036955431 | 3300010376 | Tropical Forest Soil | EGMQMRAWMVGIAVVVAIGLIWSFAAMSNLIPVDGSEMSLAGISRPAE* |
| Ga0126383_107003673 | 3300010398 | Tropical Forest Soil | AWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISPPAE* |
| Ga0126383_115792401 | 3300010398 | Tropical Forest Soil | RDVEGMQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGPEMSLAGISRPAE* |
| Ga0126383_135193302 | 3300010398 | Tropical Forest Soil | MQMLARIAAIGIAVVVTIGLIWSVAAMSNLVPVVADS |
| Ga0124850_10109786 | 3300010863 | Tropical Forest Soil | MQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISR |
| Ga0124850_11097461 | 3300010863 | Tropical Forest Soil | MQMRAWIVGIAVVVAIGLIVAIGLIWSFAVMSNLVPVDGSGMSLAGISRPAE* |
| Ga0137374_102222292 | 3300012204 | Vadose Zone Soil | MQMRAWMMGIAVVVAIGLIWSVAAMSNLVPVDGSDSAAISRPAEPGDQLGL* |
| Ga0137362_111199042 | 3300012205 | Vadose Zone Soil | CASPYRQAQRDVEGMQMRGWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLAAISRPAE |
| Ga0137377_106948483 | 3300012211 | Vadose Zone Soil | MRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLAAISRPAE* |
| Ga0137372_102504501 | 3300012350 | Vadose Zone Soil | VNPIGKLNVEGMQMRALMVGIAVVVAIGLTWSVAAMSNLVPVDGSDSAAIARPAE* |
| Ga0150984_1083338181 | 3300012469 | Avena Fatua Rhizosphere | MRAWMVGMAVVVAIGLIWSVAAMSKLVPLDGSEMKSAAISSHAIAV |
| Ga0126375_102566512 | 3300012948 | Tropical Forest Soil | MQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE* |
| Ga0164299_101770791 | 3300012958 | Soil | EPYFVNSTRRKGMHMRAGIGIAVVVAIGLIWSVAVMSKLVPVDGSEMSLAAISRPAE* |
| Ga0164299_115910351 | 3300012958 | Soil | MQMRIGIIGLVIVIAIGLIWSVAAMTNLVPLDGSDSAVISQPAQ* |
| Ga0164302_100974253 | 3300012961 | Soil | MRRIGSIGFAALVALGLLWSAAATYKLVPVDGSEMSLAAISRPAE* |
| Ga0126369_100144516 | 3300012971 | Tropical Forest Soil | MQMLARIAAIGIAVVVTIGLIWSVAAMSNLVPVVADSDSAAIAP* |
| Ga0126369_103044831 | 3300012971 | Tropical Forest Soil | IGIAVVVTIGLIWSVAAMSNLVPVVAHSDSAAIAP* |
| Ga0126369_104087322 | 3300012971 | Tropical Forest Soil | MRAWMVGIAVVVAIGLIWSVAAMSNLVPVDGSAC* |
| Ga0126369_104846521 | 3300012971 | Tropical Forest Soil | MRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAA* |
| Ga0126369_105052392 | 3300012971 | Tropical Forest Soil | MRAWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLTSISQPAE* |
| Ga0126369_119855642 | 3300012971 | Tropical Forest Soil | MQMRAWMGIAAVVAIGLIWSFAAMSNLVPVDGSEMSLASISRPAE* |
| Ga0126369_120799382 | 3300012971 | Tropical Forest Soil | AVVVAIGLIWSFAAMSNLVPVDGSEMSLAGVSRPVE* |
| Ga0126369_122019691 | 3300012971 | Tropical Forest Soil | KKYASPYRQAQRDVEGMQMRAWIVGIAVVVAIGLIWSFAVMSDLVPVDGSGMSLAGISRPAE* |
| Ga0163162_115808181 | 3300013306 | Switchgrass Rhizosphere | AWTVGIAVVVAVGLIWSVAAMSNLVPVVGSDVTLASISRP* |
| Ga0134075_104723131 | 3300014154 | Grasslands Soil | HRASDDPPYWQAQRDVEGMQMLAWIIAVVVAIGLIWSVAAMSNLIPVVDGSDSAPISRPAE* |
| Ga0132258_122724822 | 3300015371 | Arabidopsis Rhizosphere | MRAWMGITVVVAIGLIWSVAVMSKLVPLDGSEMRLAATSRPAE* |
| Ga0132256_1028788801 | 3300015372 | Arabidopsis Rhizosphere | MQMRAWMGIAVVVAIGLIWSVAVMSKLVPVDGSEMTLAGTSRPAQ* |
| Ga0182036_100613754 | 3300016270 | Soil | MRAWMVGIAAVVAIGLIWSVAVMSNLVPVDGSEMSLASISPPAE |
| Ga0182041_107528542 | 3300016294 | Soil | VAIAVVVAIGLIWSFAAMSNLVPVDGSEMSLASISRPAE |
| Ga0182033_117039032 | 3300016319 | Soil | GIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISRPAE |
| Ga0182032_104234341 | 3300016357 | Soil | MRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLA |
| Ga0182032_104503173 | 3300016357 | Soil | GMQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0182034_112204382 | 3300016371 | Soil | MRAWVVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSL |
| Ga0182034_113847662 | 3300016371 | Soil | GIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0182040_109234982 | 3300016387 | Soil | MRAWVVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRP |
| Ga0182037_114298631 | 3300016404 | Soil | WMVAIAVVVAIGLIWSFAAMSNLVPVDGSEMSLASISRPAE |
| Ga0182039_100481165 | 3300016422 | Soil | MVAWIIAGVVAIGLIWSVAVMSNLLPVDGSISAAISRPAK |
| Ga0182039_107460201 | 3300016422 | Soil | MRAPRQAQRDVEGMQMRAWIVGIAAVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE |
| Ga0182039_109732221 | 3300016422 | Soil | GMQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSGMTLAGISRPAE |
| Ga0182039_118272341 | 3300016422 | Soil | MRAWVVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPA |
| Ga0182038_105100891 | 3300016445 | Soil | MRAWVVGIAVVVAIGLIWSFAVMSNFVPVDGSGMSLAG |
| Ga0182038_106360701 | 3300016445 | Soil | GKHDVEGMQVRAWMAGIIAVVVTIGLIWSVAAMSNLIPVVSSNSDAISRPAE |
| Ga0182038_111076731 | 3300016445 | Soil | MHAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSL |
| Ga0066667_112022151 | 3300018433 | Grasslands Soil | MRAWIGIAVGLIWTVAAMSNVVPVDGSEMSLASISRPA |
| Ga0066662_102057611 | 3300018468 | Grasslands Soil | MQMRAWIGIAVGLIWTVAAMSNLVPVDGSEMSLASISRPAE |
| Ga0066669_102429751 | 3300018482 | Grasslands Soil | MRALSVGIAVVIAIGLIWSVAVMSNLVPVDGSEVSLAAISPPAE |
| Ga0210403_108822812 | 3300020580 | Soil | MKGPYRQAQRDMEGMQMRALTLGIAVVVAIGLIWSVAVMSNLVPLDGSEVTLAAVSRPAD |
| Ga0210406_112995481 | 3300021168 | Soil | QRDVEGMQMRAWMVAIAVVVAIGLIWSFAAMSNLVPVDGSEMSLASISRPAE |
| Ga0210408_113059502 | 3300021178 | Soil | MRALTLGIAVVVAIGLIWSVAVMSNLVPLDGSEVTLAAVS |
| Ga0187846_101181212 | 3300021476 | Biofilm | WIIAGVVAIGLIWSVAVMSNLLPVDGSISAAISRPAK |
| Ga0126371_102179882 | 3300021560 | Tropical Forest Soil | MVAWIIAVVVAIGLIWSVAVMSNLLPVDGSISAAISRPAK |
| Ga0126371_105078082 | 3300021560 | Tropical Forest Soil | MQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0126371_110086231 | 3300021560 | Tropical Forest Soil | IAVVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE |
| Ga0126371_112793901 | 3300021560 | Tropical Forest Soil | VNYLTLARRKNPYRQAQRDAEGMPMLAWIIAIIVAIGLIWSVAAMSNLLPMDGSDSAATSQPAK |
| Ga0126371_123856421 | 3300021560 | Tropical Forest Soil | QAQRDVEGMQMRAWVVGIAIVVAIGLIWSFAAMSNLVPVDGSETSVAGISRPAESLATG |
| Ga0126371_130138651 | 3300021560 | Tropical Forest Soil | VEGIQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0126371_135508741 | 3300021560 | Tropical Forest Soil | MHMLAWIIAVVVVIGLIWSVAAMSNLLPVDGSDSAAISRPAE |
| Ga0207699_105093932 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGMQMRALTLGIAVVVAIGLIWSVAVMSDLVPVVGSDMTLAAMSRPAE |
| Ga0207684_101027532 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVWVMGIAVVVAIGLIWSVAVMFNLVPVDGSEMSLASISRPAE |
| Ga0207663_117235202 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RDMEGMQMRALTLGIAVVVAIGLIWSVAVMSDLVPVVGSDVTLAAMSRPAE |
| Ga0207700_100043351 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GIAVVVAIGLIWSVAAMSNLVPVDGSEMSLAAISRPAE |
| Ga0207664_102900331 | 3300025929 | Agricultural Soil | MRALTLGIAVVVAIGLIWSVAVMSNLVPLVGSEVTLAAVSRPAE |
| Ga0209465_101024773 | 3300027874 | Tropical Forest Soil | MRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0209465_101550594 | 3300027874 | Tropical Forest Soil | MLARIAAIGIAVVVTIGLIWSVAAMSNLVPVVADSDSAAIAP |
| Ga0209382_103183595 | 3300027909 | Populus Rhizosphere | WMVGMAVVVAIGLIWSVAAMSKLVPVDGSEMSLAGTSRPAE |
| Ga0209526_100900453 | 3300028047 | Forest Soil | MCESLSASSTRVEGMQMRAWIVGIAVVVAIGLIWSVAVMANLVPVDGSEMSLASISRPAE |
| Ga0307280_103153951 | 3300028768 | Soil | DAEATQMLAWIMAVVVAIGLIWSVAAMSNLVPVVDSDLAAISRPAE |
| Ga0308154_1124201 | 3300030986 | Soil | KMRRIGSIGFAALVALGLLWSAAATSKLVPVDGSEMSLAAISRPAE |
| Ga0308194_101355201 | 3300031421 | Soil | QMLAWIMAVVVAIGLIWSVAAMSNLVPVVDSDLAATSRPAE |
| Ga0318516_100436922 | 3300031543 | Soil | MCEPLSASSTRVEGIQMRAWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISPPAE |
| Ga0318516_101246592 | 3300031543 | Soil | MQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318516_107109641 | 3300031543 | Soil | MQMRAWVVGIAVVVAIGLIWSFAVMSNFVPVDGSGMSLAGISRPAE |
| Ga0318541_1000506911 | 3300031545 | Soil | MRAWVVGIAVVVAIGLIWSFAVMSNFVPVDGSGMSLAGISRPAE |
| Ga0318541_100189564 | 3300031545 | Soil | MRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318528_101030712 | 3300031561 | Soil | MHMLAWIIAVVVAIGLIWSVAAMSNLLPVDGSDSAAISRPAE |
| Ga0318528_102050422 | 3300031561 | Soil | MVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0310915_100127782 | 3300031573 | Soil | MLAWIIAVVVAIGLIWSVAAMSNLLPVDGSDSAAISRPAE |
| Ga0310915_101499693 | 3300031573 | Soil | MQMVAWIIAVVVAIGLIWSVAVMSNLLPVDGSISAAISRPAK |
| Ga0310915_103903601 | 3300031573 | Soil | MRAWVVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0310915_107212891 | 3300031573 | Soil | MRAWIVGIAAVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE |
| Ga0310915_107893731 | 3300031573 | Soil | GRRKYASPYRQAQRDVEAMQMRAWMVGIALVVAISLIWSIAAVSNLVPVDGSEMSLAGISRPAE |
| Ga0310915_108080712 | 3300031573 | Soil | MQMHAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0310915_109437672 | 3300031573 | Soil | MVAWIIAGVVTIGLIWSVAVMSNLLPVDGSISAAISRPAK |
| Ga0310915_110951731 | 3300031573 | Soil | WMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318555_105936811 | 3300031640 | Soil | YRKAQRDVEGMHMLAWIIAVVVAIGLIWSVAGMSNLLPVDGSDSAAISRPAE |
| Ga0318574_105545372 | 3300031680 | Soil | VGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318496_105136082 | 3300031713 | Soil | VGAAKKYASPYRQAQRDIEGMQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0306917_100805653 | 3300031719 | Soil | WIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0306917_104535312 | 3300031719 | Soil | MCEPYRQAQRDVEGMQMRAWMVAIAVVVAIGLIWSFAAMSNLVPVDGSEMSLASISRPAE |
| Ga0306917_111635541 | 3300031719 | Soil | MVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISRPAE |
| Ga0318501_103573022 | 3300031736 | Soil | VVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0307468_1002916262 | 3300031740 | Hardwood Forest Soil | MRAWMGIAVVAIGLIWSVAVMSKLIPVDGSEMRLAGTSRPAE |
| Ga0318492_103825841 | 3300031748 | Soil | MHMLAWIIAVVVAIGLIWSVAGMSNLLPVDGSDSAAISRPAE |
| Ga0318494_104509431 | 3300031751 | Soil | IEAMQMRAWMVGIAVVVAIGLIWSIAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318535_102307412 | 3300031764 | Soil | MRAWIVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISPPAE |
| Ga0318554_101938381 | 3300031765 | Soil | VEGMQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGPEMSLAGISRPAE |
| Ga0318554_106050752 | 3300031765 | Soil | GMQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318521_100169667 | 3300031770 | Soil | ASPYRQAQRDVEGMQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318521_100778614 | 3300031770 | Soil | MQMRAWMVGIAIVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318521_106455472 | 3300031770 | Soil | MRAWVVGIAVVVAIGLIWSFAVMSNFVPVDGSGMSLAGI |
| Ga0318508_10544362 | 3300031780 | Soil | AVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318547_107816451 | 3300031781 | Soil | MVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISQPAE |
| Ga0318548_103894582 | 3300031793 | Soil | MQMRAWIVGIAVVVAIGLIWSFAVMSNFVPVDGSGMSLAGISRPAE |
| Ga0318523_102193141 | 3300031798 | Soil | IAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318568_106574981 | 3300031819 | Soil | MQMRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISPPAE |
| Ga0318567_104208221 | 3300031821 | Soil | QQPRPPDREAQRDTEGMQMVAWIIAVVVAIGLIWSVAVMSNLLPVDGSISAAISRPAK |
| Ga0310917_105924022 | 3300031833 | Soil | MRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISRP |
| Ga0310917_108892511 | 3300031833 | Soil | MRAWVVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAG |
| Ga0318512_100085651 | 3300031846 | Soil | RRGMQMRAWVVGIAVVVAIGLIWSFAVMSNFVPVDGSGMSLAGISRPAE |
| Ga0306919_100807224 | 3300031879 | Soil | KKYASPYRQAQLDVEGMQMRAWVVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0306925_101031016 | 3300031890 | Soil | MRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLAAISRPAE |
| Ga0306925_102679111 | 3300031890 | Soil | MRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLAGISRPAE |
| Ga0306925_107177023 | 3300031890 | Soil | VKKYASPYRQAQLDVEGMQMRAWVVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0306925_112034131 | 3300031890 | Soil | MRAWMVAIAVVVAIGLIWSFAAMSNLVPVDGSEMSL |
| Ga0318551_103015933 | 3300031896 | Soil | MRAWVVGIAVVVAIGLIWSFAVMSNFVPVDGSGMSLAGISR |
| Ga0306923_100965138 | 3300031910 | Soil | MRAWMVAIAVVVAIGLIWSFAAMSNLVPVDGSEMSLASISRPAE |
| Ga0306923_101316794 | 3300031910 | Soil | MRAWMVGIAVVVAIGLIWSIAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0306923_104217271 | 3300031910 | Soil | MRAWMVGIAVVVAIGLIWSFAAMSNLVPVDRSEMSLAGISRPAE |
| Ga0306923_104466181 | 3300031910 | Soil | MRAWIVGIAAVVAIGLIWSFAAMSNLVPVDGSGMSLAGISR |
| Ga0306923_120322472 | 3300031910 | Soil | DVEGMQMRAWIVGIAAVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE |
| Ga0306921_104039872 | 3300031912 | Soil | MQMRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLAAISRPAE |
| Ga0306921_111578452 | 3300031912 | Soil | AQRDVEGMQMRAWIVGIAAVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE |
| Ga0306921_118369371 | 3300031912 | Soil | AQLDVEGMQMRAWVVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0306921_125406591 | 3300031912 | Soil | KMCEPYRQAQRDVEGMQMRAWMVAIAVVVAIGLIWSFAAMSNLVPVDGSEMSLASISRPA |
| Ga0310912_101653241 | 3300031941 | Soil | MRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMS |
| Ga0310912_108459181 | 3300031941 | Soil | QMRAWVVGIAVVVAIGLIWSFAVMSNFVPVDGSGMSLAGISRPAE |
| Ga0310912_109212521 | 3300031941 | Soil | MRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISRPA |
| Ga0310916_100471481 | 3300031942 | Soil | MVAWIIAVVVAICLIWSVAVMSNLLPVDGSISAAISRPAK |
| Ga0310916_102276033 | 3300031942 | Soil | VAWIIAVVVAIGLIWSVAVMSNLLPVDGSISAAISRPAK |
| Ga0310916_109224261 | 3300031942 | Soil | RQARRDVEGMQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGPEMSLAGISRPAE |
| Ga0310916_109312303 | 3300031942 | Soil | VEGMQMRAWVVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0310909_105007342 | 3300031947 | Soil | MRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGPEMSLAGISRPAE |
| Ga0310909_109795971 | 3300031947 | Soil | KYASPSASSTRREGMQMRAWIVVIAAVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE |
| Ga0310909_110304882 | 3300031947 | Soil | MRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLAS |
| Ga0306926_1001569014 | 3300031954 | Soil | MLAWIIAVVVAIGLIWSVAGMSNLLPVDGSDSAAISRPAE |
| Ga0306926_104802802 | 3300031954 | Soil | MRVWMVTIAVVVAIGLIWSVAVMFNLVPVDSSEMSLASISQPAE |
| Ga0306926_117109482 | 3300031954 | Soil | MRAPRQAMRAWIVGIAAVVAIGLIWSFAAMSNLVPVDGS |
| Ga0318530_100133595 | 3300031959 | Soil | MRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSL |
| Ga0306922_112128781 | 3300032001 | Soil | MQMRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISRPAE |
| Ga0306922_114360172 | 3300032001 | Soil | EGMQMRAWMVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0310911_104000451 | 3300032035 | Soil | PRPPDREAQRDTEGMQMVAWIIAVVVAIGLIWSVAVMSNLLPVDGSISAAISRPAK |
| Ga0310911_107251752 | 3300032035 | Soil | YRQAQRDVEGMQMRAWVVGIAVVVAIGLIWSFAVMSNFVPVDGSGMSLAGISRPAE |
| Ga0310911_108176682 | 3300032035 | Soil | QAQRDVEAMQTRAWMVGIAVVVAIGPIWSIAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0318533_101442932 | 3300032059 | Soil | MRAWMVGIAVVVAIGLIWSVAVMSNLVPVDGSEMSLASISRPAE |
| Ga0318533_102963943 | 3300032059 | Soil | MQMHAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSE |
| Ga0306924_102483581 | 3300032076 | Soil | MRAWMVGIALVVAISLIWSIAAVSNLVPVDGSEMSLAGISRPA |
| Ga0306924_114814372 | 3300032076 | Soil | VKKYASPYRQAQRDVEGMQMRAWVVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0306924_118619852 | 3300032076 | Soil | MQMRAWMVAIAVVVAIGLIWSFAAMSNLVPVDGSEMSLASISRPAE |
| Ga0306924_126277621 | 3300032076 | Soil | HDVEGMQMRAWMAGIIAVVVTIGLIWSVAAMSELVPVVSSDSNAISRPAE |
| Ga0307471_1004296552 | 3300032180 | Hardwood Forest Soil | MLAWIIAVVVAIGLIWSVAAMSNLVPVVDVSAAISRPAE |
| Ga0307472_1022057992 | 3300032205 | Hardwood Forest Soil | MCEPLFRQAQCDAEGKHMRAGMMAMAAVVAIGLIWSVAVMSKLVPVDGSEMRLAGTSRPA |
| Ga0306920_1012622281 | 3300032261 | Soil | RKICEPYRQAQRDVEGMQMRAWMVGIAVVVAIILIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| Ga0306920_1013172541 | 3300032261 | Soil | AVVVAIGLIWSVAVMSNLVPVDGSEMSLASISRPAE |
| Ga0310914_108174501 | 3300033289 | Soil | APRQAQRDVEGMQMRAWIVGIAAVVAIGLIWSFAAMSNLVPVDGSGMSLAGISRPAE |
| Ga0318519_109179892 | 3300033290 | Soil | YASPYRQAQRDIEGMQMRAWIVGIAVVVAIGLIWSFAAMSNLVPVDGSEMSLAGISRPAE |
| ⦗Top⦘ |