


| Basic Information | |
|---|---|
| Family ID | F008886 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 326 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TGYVLNDMVTTGQVRNRPVITFTNGTAATRTIDVAVFIGG |
| Number of Associated Samples | 178 |
| Number of Associated Scaffolds | 325 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.92 % |
| % of genes near scaffold ends (potentially truncated) | 98.16 % |
| % of genes from short scaffolds (< 2000 bps) | 77.91 % |
| Associated GOLD sequencing projects | 149 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified viruses (64.724 % of family members) |
| NCBI Taxonomy ID | 12429 |
| Taxonomy | All Organisms → Viruses → unclassified viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (37.730 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.663 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.558 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.18 % |
| Unclassified | root | N/A | 32.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10033579 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2231 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10140521 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 841 | Open in IMG/M |
| 3300000947|BBAY92_10007168 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2939 | Open in IMG/M |
| 3300000949|BBAY94_10178606 | All Organisms → Viruses → unclassified viruses → Virus sp. | 573 | Open in IMG/M |
| 3300000949|BBAY94_12623165 | Not Available | 705 | Open in IMG/M |
| 3300001913|JGI24158J21664_10117376 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1600 | Open in IMG/M |
| 3300001934|GOS2267_103759 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1784 | Open in IMG/M |
| 3300003516|Antartic2_1244149 | All Organisms → Viruses → unclassified viruses → Virus sp. | 507 | Open in IMG/M |
| 3300004449|Ga0065203_1451942 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 706 | Open in IMG/M |
| 3300004449|Ga0065203_1462988 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2170 | Open in IMG/M |
| 3300004449|Ga0065203_1463006 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2181 | Open in IMG/M |
| 3300004829|Ga0068515_102519 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2349 | Open in IMG/M |
| 3300004951|Ga0068513_1001391 | Not Available | 2473 | Open in IMG/M |
| 3300004951|Ga0068513_1004462 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1460 | Open in IMG/M |
| 3300004951|Ga0068513_1010535 | All Organisms → Viruses → unclassified viruses → Virus sp. | 974 | Open in IMG/M |
| 3300004951|Ga0068513_1014403 | Not Available | 840 | Open in IMG/M |
| 3300004951|Ga0068513_1015014 | Not Available | 824 | Open in IMG/M |
| 3300004951|Ga0068513_1015280 | All Organisms → Viruses → unclassified viruses → Virus sp. | 817 | Open in IMG/M |
| 3300004951|Ga0068513_1022177 | All Organisms → Viruses → unclassified viruses → Virus sp. | 683 | Open in IMG/M |
| 3300004951|Ga0068513_1030112 | All Organisms → Viruses → unclassified viruses → Virus sp. | 591 | Open in IMG/M |
| 3300004951|Ga0068513_1035412 | All Organisms → Viruses → unclassified viruses → Virus sp. | 547 | Open in IMG/M |
| 3300005057|Ga0068511_1105588 | All Organisms → Viruses → unclassified viruses → Virus sp. | 505 | Open in IMG/M |
| 3300005086|Ga0072334_10354934 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1966 | Open in IMG/M |
| 3300005086|Ga0072334_10458320 | Not Available | 2375 | Open in IMG/M |
| 3300005086|Ga0072334_11377694 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 500 | Open in IMG/M |
| 3300005837|Ga0078893_10052430 | Not Available | 1355 | Open in IMG/M |
| 3300005837|Ga0078893_13349502 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1129 | Open in IMG/M |
| 3300005837|Ga0078893_13490191 | All Organisms → Viruses → unclassified viruses → Virus sp. | 707 | Open in IMG/M |
| 3300005837|Ga0078893_14632601 | Not Available | 572 | Open in IMG/M |
| 3300005882|Ga0080455_1120226 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 636 | Open in IMG/M |
| 3300006334|Ga0099675_1032490 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2480 | Open in IMG/M |
| 3300006334|Ga0099675_1126715 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1083 | Open in IMG/M |
| 3300006413|Ga0099963_1019090 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2630 | Open in IMG/M |
| 3300006637|Ga0075461_10257071 | Not Available | 511 | Open in IMG/M |
| 3300006802|Ga0070749_10060657 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2283 | Open in IMG/M |
| 3300006802|Ga0070749_10431902 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 723 | Open in IMG/M |
| 3300006803|Ga0075467_10123637 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1515 | Open in IMG/M |
| 3300006803|Ga0075467_10296154 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 863 | Open in IMG/M |
| 3300006810|Ga0070754_10046834 | All Organisms → Viruses | 2309 | Open in IMG/M |
| 3300006810|Ga0070754_10193395 | All Organisms → Viruses → unclassified viruses → Virus sp. | 951 | Open in IMG/M |
| 3300006810|Ga0070754_10256345 | All Organisms → Viruses → unclassified viruses → Virus sp. | 797 | Open in IMG/M |
| 3300006867|Ga0075476_10245364 | Not Available | 640 | Open in IMG/M |
| 3300006870|Ga0075479_10223823 | All Organisms → Viruses → unclassified viruses → Virus sp. | 751 | Open in IMG/M |
| 3300006916|Ga0070750_10039227 | Not Available | 2330 | Open in IMG/M |
| 3300006916|Ga0070750_10215022 | Not Available | 846 | Open in IMG/M |
| 3300006917|Ga0075472_10035677 | Not Available | 2327 | Open in IMG/M |
| 3300006919|Ga0070746_10045945 | Not Available | 2292 | Open in IMG/M |
| 3300006919|Ga0070746_10139864 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1185 | Open in IMG/M |
| 3300006919|Ga0070746_10253272 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 821 | Open in IMG/M |
| 3300006919|Ga0070746_10457665 | Not Available | 566 | Open in IMG/M |
| 3300006919|Ga0070746_10487305 | Not Available | 543 | Open in IMG/M |
| 3300006919|Ga0070746_10507507 | Not Available | 529 | Open in IMG/M |
| 3300006920|Ga0070748_1030809 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2203 | Open in IMG/M |
| 3300006920|Ga0070748_1147086 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 878 | Open in IMG/M |
| 3300007229|Ga0075468_10123783 | All Organisms → Viruses → unclassified viruses → Virus sp. | 800 | Open in IMG/M |
| 3300007234|Ga0075460_10203389 | Not Available | 673 | Open in IMG/M |
| 3300007276|Ga0070747_1032284 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2072 | Open in IMG/M |
| 3300007345|Ga0070752_1035462 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2393 | Open in IMG/M |
| 3300007345|Ga0070752_1081573 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1413 | Open in IMG/M |
| 3300007538|Ga0099851_1034397 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2023 | Open in IMG/M |
| 3300007538|Ga0099851_1080628 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1253 | Open in IMG/M |
| 3300007539|Ga0099849_1086797 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1260 | Open in IMG/M |
| 3300007613|Ga0102799_1149824 | Not Available | 642 | Open in IMG/M |
| 3300007896|Ga0111484_1046358 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 893 | Open in IMG/M |
| 3300008012|Ga0075480_10628191 | Not Available | 506 | Open in IMG/M |
| 3300009172|Ga0114995_10086244 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1766 | Open in IMG/M |
| 3300009702|Ga0114931_10779596 | All Organisms → Viruses → unclassified viruses → Virus sp. | 566 | Open in IMG/M |
| 3300009703|Ga0114933_10345930 | Not Available | 980 | Open in IMG/M |
| 3300009785|Ga0115001_10460621 | All Organisms → Viruses → unclassified viruses → Virus sp. | 788 | Open in IMG/M |
| 3300009794|Ga0105189_1002060 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1953 | Open in IMG/M |
| 3300009794|Ga0105189_1021829 | Not Available | 610 | Open in IMG/M |
| 3300010300|Ga0129351_1056936 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1595 | Open in IMG/M |
| 3300010430|Ga0118733_100620495 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2152 | Open in IMG/M |
| 3300011013|Ga0114934_10402673 | All Organisms → Viruses → unclassified viruses → Virus sp. | 609 | Open in IMG/M |
| 3300011310|Ga0138363_1133440 | Not Available | 574 | Open in IMG/M |
| 3300012919|Ga0160422_10054437 | Not Available | 2329 | Open in IMG/M |
| 3300012919|Ga0160422_10758872 | Not Available | 621 | Open in IMG/M |
| 3300012920|Ga0160423_10075788 | Not Available | 2400 | Open in IMG/M |
| 3300012936|Ga0163109_10087987 | Not Available | 2275 | Open in IMG/M |
| 3300012952|Ga0163180_11578826 | Not Available | 551 | Open in IMG/M |
| 3300013010|Ga0129327_10039450 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2396 | Open in IMG/M |
| 3300013010|Ga0129327_10044464 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2238 | Open in IMG/M |
| 3300013188|Ga0116834_1127151 | All Organisms → Viruses → unclassified viruses → Virus sp. | 550 | Open in IMG/M |
| 3300013782|Ga0120045_100359 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 997 | Open in IMG/M |
| 3300014042|Ga0117790_1020253 | Not Available | 1559 | Open in IMG/M |
| 3300014042|Ga0117790_1043316 | Not Available | 817 | Open in IMG/M |
| 3300016729|Ga0182056_1165635 | Not Available | 701 | Open in IMG/M |
| 3300016762|Ga0182084_1054385 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 662 | Open in IMG/M |
| 3300016781|Ga0182063_1334805 | All Organisms → Viruses → unclassified viruses → Virus sp. | 635 | Open in IMG/M |
| 3300017697|Ga0180120_10148071 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 996 | Open in IMG/M |
| 3300017697|Ga0180120_10249748 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 721 | Open in IMG/M |
| 3300017697|Ga0180120_10254376 | Not Available | 713 | Open in IMG/M |
| 3300017697|Ga0180120_10303349 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 639 | Open in IMG/M |
| 3300017709|Ga0181387_1005982 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2385 | Open in IMG/M |
| 3300017709|Ga0181387_1071776 | All Organisms → Viruses → unclassified viruses → Virus sp. | 697 | Open in IMG/M |
| 3300017710|Ga0181403_1007333 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2396 | Open in IMG/M |
| 3300017710|Ga0181403_1051442 | All Organisms → Viruses → unclassified viruses → Virus sp. | 861 | Open in IMG/M |
| 3300017714|Ga0181412_1013568 | Not Available | 2398 | Open in IMG/M |
| 3300017714|Ga0181412_1027763 | Not Available | 1540 | Open in IMG/M |
| 3300017714|Ga0181412_1094108 | All Organisms → Viruses → unclassified viruses → Virus sp. | 710 | Open in IMG/M |
| 3300017717|Ga0181404_1079459 | All Organisms → Viruses → unclassified viruses → Virus sp. | 811 | Open in IMG/M |
| 3300017717|Ga0181404_1081572 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 799 | Open in IMG/M |
| 3300017717|Ga0181404_1154551 | Not Available | 553 | Open in IMG/M |
| 3300017720|Ga0181383_1011277 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2390 | Open in IMG/M |
| 3300017720|Ga0181383_1144262 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 640 | Open in IMG/M |
| 3300017720|Ga0181383_1170167 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 582 | Open in IMG/M |
| 3300017720|Ga0181383_1188907 | All Organisms → Viruses → unclassified viruses → Virus sp. | 549 | Open in IMG/M |
| 3300017724|Ga0181388_1075144 | All Organisms → Viruses → unclassified viruses → Virus sp. | 807 | Open in IMG/M |
| 3300017724|Ga0181388_1177888 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 504 | Open in IMG/M |
| 3300017724|Ga0181388_1178466 | Not Available | 503 | Open in IMG/M |
| 3300017726|Ga0181381_1033867 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1141 | Open in IMG/M |
| 3300017726|Ga0181381_1044708 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 978 | Open in IMG/M |
| 3300017728|Ga0181419_1047882 | Not Available | 1123 | Open in IMG/M |
| 3300017729|Ga0181396_1105072 | All Organisms → Viruses → unclassified viruses → Virus sp. | 578 | Open in IMG/M |
| 3300017730|Ga0181417_1087892 | All Organisms → Viruses → unclassified viruses → Virus sp. | 752 | Open in IMG/M |
| 3300017731|Ga0181416_1037598 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1137 | Open in IMG/M |
| 3300017731|Ga0181416_1048861 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 996 | Open in IMG/M |
| 3300017731|Ga0181416_1073621 | All Organisms → Viruses → unclassified viruses → Virus sp. | 809 | Open in IMG/M |
| 3300017731|Ga0181416_1113249 | All Organisms → Viruses → unclassified viruses → Virus sp. | 649 | Open in IMG/M |
| 3300017732|Ga0181415_1150860 | All Organisms → Viruses → unclassified viruses → Virus sp. | 519 | Open in IMG/M |
| 3300017733|Ga0181426_1006520 | Not Available | 2288 | Open in IMG/M |
| 3300017733|Ga0181426_1013879 | All Organisms → Viruses | 1581 | Open in IMG/M |
| 3300017733|Ga0181426_1133531 | All Organisms → Viruses → unclassified viruses → Virus sp. | 501 | Open in IMG/M |
| 3300017734|Ga0187222_1075755 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 769 | Open in IMG/M |
| 3300017735|Ga0181431_1011273 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2137 | Open in IMG/M |
| 3300017735|Ga0181431_1094562 | Not Available | 670 | Open in IMG/M |
| 3300017738|Ga0181428_1019777 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1553 | Open in IMG/M |
| 3300017738|Ga0181428_1136840 | Not Available | 573 | Open in IMG/M |
| 3300017738|Ga0181428_1167585 | All Organisms → Viruses → unclassified viruses → Virus sp. | 513 | Open in IMG/M |
| 3300017739|Ga0181433_1013028 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2267 | Open in IMG/M |
| 3300017742|Ga0181399_1013291 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2369 | Open in IMG/M |
| 3300017742|Ga0181399_1116818 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 654 | Open in IMG/M |
| 3300017743|Ga0181402_1048695 | Not Available | 1147 | Open in IMG/M |
| 3300017744|Ga0181397_1127756 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 658 | Open in IMG/M |
| 3300017745|Ga0181427_1084008 | All Organisms → Viruses → unclassified viruses → Virus sp. | 779 | Open in IMG/M |
| 3300017745|Ga0181427_1086656 | All Organisms → Viruses → unclassified viruses → Virus sp. | 767 | Open in IMG/M |
| 3300017745|Ga0181427_1168132 | All Organisms → Viruses → unclassified viruses → Virus sp. | 529 | Open in IMG/M |
| 3300017745|Ga0181427_1176371 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 515 | Open in IMG/M |
| 3300017749|Ga0181392_1171914 | Not Available | 631 | Open in IMG/M |
| 3300017751|Ga0187219_1154741 | All Organisms → Viruses → unclassified viruses → Virus sp. | 659 | Open in IMG/M |
| 3300017751|Ga0187219_1156213 | All Organisms → Viruses → unclassified viruses → Virus sp. | 654 | Open in IMG/M |
| 3300017752|Ga0181400_1065431 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1103 | Open in IMG/M |
| 3300017753|Ga0181407_1081830 | Not Available | 824 | Open in IMG/M |
| 3300017753|Ga0181407_1103599 | All Organisms → Viruses → unclassified viruses → Virus sp. | 715 | Open in IMG/M |
| 3300017753|Ga0181407_1145033 | Not Available | 588 | Open in IMG/M |
| 3300017755|Ga0181411_1016101 | Not Available | 2444 | Open in IMG/M |
| 3300017755|Ga0181411_1016341 | Not Available | 2425 | Open in IMG/M |
| 3300017755|Ga0181411_1018277 | Not Available | 2288 | Open in IMG/M |
| 3300017755|Ga0181411_1121013 | All Organisms → Viruses → unclassified viruses → Virus sp. | 764 | Open in IMG/M |
| 3300017756|Ga0181382_1014998 | Not Available | 2533 | Open in IMG/M |
| 3300017756|Ga0181382_1134658 | All Organisms → Viruses → unclassified viruses → Virus sp. | 653 | Open in IMG/M |
| 3300017757|Ga0181420_1068421 | Not Available | 1120 | Open in IMG/M |
| 3300017757|Ga0181420_1140633 | All Organisms → Viruses → unclassified viruses → Virus sp. | 724 | Open in IMG/M |
| 3300017758|Ga0181409_1117926 | All Organisms → Viruses → unclassified viruses → Virus sp. | 785 | Open in IMG/M |
| 3300017758|Ga0181409_1183890 | Not Available | 606 | Open in IMG/M |
| 3300017758|Ga0181409_1203606 | All Organisms → Viruses → unclassified viruses → Virus sp. | 570 | Open in IMG/M |
| 3300017759|Ga0181414_1137193 | Not Available | 640 | Open in IMG/M |
| 3300017759|Ga0181414_1188448 | All Organisms → Viruses → unclassified viruses → Virus sp. | 535 | Open in IMG/M |
| 3300017760|Ga0181408_1018943 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1907 | Open in IMG/M |
| 3300017760|Ga0181408_1089409 | All Organisms → Viruses → unclassified viruses → Virus sp. | 805 | Open in IMG/M |
| 3300017760|Ga0181408_1090871 | All Organisms → Viruses → unclassified viruses → Virus sp. | 798 | Open in IMG/M |
| 3300017760|Ga0181408_1097921 | All Organisms → Viruses | 765 | Open in IMG/M |
| 3300017760|Ga0181408_1173736 | Not Available | 551 | Open in IMG/M |
| 3300017762|Ga0181422_1151990 | All Organisms → Viruses → unclassified viruses → Virus sp. | 710 | Open in IMG/M |
| 3300017763|Ga0181410_1150983 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 653 | Open in IMG/M |
| 3300017764|Ga0181385_1018684 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2222 | Open in IMG/M |
| 3300017764|Ga0181385_1095655 | Not Available | 910 | Open in IMG/M |
| 3300017764|Ga0181385_1110156 | Not Available | 842 | Open in IMG/M |
| 3300017764|Ga0181385_1119220 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 805 | Open in IMG/M |
| 3300017764|Ga0181385_1179131 | All Organisms → Viruses → unclassified viruses → Virus sp. | 640 | Open in IMG/M |
| 3300017764|Ga0181385_1229166 | All Organisms → Viruses → unclassified viruses → Virus sp. | 559 | Open in IMG/M |
| 3300017764|Ga0181385_1273948 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 504 | Open in IMG/M |
| 3300017767|Ga0181406_1015253 | All Organisms → Viruses | 2450 | Open in IMG/M |
| 3300017767|Ga0181406_1171848 | All Organisms → Viruses → unclassified viruses → Virus sp. | 648 | Open in IMG/M |
| 3300017768|Ga0187220_1013308 | Not Available | 2478 | Open in IMG/M |
| 3300017768|Ga0187220_1014343 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2385 | Open in IMG/M |
| 3300017769|Ga0187221_1017930 | Not Available | 2513 | Open in IMG/M |
| 3300017771|Ga0181425_1037059 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1601 | Open in IMG/M |
| 3300017772|Ga0181430_1017386 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2390 | Open in IMG/M |
| 3300017772|Ga0181430_1101143 | All Organisms → Viruses → unclassified viruses → Virus sp. | 858 | Open in IMG/M |
| 3300017772|Ga0181430_1114641 | All Organisms → Viruses → unclassified viruses → Virus sp. | 796 | Open in IMG/M |
| 3300017772|Ga0181430_1245802 | Not Available | 505 | Open in IMG/M |
| 3300017773|Ga0181386_1019141 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2284 | Open in IMG/M |
| 3300017773|Ga0181386_1025629 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1954 | Open in IMG/M |
| 3300017773|Ga0181386_1142426 | Not Available | 735 | Open in IMG/M |
| 3300017776|Ga0181394_1021804 | All Organisms → Viruses | 2301 | Open in IMG/M |
| 3300017776|Ga0181394_1104577 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 902 | Open in IMG/M |
| 3300017776|Ga0181394_1108353 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 883 | Open in IMG/M |
| 3300017779|Ga0181395_1235732 | Not Available | 562 | Open in IMG/M |
| 3300017781|Ga0181423_1023464 | Not Available | 2518 | Open in IMG/M |
| 3300017781|Ga0181423_1025773 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2394 | Open in IMG/M |
| 3300017781|Ga0181423_1030851 | Not Available | 2174 | Open in IMG/M |
| 3300017781|Ga0181423_1119321 | Not Available | 1026 | Open in IMG/M |
| 3300017781|Ga0181423_1168769 | Not Available | 838 | Open in IMG/M |
| 3300017781|Ga0181423_1192188 | All Organisms → Viruses → unclassified viruses → Virus sp. | 775 | Open in IMG/M |
| 3300017781|Ga0181423_1202379 | All Organisms → Viruses → unclassified viruses → Virus sp. | 751 | Open in IMG/M |
| 3300017781|Ga0181423_1235512 | All Organisms → Viruses → unclassified viruses → Virus sp. | 686 | Open in IMG/M |
| 3300017781|Ga0181423_1266555 | All Organisms → Viruses → unclassified viruses → Virus sp. | 637 | Open in IMG/M |
| 3300017782|Ga0181380_1073575 | Not Available | 1201 | Open in IMG/M |
| 3300017782|Ga0181380_1157523 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 771 | Open in IMG/M |
| 3300017782|Ga0181380_1171737 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 733 | Open in IMG/M |
| 3300017782|Ga0181380_1180155 | Not Available | 713 | Open in IMG/M |
| 3300017782|Ga0181380_1182580 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 707 | Open in IMG/M |
| 3300017782|Ga0181380_1208333 | Not Available | 654 | Open in IMG/M |
| 3300017782|Ga0181380_1252563 | Not Available | 585 | Open in IMG/M |
| 3300017782|Ga0181380_1266476 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 566 | Open in IMG/M |
| 3300017782|Ga0181380_1302429 | All Organisms → Viruses → unclassified viruses → Virus sp. | 523 | Open in IMG/M |
| 3300017783|Ga0181379_1022644 | Not Available | 2533 | Open in IMG/M |
| 3300017783|Ga0181379_1027187 | Not Available | 2285 | Open in IMG/M |
| 3300017783|Ga0181379_1027217 | Not Available | 2284 | Open in IMG/M |
| 3300017783|Ga0181379_1046347 | Not Available | 1679 | Open in IMG/M |
| 3300017786|Ga0181424_10109289 | Not Available | 1193 | Open in IMG/M |
| 3300017786|Ga0181424_10173998 | All Organisms → Viruses → unclassified viruses → Virus sp. | 918 | Open in IMG/M |
| 3300017786|Ga0181424_10221151 | All Organisms → Viruses → unclassified viruses → Virus sp. | 798 | Open in IMG/M |
| 3300017786|Ga0181424_10454198 | All Organisms → Viruses → unclassified viruses → Virus sp. | 517 | Open in IMG/M |
| 3300017951|Ga0181577_10307722 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1027 | Open in IMG/M |
| 3300017964|Ga0181589_10833463 | Not Available | 570 | Open in IMG/M |
| 3300017971|Ga0180438_10875332 | Not Available | 654 | Open in IMG/M |
| 3300017986|Ga0181569_10326479 | Not Available | 1059 | Open in IMG/M |
| 3300018049|Ga0181572_10447863 | All Organisms → Viruses → unclassified viruses → Virus sp. | 801 | Open in IMG/M |
| 3300018080|Ga0180433_10569746 | Not Available | 853 | Open in IMG/M |
| 3300018415|Ga0181559_10788486 | Not Available | 505 | Open in IMG/M |
| 3300018895|Ga0193547_10037238 | Not Available | 507 | Open in IMG/M |
| 3300019261|Ga0182097_1507647 | Not Available | 547 | Open in IMG/M |
| 3300019283|Ga0182058_1179945 | Not Available | 687 | Open in IMG/M |
| 3300020055|Ga0181575_10144491 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1438 | Open in IMG/M |
| 3300020056|Ga0181574_10305759 | Not Available | 965 | Open in IMG/M |
| 3300020281|Ga0211483_10197216 | Not Available | 668 | Open in IMG/M |
| 3300020381|Ga0211476_10091310 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1154 | Open in IMG/M |
| 3300020385|Ga0211677_10163681 | All Organisms → Viruses → unclassified viruses → Virus sp. | 938 | Open in IMG/M |
| 3300020392|Ga0211666_10202006 | All Organisms → Viruses → unclassified viruses → Virus sp. | 764 | Open in IMG/M |
| 3300020400|Ga0211636_10246109 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 688 | Open in IMG/M |
| 3300020409|Ga0211472_10270265 | Not Available | 684 | Open in IMG/M |
| 3300020410|Ga0211699_10095572 | All Organisms → Viruses | 1102 | Open in IMG/M |
| 3300020420|Ga0211580_10471855 | Not Available | 507 | Open in IMG/M |
| 3300020422|Ga0211702_10089492 | All Organisms → Viruses → unclassified viruses → Virus sp. | 865 | Open in IMG/M |
| 3300020424|Ga0211620_10238408 | All Organisms → Viruses → unclassified viruses → Virus sp. | 777 | Open in IMG/M |
| 3300020437|Ga0211539_10436498 | Not Available | 545 | Open in IMG/M |
| 3300020439|Ga0211558_10036144 | All Organisms → Viruses | 2496 | Open in IMG/M |
| 3300020439|Ga0211558_10049368 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2103 | Open in IMG/M |
| 3300020440|Ga0211518_10061758 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2098 | Open in IMG/M |
| 3300020464|Ga0211694_10273677 | All Organisms → Viruses → unclassified viruses → Virus sp. | 705 | Open in IMG/M |
| 3300021425|Ga0213866_10119291 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1422 | Open in IMG/M |
| 3300022053|Ga0212030_1065426 | All Organisms → Viruses → unclassified viruses → Virus sp. | 518 | Open in IMG/M |
| 3300022057|Ga0212025_1096849 | All Organisms → Viruses → unclassified viruses → Virus sp. | 505 | Open in IMG/M |
| 3300022061|Ga0212023_1040696 | All Organisms → Viruses → unclassified viruses → Virus sp. | 646 | Open in IMG/M |
| 3300022065|Ga0212024_1001120 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2620 | Open in IMG/M |
| 3300022065|Ga0212024_1001120 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2620 | Open in IMG/M |
| 3300022065|Ga0212024_1023643 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1016 | Open in IMG/M |
| 3300022065|Ga0212024_1037731 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 833 | Open in IMG/M |
| 3300022066|Ga0224902_101405 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1181 | Open in IMG/M |
| 3300022068|Ga0212021_1044835 | All Organisms → Viruses → unclassified viruses → Virus sp. | 889 | Open in IMG/M |
| 3300022068|Ga0212021_1045357 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 885 | Open in IMG/M |
| 3300022069|Ga0212026_1069346 | All Organisms → Viruses → unclassified viruses → Virus sp. | 535 | Open in IMG/M |
| 3300022072|Ga0196889_1026175 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1196 | Open in IMG/M |
| 3300022072|Ga0196889_1031731 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1068 | Open in IMG/M |
| 3300022164|Ga0212022_1028604 | All Organisms → Viruses → unclassified viruses → Virus sp. | 851 | Open in IMG/M |
| 3300022164|Ga0212022_1029273 | All Organisms → Viruses → unclassified viruses → Virus sp. | 842 | Open in IMG/M |
| 3300022164|Ga0212022_1039093 | All Organisms → Viruses → unclassified viruses → Virus sp. | 734 | Open in IMG/M |
| 3300022168|Ga0212027_1027288 | All Organisms → Viruses → unclassified viruses → Virus sp. | 763 | Open in IMG/M |
| 3300022169|Ga0196903_1022097 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 766 | Open in IMG/M |
| 3300022183|Ga0196891_1023124 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1182 | Open in IMG/M |
| 3300022183|Ga0196891_1054380 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 724 | Open in IMG/M |
| 3300022183|Ga0196891_1068841 | Not Available | 632 | Open in IMG/M |
| 3300022187|Ga0196899_1053123 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1320 | Open in IMG/M |
| 3300022187|Ga0196899_1071666 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1079 | Open in IMG/M |
| 3300022187|Ga0196899_1209962 | All Organisms → Viruses → unclassified viruses → Virus sp. | 512 | Open in IMG/M |
| 3300023087|Ga0255774_10059562 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2295 | Open in IMG/M |
| 3300023087|Ga0255774_10219249 | All Organisms → Viruses → unclassified viruses → Virus sp. | 970 | Open in IMG/M |
| 3300023087|Ga0255774_10337157 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 705 | Open in IMG/M |
| 3300023105|Ga0255782_10229752 | Not Available | 903 | Open in IMG/M |
| 3300023110|Ga0255743_10071613 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2129 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10531768 | Not Available | 591 | Open in IMG/M |
| 3300025508|Ga0208148_1063165 | All Organisms → Viruses → unclassified viruses → Virus sp. | 879 | Open in IMG/M |
| 3300025543|Ga0208303_1015074 | Not Available | 2295 | Open in IMG/M |
| 3300025608|Ga0209654_1129118 | Not Available | 637 | Open in IMG/M |
| 3300025645|Ga0208643_1019574 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2389 | Open in IMG/M |
| 3300025645|Ga0208643_1020768 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2299 | Open in IMG/M |
| 3300025645|Ga0208643_1094453 | All Organisms → Viruses → unclassified viruses → Virus sp. | 829 | Open in IMG/M |
| 3300025655|Ga0208795_1075674 | All Organisms → Viruses → unclassified viruses → Virus sp. | 940 | Open in IMG/M |
| 3300025671|Ga0208898_1031919 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2133 | Open in IMG/M |
| 3300025674|Ga0208162_1023678 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2327 | Open in IMG/M |
| 3300025751|Ga0208150_1024785 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2109 | Open in IMG/M |
| 3300025751|Ga0208150_1108575 | All Organisms → Viruses → unclassified viruses → Virus sp. | 902 | Open in IMG/M |
| 3300025759|Ga0208899_1035992 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2263 | Open in IMG/M |
| 3300025759|Ga0208899_1039861 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2107 | Open in IMG/M |
| 3300025759|Ga0208899_1113626 | Not Available | 986 | Open in IMG/M |
| 3300025759|Ga0208899_1231184 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 564 | Open in IMG/M |
| 3300025769|Ga0208767_1040081 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2297 | Open in IMG/M |
| 3300025803|Ga0208425_1012233 | Not Available | 2361 | Open in IMG/M |
| 3300025815|Ga0208785_1073693 | Not Available | 893 | Open in IMG/M |
| 3300025818|Ga0208542_1162790 | All Organisms → Viruses → unclassified viruses → Virus sp. | 599 | Open in IMG/M |
| 3300025853|Ga0208645_1082902 | Not Available | 1384 | Open in IMG/M |
| 3300025853|Ga0208645_1157236 | Not Available | 857 | Open in IMG/M |
| 3300025887|Ga0208544_10204520 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 814 | Open in IMG/M |
| 3300025889|Ga0208644_1050211 | Not Available | 2318 | Open in IMG/M |
| 3300026134|Ga0208815_1004012 | All Organisms → Viruses | 2497 | Open in IMG/M |
| 3300026134|Ga0208815_1004404 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2353 | Open in IMG/M |
| 3300026134|Ga0208815_1006827 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1750 | Open in IMG/M |
| 3300028008|Ga0228674_1164875 | All Organisms → Viruses → unclassified viruses → Virus sp. | 730 | Open in IMG/M |
| 3300028008|Ga0228674_1196603 | All Organisms → Viruses → unclassified viruses → Virus sp. | 649 | Open in IMG/M |
| 3300029293|Ga0135211_1005390 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1019 | Open in IMG/M |
| 3300029293|Ga0135211_1014527 | Not Available | 802 | Open in IMG/M |
| 3300029293|Ga0135211_1041630 | Not Available | 578 | Open in IMG/M |
| 3300029293|Ga0135211_1047307 | Not Available | 544 | Open in IMG/M |
| 3300029302|Ga0135227_1000344 | Not Available | 1518 | Open in IMG/M |
| 3300029302|Ga0135227_1007571 | All Organisms → Viruses → unclassified viruses → Virus sp. | 812 | Open in IMG/M |
| 3300029302|Ga0135227_1028221 | All Organisms → Viruses → unclassified viruses → Virus sp. | 608 | Open in IMG/M |
| 3300029306|Ga0135212_1024018 | All Organisms → Viruses → unclassified viruses → Virus sp. | 634 | Open in IMG/M |
| 3300029308|Ga0135226_1014093 | All Organisms → Viruses → unclassified viruses → Virus sp. | 676 | Open in IMG/M |
| 3300029308|Ga0135226_1020505 | Not Available | 617 | Open in IMG/M |
| 3300029309|Ga0183683_1021918 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1276 | Open in IMG/M |
| 3300029345|Ga0135210_1000916 | Not Available | 1875 | Open in IMG/M |
| 3300029345|Ga0135210_1004888 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1064 | Open in IMG/M |
| 3300029345|Ga0135210_1008158 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 898 | Open in IMG/M |
| 3300029345|Ga0135210_1018535 | Not Available | 694 | Open in IMG/M |
| 3300029635|Ga0135217_107850 | Not Available | 646 | Open in IMG/M |
| 3300029753|Ga0135224_1003104 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 980 | Open in IMG/M |
| 3300029753|Ga0135224_1006011 | Not Available | 862 | Open in IMG/M |
| 3300031627|Ga0302118_10039630 | All Organisms → Viruses → unclassified viruses → Virus sp. | 2413 | Open in IMG/M |
| 3300031766|Ga0315322_10303159 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1091 | Open in IMG/M |
| 3300032373|Ga0316204_10553925 | Not Available | 850 | Open in IMG/M |
| 3300032820|Ga0310342_100141053 | Not Available | 2332 | Open in IMG/M |
| 3300034375|Ga0348336_049285 | All Organisms → Viruses → unclassified viruses → Virus sp. | 1752 | Open in IMG/M |
| 3300034375|Ga0348336_125037 | All Organisms → Viruses → unclassified viruses → Virus sp. | 814 | Open in IMG/M |
| 3300034418|Ga0348337_193096 | Not Available | 517 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 37.73% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 23.93% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.21% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.21% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 5.21% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 3.07% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.15% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.15% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.53% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.23% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.92% |
| Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment | 0.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.92% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.92% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.92% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.61% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.61% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.61% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.61% |
| Epidermal Mucus | Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.31% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.31% |
| Freshwater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Freshwater | 0.31% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.31% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.31% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.31% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.31% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.31% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.31% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.31% |
| Ecteinascidia Turbinata | Host-Associated → Tunicates → Ascidians → Unclassified → Unclassified → Ecteinascidia Turbinata | 0.31% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001913 | Ecteinascidia turbinata endosymbiont from Florida, USA - Sample 3 | Host-Associated | Open in IMG/M |
| 3300001934 | Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858 | Environmental | Open in IMG/M |
| 3300003516 | Marine microbial communities from Antarctic ocean - Station_363 -- 0.8 um | Environmental | Open in IMG/M |
| 3300004449 | Marine microbial communities from Galveston Bay (CSEDA12C HDTS- fraction 12) | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005882 | Hydrocarbon microbial community from Halfdan Field MHF | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007613 | Marine microbial communities from the Southern Atlantic ocean - KN S19 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007896 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009702 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaG | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009794 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011310 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 DCM_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300013782 | Marine microbial communites from Sargasso Sea - Prochlorococcus B258 surface rep 1 | Environmental | Open in IMG/M |
| 3300014042 | Epidermal mucus viral and microbial communities from European eel in Spain - Ebro delta (0.22 um filter) | Host-Associated | Open in IMG/M |
| 3300016729 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016762 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016781 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018895 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_011 - TARA_X100000009 (ERX1408504-ERR1336912) | Environmental | Open in IMG/M |
| 3300019261 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020422 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022066 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026134 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300029293 | Marine harbor viral communities from the Indian Ocean - SCH2 | Environmental | Open in IMG/M |
| 3300029302 | Marine harbor viral communities from the Indian Ocean - SRB3 | Environmental | Open in IMG/M |
| 3300029306 | Marine harbor viral communities from the Indian Ocean - SCH3 | Environmental | Open in IMG/M |
| 3300029308 | Marine harbor viral communities from the Indian Ocean - SRB2 | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029345 | Marine harbor viral communities from the Indian Ocean - SCH1 | Environmental | Open in IMG/M |
| 3300029635 | Marine harbor viral communities from the Indian Ocean - SMH2 | Environmental | Open in IMG/M |
| 3300029753 | Marine harbor viral communities from the Indian Ocean - SRH3 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100335791 | 3300000115 | Marine | SSYTMNNMITTGAIRNRPIITFTNTTAATRTIDVAVFIGN* |
| DelMOSpr2010_101405212 | 3300000116 | Marine | FGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDAASVDIEVAIFIGG* |
| BBAY92_100071686 | 3300000947 | Macroalgal Surface | EPFGASEGSNYVMNNMVTTGAIRNRPIITFTNTTSGTRTIDVAVFIGN* |
| BBAY94_101786061 | 3300000949 | Macroalgal Surface | DMVTTGQVRNRPVITFKNGTAGTRTVDVAIFIGG* |
| BBAY94_126231651 | 3300000949 | Macroalgal Surface | AAVSEKVSGEAFGWNNTGYVLNDMVTTGQIRNRAVVTFTNNDASSVDLEVAIFIGG* |
| JGI24158J21664_101173764 | 3300001913 | Ecteinascidia Turbinata | GWNNTGYVLNDMVTTGQVRNRPVITFTNNDASSVDIEVAIFIGG* |
| GOS2267_1037592 | 3300001934 | Marine | SGEAFGWNNTGYVLNDMITTGAERNRPVITFTNNDASSVDIEVAIFIGG* |
| Antartic2_12441492 | 3300003516 | Freshwater | AGEPFGWNGNYIMNDMVTQGAVRNRPVVTFTNGTSGTRVVDVAIFIGG* |
| Ga0065203_14519421 | 3300004449 | Sediment | FGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDIEVAIFIGG* |
| Ga0065203_14629881 | 3300004449 | Sediment | NTGYVMNDMVTTGQVRNRPVITFTNNDASAVDIEVAVFIGG* |
| Ga0065203_14630061 | 3300004449 | Sediment | NTGYVMNDMVTTGQVRNRPVVTFTNNDAASVDIEVAIFIGG* |
| Ga0068515_1025191 | 3300004829 | Marine Water | PFGWNGNYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG* |
| Ga0068513_10013915 | 3300004951 | Marine Water | QPFGWNNTGYVMNDTVTTGSVRNRPVITFTNNDSNSATIDVAVFIA* |
| Ga0068513_10044624 | 3300004951 | Marine Water | EPFGWNGNYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG* |
| Ga0068513_10105351 | 3300004951 | Marine Water | TGYVLNDMVTTGQVRNRPVITFTNGTAATRTIDVAVFIGG* |
| Ga0068513_10144031 | 3300004951 | Marine Water | WKGGYVMNDMVTTAAERNRPIVTFTNNSAATREIDVAIFIGG* |
| Ga0068513_10150141 | 3300004951 | Marine Water | LVTGEPFGWNGNYTMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG* |
| Ga0068513_10152801 | 3300004951 | Marine Water | EPFGWNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG* |
| Ga0068513_10221771 | 3300004951 | Marine Water | GWNGNYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG* |
| Ga0068513_10301121 | 3300004951 | Marine Water | LVTGQPFGWSGTGYVMNDMVTTGQVRNRPVITFTNNTAATRQVDVAIFIGG* |
| Ga0068513_10354121 | 3300004951 | Marine Water | EPFGWNGNYVMNDMVTTGQVRNRPIITFTNGTSATRTIDVAVFIGG* |
| Ga0068511_11055882 | 3300005057 | Marine Water | NNTGYIMNDFTTTGAERNRPVITFTNNDAASVDVEVAIFIGG* |
| Ga0072334_103549341 | 3300005086 | Water | WNNTGYVMNDMVTTGQVRNRPVITFKNGTSATRTVDVAIFIGG* |
| Ga0072334_104583201 | 3300005086 | Water | GASENSSYTMNNMITTGAIRNRPIITFTNTTAATRTVDVAVFIGN* |
| Ga0072334_113776941 | 3300005086 | Water | TGEPFGASENSSYTMNNMITTGAIRNRPIITFTNTTSGTRTVDVAVFIGN* |
| Ga0078893_100524301 | 3300005837 | Marine Surface Water | VSGEAFGWNNTGYVMNDMVTTGQVRNRPVITFTNNDASSVDIEVAIFIGG* |
| Ga0078893_133495023 | 3300005837 | Marine Surface Water | WRGGYVLNDMVTTGQVRNRPVITFTNGSGSSATIDVAVFIGG* |
| Ga0078893_134901912 | 3300005837 | Marine Surface Water | WSGTGYVMNDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG* |
| Ga0078893_146326013 | 3300005837 | Marine Surface Water | NNTGYVLNDMITTGAERNRPVITFANGDVNSVDIEVAIFIGG* |
| Ga0080455_11202261 | 3300005882 | Water | NNMITTGAIRNRPIITFTNTTAATRTVDVAVFIGN* |
| Ga0099675_10324905 | 3300006334 | Marine | VTGQPFGWSGTGYVMNDMVTTGSVRNRPVITFTNGTSATRTVDVAVFIGG* |
| Ga0099675_11267153 | 3300006334 | Marine | NMNDMVTTGQVRNRPIITFTNNTSGTVEVQCAVFIGG* |
| Ga0099963_10190901 | 3300006413 | Marine | FSAAEGSNYVMNNMITTGAIRNRPIITFTNTTSGTRTIDVAVFIGN* |
| Ga0075461_102570712 | 3300006637 | Aqueous | DMITTGAERNRPVVTFTNGDAASVDVEVAIFIGG* |
| Ga0070749_100606571 | 3300006802 | Aqueous | KVSGEAFGWNNTGYVMNDMVTTGQVRNRPVITFTNNDASSVNIEVAVFIGG* |
| Ga0070749_104319022 | 3300006802 | Aqueous | GEPFGASENSSYTMNNMITTGAIRNRPIITFTNTTAATRTVDVAVFIGN* |
| Ga0075467_101236374 | 3300006803 | Aqueous | FGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG* |
| Ga0075467_102961542 | 3300006803 | Aqueous | GWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDIEVAIFIGG* |
| Ga0070754_100468345 | 3300006810 | Aqueous | VLNDMVTVGAERNRPVITFTNNDASSVDVEVAIFIGG* |
| Ga0070754_101933952 | 3300006810 | Aqueous | MNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG* |
| Ga0070754_102563451 | 3300006810 | Aqueous | FGWNNTGYVLNDTVTVGAERNRPVVTFTNKDAAAVDIEVAIFIGG* |
| Ga0075476_102453641 | 3300006867 | Aqueous | NDMVTTGQVRNRPVVTFTNNDASSVNLEVAIFIGG* |
| Ga0075479_102238231 | 3300006870 | Aqueous | GGYVLNDMITTGQVRNRPVVTFTNGSGSSATIDVAIFIGG* |
| Ga0070750_100392271 | 3300006916 | Aqueous | TGYVLNDMVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG* |
| Ga0070750_102150221 | 3300006916 | Aqueous | EKVSGEAFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG* |
| Ga0075472_100356775 | 3300006917 | Aqueous | GYVLNDMITTGAERNRPVITFTNNDASSVDVEVAIFIGG* |
| Ga0070746_100459451 | 3300006919 | Aqueous | NDMITTGQVRNRPVITFTNGSGADATVDVAVFIGG* |
| Ga0070746_101398641 | 3300006919 | Aqueous | VMNDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG* |
| Ga0070746_102532721 | 3300006919 | Aqueous | GASENSSYTMNNMITTGAIRNRPIITFTNTTAATRTIDVAVFIGN* |
| Ga0070746_104576652 | 3300006919 | Aqueous | LNDMVTTGQVRNRPVVTFTNNDASSVNLEVAIFIGG* |
| Ga0070746_104873052 | 3300006919 | Aqueous | WNNTGYVLNDMVTTGQVRNRPVVTFTNNDAASVDIEVAIFIGG* |
| Ga0070746_105075072 | 3300006919 | Aqueous | DTVTVGAERNRPVVTFTNKDAAAVDIEVAIFIGG* |
| Ga0070748_10308091 | 3300006920 | Aqueous | VLNDMITTGQVRNRPVVTFTNGAGATATVDVAIFIGG* |
| Ga0070748_11470862 | 3300006920 | Aqueous | YTMNNMITTGAIRNRPIITFTNTTAATRTIDVAVFIGN* |
| Ga0075468_101237831 | 3300007229 | Aqueous | AVVSEDVTGEAFGWRGGYVLNDMITTGQVRNRPVVTFTNGSGSSATIDVAIFIGG* |
| Ga0075460_102033892 | 3300007234 | Aqueous | VLNDMVTTGQVRNRPVITFTNGSGAEATVDVAVFIGG* |
| Ga0070747_10322845 | 3300007276 | Aqueous | LNDMVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG* |
| Ga0070752_10354625 | 3300007345 | Aqueous | GWNNTGYVMNDMVCTGQVRNRPVITFTNGTAATRTIDVAIFIGG* |
| Ga0070752_10815734 | 3300007345 | Aqueous | TGYVLNDTVTVGAERNRPVVTFTNKDAAAVDIEVAIFIGG* |
| Ga0099851_10343971 | 3300007538 | Aqueous | VTGQPFGWNGTGYVLNDMVTTGQVRNRPIITFKNGTSGTRTIDVAVFIGG* |
| Ga0099851_10806284 | 3300007538 | Aqueous | VTGEPFGWNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAIFIGG* |
| Ga0099849_10867974 | 3300007539 | Aqueous | VMNDMVTTGQVRNRPVITFTNNSGASATIDVAVFIGG* |
| Ga0102799_11498241 | 3300007613 | Marine | MNNMTTTGDIRNRPIITFTNTGSNSATIDVAVFIGSQ* |
| Ga0111484_10463582 | 3300007896 | Sediment | GYVLNDTVTTGQVRNRPVVTFTNNDAASVDLEVAIFIGG* |
| Ga0075480_106281912 | 3300008012 | Aqueous | AFGWNNTGYVLNDMVTTGQVRNRPVITFTNTDAGSVDIEVAIFIGG* |
| Ga0114995_100862444 | 3300009172 | Marine | VMNDMVTTGQIRNRPVITFTNNTASTKVVDVAIFIGG* |
| Ga0114931_107795962 | 3300009702 | Deep Subsurface | LVTGEPFGWNGNYVMNDMVTTGQVRNRPIITFTNGTSATRTVDVAVFIGG* |
| Ga0114933_103459302 | 3300009703 | Deep Subsurface | MNDMVTSGAVRNRPIITFSNTGSASADIDVAVFIGSQ* |
| Ga0115001_104606211 | 3300009785 | Marine | GEPFGWNGNYVMNDMVTQGAVRNRPVITFTNGTAATRTVDVAIFIGG* |
| Ga0105189_10020601 | 3300009794 | Marine Oceanic | GYVLNDMVTTGQVRNRPIITFKNGTAATRTIDVAVFIGG* |
| Ga0105189_10218291 | 3300009794 | Marine Oceanic | MNDMVTTGQVRNRPTITFTNGSGSSATIDVAVFIGG* |
| Ga0129351_10569364 | 3300010300 | Freshwater To Marine Saline Gradient | GWNNTGYVMNDMVTTGQVRNRPVITFTNNSGASATIDVAVFIGG* |
| Ga0118733_1006204955 | 3300010430 | Marine Sediment | WRGGYVLNDTVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG* |
| Ga0114934_104026732 | 3300011013 | Deep Subsurface | NDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG* |
| Ga0138363_11334402 | 3300011310 | Marine | TGEAFGWNGTGYVMNDMVTTGAVRNRPIIQFTNTGSASATIDVAVFIGSQ* |
| Ga0160422_100544375 | 3300012919 | Seawater | VMNDMVTTATERNRPIITFTNTSGATRTIQVAVFIGG* |
| Ga0160422_107588721 | 3300012919 | Seawater | ELVTGQPFGWNNTGYVMNDTVTTGNVRNRPVITFTNNDASSVTVDVAVFIS* |
| Ga0160423_100757886 | 3300012920 | Surface Seawater | NYVMNNMVTTGAIRNRPIITFTNTTAATRTIDVAVFIGN* |
| Ga0163109_100879875 | 3300012936 | Surface Seawater | GWRGGYVLNDMVTTGQVRNRPVITFTNGSGSSATIDVAVFIGG* |
| Ga0163180_115788261 | 3300012952 | Seawater | TGYVMNDMVTTGQVRNRPVITFSNGTAATRTVDVAVFIGG* |
| Ga0129327_100394501 | 3300013010 | Freshwater To Marine Saline Gradient | LVTGQPFGWNNTGYVLNDMVTTGQVRNRPIIQFKNGTGATRTIDVAVFIGG* |
| Ga0129327_100444641 | 3300013010 | Freshwater To Marine Saline Gradient | DMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG* |
| Ga0116834_11271512 | 3300013188 | Marine | NDMVTTGSVRNRPVITFTNGTAATRTVDVAVFIGG* |
| Ga0120045_1003593 | 3300013782 | Marine | EGEPFGASENSNYILNNMVTTGAIRNRPIITFTNSTAATRTVDVAVFIGN* |
| Ga0117790_10202531 | 3300014042 | Epidermal Mucus | GGGEPFGWKGGYVMNDMVTTNAERNRPIVTFTNTSGATREIDVAIFIGG* |
| Ga0117790_10433161 | 3300014042 | Epidermal Mucus | GGGEPFGWKGGYVMNDMVTTNAERNRPIVTFTNTSAATREIDVAIFIGG* |
| Ga0182056_11656352 | 3300016729 | Salt Marsh | EKVSGEAFGWNNTGYVLNDMITTGAERNRPVITFTNSDAASVDIEVAIFIGG |
| Ga0182084_10543851 | 3300016762 | Salt Marsh | GYVLNDMVTTGQVRNRPVVTFTNNDASSVDIEVAIFIGG |
| Ga0182063_13348051 | 3300016781 | Salt Marsh | MNDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG |
| Ga0180120_101480711 | 3300017697 | Freshwater To Marine Saline Gradient | FGASENSSYTMNNMITTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0180120_102497482 | 3300017697 | Freshwater To Marine Saline Gradient | GGYVLNDMITTGQVRNRPVVTFTNGSGSSATIDVAIFIGG |
| Ga0180120_102543761 | 3300017697 | Freshwater To Marine Saline Gradient | GYVMNDMVTTGQVRNRPVITFTNNDASSVDIEVAIFIGG |
| Ga0180120_103033492 | 3300017697 | Freshwater To Marine Saline Gradient | VTGEAFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDAASVDLEVAIFIGG |
| Ga0181387_10059821 | 3300017709 | Seawater | MNDMVTTGQVRNRPVITFTNGTASTRTIDVAIFIGG |
| Ga0181387_10717762 | 3300017709 | Seawater | GNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0181403_10073331 | 3300017710 | Seawater | VTGEPFGWNNTGYVLNDMVTTGQVRNRPVITFKNGTAATRTIDVAIFIGG |
| Ga0181403_10514422 | 3300017710 | Seawater | NDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0181412_10135684 | 3300017714 | Seawater | VTGEPFGASENSSYTMNNMITTGAIRNRPIVTFTNTTAATRTIDVAIFIGN |
| Ga0181412_10277634 | 3300017714 | Seawater | YVMNDTVTTGNVRNRPVVTFTNKDTNTAVIDVAIFIA |
| Ga0181412_10941082 | 3300017714 | Seawater | YVMNDMVTTGQVRNRPVITFNNGTSGTRVVDVAVFIGG |
| Ga0181404_10794592 | 3300017717 | Seawater | MNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG |
| Ga0181404_10815722 | 3300017717 | Seawater | FGASENSSYTMNNMITTGAIRNRPIVTFTNTTAATRTIDVAIFIGN |
| Ga0181404_11545512 | 3300017717 | Seawater | LNDMITTGAERNRPVITFTNDDASSVDIEVAIFIGG |
| Ga0181383_10112771 | 3300017720 | Seawater | TGQPFGWNNTGYVLNDMVTTGQVRNRPVITFKNGTAGTRQIDVAIFIGG |
| Ga0181383_11442621 | 3300017720 | Seawater | NTGYVMNDTVTTGSVRNRPVITFTNGTAGTRTVDVAVFIGG |
| Ga0181383_11701671 | 3300017720 | Seawater | EGSNYVMNNMVTTGAIRNRPIITFTNTTAATRTVDVAVFIGN |
| Ga0181383_11889071 | 3300017720 | Seawater | NYVMNDMVTSGQVRNRPVITFTNGTADTKTVDVAVFIGG |
| Ga0181388_10751442 | 3300017724 | Seawater | ALVTGEPFGWNGNYVMNDMVTTGQVRNRPVITFTNGTAATRVVDVSIFIGG |
| Ga0181388_11778881 | 3300017724 | Seawater | NYVMNDMVTTGQVRNRPVITFTNTSGATRTIDVAVFIGG |
| Ga0181388_11784662 | 3300017724 | Seawater | NNTGYVLNDMITTGQVRNRPVVTFTNNDASSVDLEVAIFIGG |
| Ga0181381_10338671 | 3300017726 | Seawater | MNDMITTGAVRNRPIITFTNTGSSSATIDVAVFIGSQ |
| Ga0181381_10447083 | 3300017726 | Seawater | GEPFGWNGNYTMNDMITTGQVRNRPVITFTNTTGATRTIDVAVFIGG |
| Ga0181419_10478823 | 3300017728 | Seawater | TMNNMVTTGAIRNRPIITFTNTTSGTRTVDVAVFIGN |
| Ga0181396_11050721 | 3300017729 | Seawater | ALVTGEPFGWNGNYAMNDMVTQGAVRNRPVITFTNGTSATRTVDVAVFIGG |
| Ga0181417_10878922 | 3300017730 | Seawater | AFGWRGGYVLNDMITTGQVRNRPVVTFTNGSGSSATVDVAIFIGG |
| Ga0181416_10375981 | 3300017731 | Seawater | VTGEPFGWNGNYVMNDMVTTGQVRNRPVITFTNGTAATRVVDVAVFIGG |
| Ga0181416_10488611 | 3300017731 | Seawater | MNDMVTTGGIRNRPVITFTNGTGGTRTVDVAVFIGG |
| Ga0181416_10736212 | 3300017731 | Seawater | FGWNGNYAMNDMVTTGQVRNRSVITFTNGTAATRTVDVAVFIGG |
| Ga0181416_11132492 | 3300017731 | Seawater | VLNDMVTTGQVRNRPVVQFKNGTAGTRTVDVAIFIGS |
| Ga0181415_11508602 | 3300017732 | Seawater | LNDMVTTGQVRNRPVITFTNGTSATRTIDVAIFIGG |
| Ga0181426_10065206 | 3300017733 | Seawater | WNGTGYVMNDMITTGAVRNRPIITFTNTGSSSATIDVAVFIGSQ |
| Ga0181426_10138794 | 3300017733 | Seawater | WNGNYVMNDMVTTGQVRNRPVITFTNGTAGTRTVDVAVFIGG |
| Ga0181426_11335311 | 3300017733 | Seawater | PFGWNGTGYVLNDMVTTGQVRNRPIIQFKNGTAGTRTIDVAIFIGG |
| Ga0187222_10757552 | 3300017734 | Seawater | EPFGASENSSYTMNNMVTTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0181431_10112731 | 3300017735 | Seawater | AFGWRGGYVLNDTVTTGQVRNRPVVTFTNNDAGSVDLEVAIFIGG |
| Ga0181431_10945622 | 3300017735 | Seawater | VTGEAFGWNNTGYVMNDMVTTGQVRNRPVITFTNNTAATRTVDVAVFIGG |
| Ga0181428_10197771 | 3300017738 | Seawater | NDMVTQGSVRNRPVVTFTNGTASTVTVDCAIFIGG |
| Ga0181428_11368401 | 3300017738 | Seawater | PFGWNNTGYVMNDTVTTGNVRNRPVVTFTNKDTNTAVIDVAIFIA |
| Ga0181428_11675851 | 3300017738 | Seawater | KEDKTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0181433_10130281 | 3300017739 | Seawater | VLNDMVTTGQVRNRPIIQFKNGTAGTRTVDVAVFIGG |
| Ga0181399_10132915 | 3300017742 | Seawater | FGWNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0181399_11168181 | 3300017742 | Seawater | GGYVLNDTVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG |
| Ga0181402_10486951 | 3300017743 | Seawater | EPFGASENGSYTLNNMITTGAIRNRPIVTFTNTTSGTRTIDVAIFIGN |
| Ga0181397_11277561 | 3300017744 | Seawater | GASENSSYTMNNMVTTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0181427_10840081 | 3300017745 | Seawater | GQPFGWNNTGYVLNDMVTTGQVRNRPVVTFKNGTASTRTVDVAIFIGS |
| Ga0181427_10866563 | 3300017745 | Seawater | GGYVLNDTVTTGQVRNRPVVTFTNNDAAPVDLEVAIFIGG |
| Ga0181427_11681322 | 3300017745 | Seawater | AMNDMVTTGQVRNRPVITFTNGTAATRTVDVAIFIGG |
| Ga0181427_11763711 | 3300017745 | Seawater | GASENSSYTMNNMITTGAIRNRPIITFTNTTAAARVIDVAVFIGN |
| Ga0181392_11719141 | 3300017749 | Seawater | PFGWNNTGYVMNDTVTTGNVRNRPVITFTNNDSNTAVVDVAIFIA |
| Ga0187219_11547411 | 3300017751 | Seawater | NDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG |
| Ga0187219_11562132 | 3300017751 | Seawater | PFGLNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0181400_10654311 | 3300017752 | Seawater | PFGWNGNYAMNDMVTTGQVRNRPVITFTNGTSATRTVDVAVFIGG |
| Ga0181407_10818302 | 3300017753 | Seawater | SGEAFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG |
| Ga0181407_11035991 | 3300017753 | Seawater | PFGWNGNYVMNDMVTTGQVRNRPVITFTNGTASTRTVDVAVFIGG |
| Ga0181407_11450331 | 3300017753 | Seawater | NTGYVMNDTVTTGNVRNRPVITFTNKDSNTAVIDVAIFIA |
| Ga0181411_10161015 | 3300017755 | Seawater | VSEKVTGQPFGWNNTGYVMNDTVTTGNVRNRPVVTFTNKDTNTAVIDVAIFIA |
| Ga0181411_10163411 | 3300017755 | Seawater | GYVLNNMTTTGNIRNRPIITFSNTGSATATIDVAVFIGSQS |
| Ga0181411_10182771 | 3300017755 | Seawater | KVSGEAFGWNNTGYVLNDMITTGAERNRPVITFTNDDASSVDIEVAIFIGG |
| Ga0181411_11210131 | 3300017755 | Seawater | YAMNDMVTQGAVRNIPVITFTNGTAATRTVDVAVFIGG |
| Ga0181382_10149985 | 3300017756 | Seawater | GQPFGWNNTGYVMNDTVTTGNVRNRPVITFTNKDTNSATIDVAIFIA |
| Ga0181382_11346581 | 3300017756 | Seawater | RYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAIFIGG |
| Ga0181420_10684213 | 3300017757 | Seawater | SEESAGEPFGWTGHYVMNDMVTTGAVRNRPVITFTNDDASSCTVDVAVFIS |
| Ga0181420_11406331 | 3300017757 | Seawater | NYAMNDMVTQGAVRNRPVITFTNGTSATRTVDVAVFIGG |
| Ga0181409_11179262 | 3300017758 | Seawater | TGYVMNDMVTTGQVRNRPVITFKNGTAGTRTVDVAIFIGG |
| Ga0181409_11838902 | 3300017758 | Seawater | MTTTGNIRNRPIITFTNTGGASATIDVAVFIGSQG |
| Ga0181409_12036062 | 3300017758 | Seawater | FGWRGSYVMNDMVTTGAVRNRPIITFTNGTGATRTVDVCVFIGSPS |
| Ga0181414_11371931 | 3300017759 | Seawater | FGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG |
| Ga0181414_11884482 | 3300017759 | Seawater | LNDMVTTGQVRNRPVIQFKNGTAGTRTVDVAVFIGG |
| Ga0181408_10189431 | 3300017760 | Seawater | TGYVLNDMVTTGQVRNRPIIQFKNGTSGTRTVDVAVFIGG |
| Ga0181408_10894092 | 3300017760 | Seawater | EPFGWNGNYAINDMVTQGAVRNRPVITFTNGTSATRTVDVAVFIGG |
| Ga0181408_10908712 | 3300017760 | Seawater | EPFGWNGNYAMNDMVTTGQVRNRPVITFTNGTSATRTVDVAIFIGG |
| Ga0181408_10979212 | 3300017760 | Seawater | GWRGGYVLNDMITTGQVRNRPVITFTNSSGSSATVDVAVFIGG |
| Ga0181408_11737362 | 3300017760 | Seawater | EAFGWNNTGYVMNDMVTTGQVRNRPVITFTNNTAATRTVDVAVFIGG |
| Ga0181422_11519902 | 3300017762 | Seawater | GYVLNDMITTGQVRNRPVVTFTNGSGATATVDVAIFIGG |
| Ga0181410_11509832 | 3300017763 | Seawater | NSSYTMNNMITTGAIRNRPIVTFTNTTSGTRTIDVAIFIGN |
| Ga0181385_10186845 | 3300017764 | Seawater | NSSYTMNNMVTTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0181385_10956551 | 3300017764 | Seawater | VSGLVDGEPFGWAGNYLMNDMVTTGAVRNRPVITFTNNDTNSATLDVAVFISSV |
| Ga0181385_11101561 | 3300017764 | Seawater | VSGEAFGWNGTGYVMNDMVTTGQVRNRPVITFTNNDASSVDVEVAIFIGG |
| Ga0181385_11192202 | 3300017764 | Seawater | GWNNTGYVLNDMVTTGQVRNRPVVTFTNNDAASVDIEVAIFIGG |
| Ga0181385_11791312 | 3300017764 | Seawater | AFGWRGGYVLNDMITTGQVRNRPVVTFTNGSGATATVDVAIFIGG |
| Ga0181385_12291662 | 3300017764 | Seawater | NYVMNDMVTTGAVRNRPIITFTNGTGATRTVDVCVFIGSPS |
| Ga0181385_12739482 | 3300017764 | Seawater | FGASENSSYVMNNMVTTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0181406_10152536 | 3300017767 | Seawater | EKVTGEAFGWRGGYVLNDTVTTGQVRDRPVVTFTNNDAGSVDLEVAIFIGG |
| Ga0181406_11718481 | 3300017767 | Seawater | PFGWNGNYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG |
| Ga0187220_10133081 | 3300017768 | Seawater | PFGASENSSYTMNNMITTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0187220_10143431 | 3300017768 | Seawater | GWNGNYVMNDMVTTGQVRNRPVITFTNGTASTRTIDVAIFIGG |
| Ga0187221_10179306 | 3300017769 | Seawater | SEKVSGEAFGWNNTGYVLNDMITTGAERNRPVITFTNGDASSVNVEVAIFIGG |
| Ga0181425_10370591 | 3300017771 | Seawater | VMNDMVTTGQVRNRPVITFTNGTASTRTIDVAIFIGG |
| Ga0181430_10173865 | 3300017772 | Seawater | GTGYVLNDMVTTGQVRNRPIIQFKNGTAGTRTVDVAVFIGG |
| Ga0181430_11011432 | 3300017772 | Seawater | FGWNGNYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG |
| Ga0181430_11146411 | 3300017772 | Seawater | GNYAMNDMVTTGQVRNRPVITFTNGTSATRTVDVAVFIGG |
| Ga0181430_12458022 | 3300017772 | Seawater | TGEAFGWRGGYVLNDMITTGQVRNRPVVTFTNGSGATATIDVAIFIGG |
| Ga0181386_10191411 | 3300017773 | Seawater | ALVTGEPFGWNGNYTMNDMVTTGQVRNRPVITFTNTTGATRTIDVAVFIGG |
| Ga0181386_10256294 | 3300017773 | Seawater | FGWNGTGYVLNDMVTTGQVRNRPIIQFKNGTAGTRTVDVAVFIGG |
| Ga0181386_11424261 | 3300017773 | Seawater | QPFGWNNTGYVMNDTVTTGNVRNRPVVTFTNNDTNSATVDVAIFIA |
| Ga0181394_10218045 | 3300017776 | Seawater | GWNNSGYVMNDMVTTGGIRNRPVITFTNGTGGTRTVDVAVFIGG |
| Ga0181394_11045772 | 3300017776 | Seawater | TMNNMVTTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0181394_11083531 | 3300017776 | Seawater | PFGASENSSYTMNNMVTTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0181395_12357321 | 3300017779 | Seawater | KVTGQPFGWNNTGYVMNDTVTTGNVRNRPVITFTNKDSNTAVIDVAIFIA |
| Ga0181423_10234641 | 3300017781 | Seawater | YVMNDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG |
| Ga0181423_10257735 | 3300017781 | Seawater | GEPFGWNNTGYVLNDMVTTGQVRNRPVITFKNGTGATRTIDVAVFIGG |
| Ga0181423_10308511 | 3300017781 | Seawater | MNDMVTTGAVRNRPVITFTNEDAASCTIDVAVFIA |
| Ga0181423_11193213 | 3300017781 | Seawater | WRGGYVLNDTVTTGQVRNRPVVTFTNNDAGSVDLEVAIFIGG |
| Ga0181423_11687691 | 3300017781 | Seawater | NTAYVMNDTVTTGNVRNRPVVTFTNTGGSSATIDVAIFIA |
| Ga0181423_11921882 | 3300017781 | Seawater | NGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0181423_12023792 | 3300017781 | Seawater | GWNGNYAMNDMVTTGQVRNRPVITFTNGTSATRVVDVAVFIGG |
| Ga0181423_12355121 | 3300017781 | Seawater | GYVLNDMVTTGQVRNRPIIQFKNGTAGTRTVDVAVFIGG |
| Ga0181423_12665552 | 3300017781 | Seawater | MNDMVTTGQVRNRPVITFKNGTSGTRTVDVAIFIGG |
| Ga0181380_10735754 | 3300017782 | Seawater | GGYVMNDMITTGQVRNRPVITFTNNDSSSATIDVAVFIGG |
| Ga0181380_11575231 | 3300017782 | Seawater | LVTGEPFGASENSSYTMNNMITTGAIRNRPIVTFTNTTSGTRTIDVAIFIGN |
| Ga0181380_11717372 | 3300017782 | Seawater | NDMITTGQVRNRPVITFTNGSGSSATVDVAVFIGG |
| Ga0181380_11801552 | 3300017782 | Seawater | EAFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDIEVAIFIGG |
| Ga0181380_11825802 | 3300017782 | Seawater | NDMVTTGQVRNRPVVTFTNNDASSVDIEVAIFIGG |
| Ga0181380_12083332 | 3300017782 | Seawater | AFGWRGGYVLNDTVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG |
| Ga0181380_12525631 | 3300017782 | Seawater | QPFGWNNTAYVMNDTVTTGNVRNRPVVTFTNTGGSSATIDVAIFIA |
| Ga0181380_12664762 | 3300017782 | Seawater | EPFGWNGNYTMNDMITTGQVRNRPVITFTNTTGATRTIDVAVFIGG |
| Ga0181380_13024292 | 3300017782 | Seawater | GEPFGWRGNYVMNDMVTTGAVRNRPIITFTNGTAANRTVDVCVFIGSPS |
| Ga0181379_10226445 | 3300017783 | Seawater | YVMNDTVTTGNVRNRPVITFTNKDTNSATIDVAIFIA |
| Ga0181379_10271871 | 3300017783 | Seawater | SYTMNNMITTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0181379_10272171 | 3300017783 | Seawater | SEKVSGEAFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDAASVDIEVAIFIGG |
| Ga0181379_10463474 | 3300017783 | Seawater | VMNDTVTTGNVRNRPVVTFTNKDTNTAVIDVAIFIA |
| Ga0181424_101092891 | 3300017786 | Seawater | WNNTGYVLNDMITTGQVRNRPVVTFTNNDASSVDLEVAIFIGG |
| Ga0181424_101739981 | 3300017786 | Seawater | SALVTGEPFGWNGNYAMNDMVTTGQVRNRPVITFTNGTSATRTVDVAIFIGG |
| Ga0181424_102211511 | 3300017786 | Seawater | NYAMNGMVTTGQVRNRPAITFTNGTSATRTVDVAVFIGG |
| Ga0181424_104541981 | 3300017786 | Seawater | TGEPFGWDGNYAMNDMVTTGQVRNRPVITITNGTSGTRTVDVAVFIGG |
| Ga0181577_103077222 | 3300017951 | Salt Marsh | VSEKVSGEAFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG |
| Ga0181589_108334631 | 3300017964 | Salt Marsh | YVLNDTITVGAERNRPVITFTNNDAGSVDIEVAIFIGG |
| Ga0180438_108753322 | 3300017971 | Hypersaline Lake Sediment | GYVMNDMVTTAAERNRPIITFTNTSGATREIDVAVFIGG |
| Ga0181569_103264791 | 3300017986 | Salt Marsh | NNTGYVLNDMITTGAERNRPVITFTNSDAASVDIEVAIFIGG |
| Ga0181572_104478631 | 3300018049 | Salt Marsh | VMNDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG |
| Ga0180433_105697462 | 3300018080 | Hypersaline Lake Sediment | GGEPVGWKGGYVMNDMVTTAAERNRPIVTFTNTSGATREIDVAIFIGG |
| Ga0181559_107884861 | 3300018415 | Salt Marsh | VSEKVSGEAFGWNNTGYVMNDMVTTGQVRNRPVITFTNNDASSVDIEVAILIGG |
| Ga0193547_100372382 | 3300018895 | Marine | GEAFGWRGGYVLNDMITTGQVRNRPVITFTNNDSNAATIDVAVFIGG |
| Ga0182097_15076471 | 3300019261 | Salt Marsh | GYVLNDMVTTGQVRNRPIITFTNNDASSVDIEVAVFIGG |
| Ga0182058_11799451 | 3300019283 | Salt Marsh | AFGWNNTGYVLNDMITTGAERNRPVITFTNSDAASVDIEVAIFIGG |
| Ga0181575_101444911 | 3300020055 | Salt Marsh | NTGYVLNDMVTTGQVRNRPVVTFTNNDAGSVDLEVAIFIGG |
| Ga0181574_103057591 | 3300020056 | Salt Marsh | FGWNNTGYVLNDMITTGAERNRPVITFTNSDAASVDIEVAIFIGG |
| Ga0211483_101972161 | 3300020281 | Marine | TGYVMNDMVTTGQVRNRPVITFTNGTSGTKVVDVAVFIGG |
| Ga0211476_100913101 | 3300020381 | Marine | NTGYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG |
| Ga0211677_101636811 | 3300020385 | Marine | VTGEPFGWNGNYAMNDMVTTGQVRNRPVITFTNGTSATRTVDVAVFIGG |
| Ga0211666_102020063 | 3300020392 | Marine | QPFGWNNTGYIMNDMVTQGSVRNRPVITFTNGTAATRTVDVAIFIGG |
| Ga0211636_102461091 | 3300020400 | Marine | FGWNNTGYVMNDMVTTGQVRNRPVITFTNNTAATRTVDVAVFIGG |
| Ga0211472_102702651 | 3300020409 | Marine | YVMNDMITTGAVRNRPIIQFTNTGSASADIDVAVFIGSQG |
| Ga0211699_100955723 | 3300020410 | Marine | DIVTTGQIRNRPIITFTNTGSSSATIDVAVFIGSQ |
| Ga0211580_104718551 | 3300020420 | Marine | NNTGYLMNDMVTTGQVRNRPVITFTNGTSGTRTVDVAVFIGN |
| Ga0211702_100894922 | 3300020422 | Marine | FGWSGTGYVMNDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG |
| Ga0211620_102384082 | 3300020424 | Marine | GWSGTGYVMNDMVTTGQVRNRPVITFTNGTSGTRTIDVAVFIGG |
| Ga0211539_104364981 | 3300020437 | Marine | WNNTGYVMNDMVTTGQVRNRPVITFTNGTGATRTIDVAVFIGG |
| Ga0211558_100361445 | 3300020439 | Marine | SYVMNDTIVTGAIRNRPVITFTNNTAATRTIDVAVFLSSQP |
| Ga0211558_100493681 | 3300020439 | Marine | GYVMNDMVTTGQVRNRPVITFTNNTAATRTVDVAIFIGG |
| Ga0211518_100617584 | 3300020440 | Marine | WNNTGYVLNDMVTTGQVRNRPIIQFKNGTAATRTIDVAVFIGG |
| Ga0211694_102736772 | 3300020464 | Marine | GWNGNYVMNDMVTTGQVRNRPVITFTNGTASSLEVDVAIFIGG |
| Ga0213866_101192911 | 3300021425 | Seawater | EAFGWNNTGYVLNDMTTVGAERNRPVITFTNSDASSVDVEVAIFIGG |
| Ga0212030_10654261 | 3300022053 | Aqueous | GWNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0212025_10968492 | 3300022057 | Aqueous | TGYVMNDMVTTGQVRNRPVITFTNNTAATRTVDVAIFIGG |
| Ga0212023_10406961 | 3300022061 | Aqueous | AMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0212024_10011201 | 3300022065 | Aqueous | WNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0212024_10011206 | 3300022065 | Aqueous | MNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0212024_10236431 | 3300022065 | Aqueous | EKVTGEAFGWNNTGYVLNDMITTGAERNRPVVTFTNGDAASVDVEVAIFIGG |
| Ga0212024_10377311 | 3300022065 | Aqueous | TGYVMNDMVTTGQVRNRPVITFTNNDASSVNIEVAVFIGG |
| Ga0224902_1014053 | 3300022066 | Seawater | GEPFGWNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0212021_10448352 | 3300022068 | Aqueous | PFGWNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0212021_10453572 | 3300022068 | Aqueous | VTGEPFGASENSSYTMNNMITTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0212026_10693461 | 3300022069 | Aqueous | GNYAMNDMVTTGQVRNRPVITFTNGTSATRTVDVAIFIGG |
| Ga0196889_10261753 | 3300022072 | Aqueous | TGYVMNDMVTTGQVRNRPVITFKNGTSGTRTVDVAIFIGG |
| Ga0196889_10317313 | 3300022072 | Aqueous | FFGWNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0212022_10286041 | 3300022164 | Aqueous | TGQPFGWNNTGYVMNDMVTTGQVRNRPVITFKNGTSGTRTVDVAIFIGG |
| Ga0212022_10292732 | 3300022164 | Aqueous | TGEPFGWNGNYAMNDMVTTGQVRNRPVITFTNGTSATRTVDVAIFIGG |
| Ga0212022_10390931 | 3300022164 | Aqueous | GGYVLNDMITTGQVRNRPVVTFTNGSGATATVDVAIFIGG |
| Ga0212027_10272881 | 3300022168 | Aqueous | LVTGQPFGWNNTGYVMNDMVTTGQVRNRPVITFTNNTAATRTVDVAIFIGG |
| Ga0196903_10220971 | 3300022169 | Aqueous | NSSYTMNNMITTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0196891_10231243 | 3300022183 | Aqueous | YVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG |
| Ga0196891_10543802 | 3300022183 | Aqueous | AFGWRGGYVLNDMITTGQVRNRPVVTFTNNSGSSATVDVAIFIGG |
| Ga0196891_10688411 | 3300022183 | Aqueous | LNDMITTGAERNRPVITFTNNDASSVDVEVAIFIGG |
| Ga0196899_10531234 | 3300022187 | Aqueous | YAMNDMVTQGAVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0196899_10716663 | 3300022187 | Aqueous | FGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDAASVDIEVAIFIGG |
| Ga0196899_12099622 | 3300022187 | Aqueous | VTGEPFGWNGNYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG |
| Ga0255774_100595625 | 3300023087 | Salt Marsh | EPFGWNGNYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG |
| Ga0255774_102192492 | 3300023087 | Salt Marsh | PFGWNNTGYVMNDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG |
| Ga0255774_103371571 | 3300023087 | Salt Marsh | LNDMVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG |
| Ga0255782_102297522 | 3300023105 | Salt Marsh | GYVMNDMVTTAAERNRPIVTFTNNSAATREIDVAIFIGG |
| Ga0255743_100716135 | 3300023110 | Salt Marsh | AFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG |
| (restricted) Ga0255047_105317682 | 3300024520 | Seawater | ISEKVTGEAFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDAASIDLEVAIFIGG |
| Ga0208148_10631652 | 3300025508 | Aqueous | TGEPFGWNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0208303_10150741 | 3300025543 | Aqueous | EKVSGEAFGWNNTGYVLNDMITTGQVRNRPVVTFTNNDASSVNIEVAIFIGG |
| Ga0209654_11291181 | 3300025608 | Marine | GYVMNDMVTTAAERNRPIITFTNNSGASRTIDVAVFIGG |
| Ga0208643_10195745 | 3300025645 | Aqueous | YAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0208643_10207681 | 3300025645 | Aqueous | IGNYAMNDMVTTGQVRNRPVITFTNGTSATRTVDVAVFIGG |
| Ga0208643_10944531 | 3300025645 | Aqueous | VSEDVTGEAFGWRGGYVLNDMITTGQVRNRPVVTFTNGSGSSATIDVAIFIGG |
| Ga0208795_10756741 | 3300025655 | Aqueous | VTGEPFGWNGNYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAIFIGG |
| Ga0208898_10319195 | 3300025671 | Aqueous | AISEKVTGEAFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDIEVAVFIGG |
| Ga0208162_10236785 | 3300025674 | Aqueous | EKISGEAFGWNNTGYVLNDMVTTGVERNRPVITFTNNDASSVNIEVAIFIGG |
| Ga0208150_10247855 | 3300025751 | Aqueous | NTGYVLNDMITTGAERNRPVVTFTNGDAASVDVEVAIFIGG |
| Ga0208150_11085752 | 3300025751 | Aqueous | MNDMVCTGQVRNRPVITFTNGTAATRTIDVAIFIGG |
| Ga0208899_10359921 | 3300025759 | Aqueous | YVLNDMITTGAERNRPVVTFTNGDAASVDVEVAIFIGG |
| Ga0208899_10398615 | 3300025759 | Aqueous | NYAMNDMVTTGQVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0208899_11136261 | 3300025759 | Aqueous | GWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDLEVAIFIGG |
| Ga0208899_12311842 | 3300025759 | Aqueous | GWNNTGYVLNDMVTTGQVRNRPVVTFTNNDAGSVDLEVAIFIGG |
| Ga0208767_10400811 | 3300025769 | Aqueous | GEAFGWRGGYVLNDMITTGQVRNRPVVTFTNNSGSSATVDVAIFIGG |
| Ga0208425_10122335 | 3300025803 | Aqueous | VLNDMITTGAERNRPVITFTNNDASSVDVEVAIFIGG |
| Ga0208785_10736932 | 3300025815 | Aqueous | EAFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDAASVDIEVAIFIGG |
| Ga0208542_11627901 | 3300025818 | Aqueous | QPFGWSNTGYVMNDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG |
| Ga0208645_10829024 | 3300025853 | Aqueous | ENSSYTMNNMITTGAIRNRPIITFTNTTAATRTIDVAVFIGN |
| Ga0208645_11572363 | 3300025853 | Aqueous | AVSEKVSGEAFGWNNTGYVMNDMVTTGQVRNRPIITFTNNDASSVDIEVAVFIGG |
| Ga0208544_102045201 | 3300025887 | Aqueous | GWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVDIEVAIFIGG |
| Ga0208644_10502115 | 3300025889 | Aqueous | KVSGEAFGWNNTGYVLNDMVTTGQVRNRPVVTFTNNDASSVNLEVAIFIGG |
| Ga0208815_10040121 | 3300026134 | Marine Oceanic | SGTGYVMNDMVTTGQVRNRPVITFTNNTAATRTVDVAVFIGG |
| Ga0208815_10044045 | 3300026134 | Marine Oceanic | PFGWDNTGYKMNDMVTTGGVRNRPVITFTNGTSGTRQVDVAVFIGG |
| Ga0208815_10068271 | 3300026134 | Marine Oceanic | NNTGYVMNDMVTTGGIRNRPVVTFTNGTGSTRTVDVSIFIGLPQ |
| Ga0228674_11648752 | 3300028008 | Seawater | RGNYVMNDMVTTGAVRNRPIITFTNGTAGTRTIDVCVFIGSPS |
| Ga0228674_11966031 | 3300028008 | Seawater | EPVGWNGNYAMNDMVTQGAVRNRPVITFTNGTAATRTVDVAVFIGG |
| Ga0135211_10053901 | 3300029293 | Marine Harbor | FGWNGNYVMNDMVTTGQVRNRPVITFTNGTAATRTIDVAVFIGG |
| Ga0135211_10145273 | 3300029293 | Marine Harbor | NNTGYVLNDMITTGAERNRPVITFTNSDASSVDVEVAIFIGG |
| Ga0135211_10416302 | 3300029293 | Marine Harbor | NLCQCFPVTINIGYVLNDMITTGAERNRPVITFTNGDASSVDVEVAIFIGG |
| Ga0135211_10473071 | 3300029293 | Marine Harbor | GEPFGWNGNYVMNDMVTTGQVRNRPVITFTNGTAATRTIDVAVFIGG |
| Ga0135227_10003444 | 3300029302 | Marine Harbor | GWKGGYVLNDMITTGAQRNRPVITFTNGSGASATIDVAVFIGG |
| Ga0135227_10075711 | 3300029302 | Marine Harbor | FPSHDPFGWSGTGYVMNDMVTTGSVRNRPVITFTNGTAATRTVDVAVLIGG |
| Ga0135227_10282211 | 3300029302 | Marine Harbor | TLVTGQPFGWSGTGYVMNDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG |
| Ga0135212_10240182 | 3300029306 | Marine Harbor | WNNTGYVLNDMITTGAERNRPVITFTNGDASSVDIEVAIFIGG |
| Ga0135226_10140932 | 3300029308 | Marine Harbor | FPVTIGWRGGYVLNDMVTTGQVRNRPVITFTNNSAASADIDVAIFIGG |
| Ga0135226_10205052 | 3300029308 | Marine Harbor | FPSHDPGAVRNRPVITFTNGTSATRTVDVAVFIGG |
| Ga0183683_10219181 | 3300029309 | Marine | LVTGEPFGWNGNYVMNDMVTTGQVRNRPIITFTNGTSATRTIDVAVFIGG |
| Ga0135210_10009164 | 3300029345 | Marine Harbor | VSQSRSGQVRNRPVITFTNNDSASATIDVAVFIGG |
| Ga0135210_10048883 | 3300029345 | Marine Harbor | VSQSRSTGEPFGWNGNYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG |
| Ga0135210_10081582 | 3300029345 | Marine Harbor | VSQSRSIGAERNRPVITFTNNDAASVDVEVAIFIGG |
| Ga0135210_10185352 | 3300029345 | Marine Harbor | LGFHLFPSHDPGWNNTGYVINDMVTTGQVRNRPVITFTNNDAASVDVEVAVFIGG |
| Ga0135217_1078502 | 3300029635 | Marine Harbor | SEKVSGQAFGWNNTGYVMNDMVTTGQVRNRPIITFTNNDAGSVDIEVAIFIGG |
| Ga0135224_10031041 | 3300029753 | Marine Harbor | VLNDTITDPASVRNRPVITFTNNDAASVDVEVAVYIGA |
| Ga0135224_10060111 | 3300029753 | Marine Harbor | FPVTIGNYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG |
| Ga0302118_100396301 | 3300031627 | Marine | EPFGWNGNYVMNDMVTQGAVRNRPVITFTNGTAATRTVDVAIFIGG |
| Ga0315322_103031591 | 3300031766 | Seawater | GEPFGWNGNYAMNDMVTTGQVRNRPVITFTNGTSATRTVDVAVFIGG |
| Ga0316204_105539252 | 3300032373 | Microbial Mat | TGYVMNDMVTTGNVRNRPVITFTNNTAATRTIDVAVFIGG |
| Ga0310342_1001410536 | 3300032820 | Seawater | GTGYVMNDMVTTGAVRNRPIIQFTNTGASSADIDVAVFIGSQ |
| Ga0348336_049285_9_119 | 3300034375 | Aqueous | MKDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG |
| Ga0348336_125037_3_113 | 3300034375 | Aqueous | LNDTVTVGAERNRPVVTFTNKDAAAVDIEVAIFIGG |
| Ga0348337_193096_388_516 | 3300034418 | Aqueous | WRGGYVLNDMITTGQVRNRPVVTFTNGSGSSATIDVAIFIGG |
| ⦗Top⦘ |