


| Basic Information | |
|---|---|
| Family ID | F008841 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 327 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ADGSLSAAVEHVYPLDQFKEAFEQSLKSNRSGKILFKFGAH |
| Number of Associated Samples | 231 |
| Number of Associated Scaffolds | 327 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.99 % |
| % of genes near scaffold ends (potentially truncated) | 95.11 % |
| % of genes from short scaffolds (< 2000 bps) | 93.88 % |
| Associated GOLD sequencing projects | 214 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.131 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.309 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.682 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 15.94% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 327 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 16.82 |
| PF12680 | SnoaL_2 | 5.81 |
| PF08240 | ADH_N | 5.81 |
| PF13561 | adh_short_C2 | 5.50 |
| PF12840 | HTH_20 | 5.20 |
| PF16798 | DUF5069 | 3.67 |
| PF13602 | ADH_zinc_N_2 | 1.83 |
| PF01638 | HxlR | 1.83 |
| PF06314 | ADC | 1.22 |
| PF02954 | HTH_8 | 1.22 |
| PF13977 | TetR_C_6 | 0.92 |
| PF13533 | Biotin_lipoyl_2 | 0.92 |
| PF03625 | DUF302 | 0.92 |
| PF00753 | Lactamase_B | 0.92 |
| PF16925 | TetR_C_13 | 0.92 |
| PF00873 | ACR_tran | 0.61 |
| PF03551 | PadR | 0.61 |
| PF00107 | ADH_zinc_N | 0.61 |
| PF00291 | PALP | 0.61 |
| PF00072 | Response_reg | 0.61 |
| PF03928 | HbpS-like | 0.61 |
| PF02798 | GST_N | 0.61 |
| PF02223 | Thymidylate_kin | 0.31 |
| PF13358 | DDE_3 | 0.31 |
| PF00986 | DNA_gyraseB_C | 0.31 |
| PF07508 | Recombinase | 0.31 |
| PF04366 | Ysc84 | 0.31 |
| PF00857 | Isochorismatase | 0.31 |
| PF04397 | LytTR | 0.31 |
| PF04143 | Sulf_transp | 0.31 |
| PF04851 | ResIII | 0.31 |
| PF00400 | WD40 | 0.31 |
| PF04542 | Sigma70_r2 | 0.31 |
| PF06983 | 3-dmu-9_3-mt | 0.31 |
| PF01656 | CbiA | 0.31 |
| PF02566 | OsmC | 0.31 |
| PF16884 | ADH_N_2 | 0.31 |
| PF03476 | MOSC_N | 0.31 |
| PF00150 | Cellulase | 0.31 |
| PF01799 | Fer2_2 | 0.31 |
| PF02781 | G6PD_C | 0.31 |
| PF06826 | Asp-Al_Ex | 0.31 |
| PF12867 | DinB_2 | 0.31 |
| PF08546 | ApbA_C | 0.31 |
| PF05977 | MFS_3 | 0.31 |
| PF00440 | TetR_N | 0.31 |
| PF07681 | DoxX | 0.31 |
| PF07992 | Pyr_redox_2 | 0.31 |
| PF01022 | HTH_5 | 0.31 |
| PF07690 | MFS_1 | 0.31 |
| PF00891 | Methyltransf_2 | 0.31 |
| PF04248 | NTP_transf_9 | 0.31 |
| PF00092 | VWA | 0.31 |
| PF04392 | ABC_sub_bind | 0.31 |
| PF05524 | PEP-utilisers_N | 0.31 |
| PF00034 | Cytochrom_C | 0.31 |
| PF04075 | F420H2_quin_red | 0.31 |
| PF03060 | NMO | 0.31 |
| PF01609 | DDE_Tnp_1 | 0.31 |
| PF14552 | Tautomerase_2 | 0.31 |
| PF02826 | 2-Hacid_dh_C | 0.31 |
| PF07080 | DUF1348 | 0.31 |
| PF00589 | Phage_integrase | 0.31 |
| PF12852 | Cupin_6 | 0.31 |
| PF07494 | Reg_prop | 0.31 |
| PF07676 | PD40 | 0.31 |
| PF04545 | Sigma70_r4 | 0.31 |
| PF03466 | LysR_substrate | 0.31 |
| PF00582 | Usp | 0.31 |
| PF00201 | UDPGT | 0.31 |
| PF00196 | GerE | 0.31 |
| PF00108 | Thiolase_N | 0.31 |
| PF00578 | AhpC-TSA | 0.31 |
| PF02771 | Acyl-CoA_dh_N | 0.31 |
| PF13565 | HTH_32 | 0.31 |
| PF13518 | HTH_28 | 0.31 |
| PF00144 | Beta-lactamase | 0.31 |
| PF13005 | zf-IS66 | 0.31 |
| COG ID | Name | Functional Category | % Frequency in 327 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.45 |
| COG4689 | Acetoacetate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.22 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.92 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.61 |
| COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 0.61 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.61 |
| COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.31 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.31 |
| COG0187 | DNA gyrase/topoisomerase IV, subunit B | Replication, recombination and repair [L] | 0.31 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.31 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.31 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.31 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.31 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.31 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.31 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.31 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.31 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.31 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.31 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.31 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.31 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.31 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.31 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.31 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.31 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.31 |
| COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.31 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.31 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.31 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.31 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.31 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.31 |
| COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 0.31 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.31 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.31 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.31 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.31 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.31 |
| COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 0.31 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.31 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.31 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.31 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.31 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.31 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.31 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.13 % |
| Unclassified | root | N/A | 8.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01CG24B | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 2170459002|F0B48LX02HIJKU | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300001641|JGI20238J16299_102961 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101044285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300002908|JGI25382J43887_10305672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300004080|Ga0062385_10067213 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300004091|Ga0062387_100519113 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300004092|Ga0062389_101042618 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300004092|Ga0062389_103012032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 630 | Open in IMG/M |
| 3300004092|Ga0062389_104352447 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005174|Ga0066680_10220169 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300005174|Ga0066680_10832474 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005175|Ga0066673_10909042 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005177|Ga0066690_10091358 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
| 3300005181|Ga0066678_10467379 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005186|Ga0066676_11030416 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005289|Ga0065704_10049399 | Not Available | 678 | Open in IMG/M |
| 3300005294|Ga0065705_10259527 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300005328|Ga0070676_11415776 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005330|Ga0070690_100182581 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300005332|Ga0066388_100449804 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
| 3300005332|Ga0066388_105293398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300005332|Ga0066388_105574671 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005335|Ga0070666_10329886 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300005341|Ga0070691_10276971 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005345|Ga0070692_10800098 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005347|Ga0070668_100721397 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300005364|Ga0070673_101663568 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005367|Ga0070667_101234564 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005436|Ga0070713_102058113 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005440|Ga0070705_101759473 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005441|Ga0070700_100473605 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300005445|Ga0070708_100754823 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005445|Ga0070708_101107973 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005457|Ga0070662_100238453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1458 | Open in IMG/M |
| 3300005467|Ga0070706_100513553 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300005468|Ga0070707_100077853 | All Organisms → cellular organisms → Bacteria | 3199 | Open in IMG/M |
| 3300005468|Ga0070707_100282969 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300005468|Ga0070707_100388722 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300005468|Ga0070707_100801307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 906 | Open in IMG/M |
| 3300005468|Ga0070707_101823538 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005518|Ga0070699_100228119 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300005545|Ga0070695_100289135 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300005556|Ga0066707_10156255 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300005617|Ga0068859_100244902 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300005840|Ga0068870_10483492 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300005843|Ga0068860_100714130 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300006028|Ga0070717_10298818 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300006028|Ga0070717_11523523 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006031|Ga0066651_10338469 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300006049|Ga0075417_10179308 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300006173|Ga0070716_100180143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1386 | Open in IMG/M |
| 3300006173|Ga0070716_100729501 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300006176|Ga0070765_100849262 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300006794|Ga0066658_10014293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2988 | Open in IMG/M |
| 3300006797|Ga0066659_10782891 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300006800|Ga0066660_10077591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2277 | Open in IMG/M |
| 3300006854|Ga0075425_101680406 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300006854|Ga0075425_102268113 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300006871|Ga0075434_100556667 | Not Available | 1166 | Open in IMG/M |
| 3300006871|Ga0075434_100864679 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300006871|Ga0075434_100935039 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300006903|Ga0075426_10441025 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300006903|Ga0075426_10858215 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300007255|Ga0099791_10344431 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300007265|Ga0099794_10469134 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 661 | Open in IMG/M |
| 3300009012|Ga0066710_100948231 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300009012|Ga0066710_102860199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 679 | Open in IMG/M |
| 3300009038|Ga0099829_10077279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2538 | Open in IMG/M |
| 3300009038|Ga0099829_10241251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1472 | Open in IMG/M |
| 3300009038|Ga0099829_11751922 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009088|Ga0099830_11238470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300009089|Ga0099828_10298410 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300009089|Ga0099828_10323326 | Not Available | 1389 | Open in IMG/M |
| 3300009089|Ga0099828_11114172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300009089|Ga0099828_11985402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300009090|Ga0099827_10054497 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
| 3300009147|Ga0114129_10240645 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
| 3300009147|Ga0114129_10995882 | Not Available | 1056 | Open in IMG/M |
| 3300009147|Ga0114129_11371299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300009156|Ga0111538_13097798 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300009162|Ga0075423_10549435 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300009176|Ga0105242_10695911 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300009177|Ga0105248_12047544 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009521|Ga0116222_1371931 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300009545|Ga0105237_11112387 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300009553|Ga0105249_13517564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 504 | Open in IMG/M |
| 3300010043|Ga0126380_10375590 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300010046|Ga0126384_10442850 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300010154|Ga0127503_10152195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. AZCC_0083 | 1653 | Open in IMG/M |
| 3300010159|Ga0099796_10349026 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 637 | Open in IMG/M |
| 3300010301|Ga0134070_10158597 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300010301|Ga0134070_10318052 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010304|Ga0134088_10151822 | Not Available | 1102 | Open in IMG/M |
| 3300010304|Ga0134088_10419816 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300010326|Ga0134065_10162936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 786 | Open in IMG/M |
| 3300010333|Ga0134080_10519003 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010336|Ga0134071_10553111 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010361|Ga0126378_10589735 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300010366|Ga0126379_12103465 | Not Available | 666 | Open in IMG/M |
| 3300010376|Ga0126381_104954635 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010379|Ga0136449_102668384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 710 | Open in IMG/M |
| 3300010397|Ga0134124_11806157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 645 | Open in IMG/M |
| 3300010397|Ga0134124_12843744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300010399|Ga0134127_11889083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 674 | Open in IMG/M |
| 3300010403|Ga0134123_13587581 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300011119|Ga0105246_11565761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 621 | Open in IMG/M |
| 3300011120|Ga0150983_15380852 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300011269|Ga0137392_10493371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
| 3300011270|Ga0137391_10103904 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300011270|Ga0137391_10479399 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300011270|Ga0137391_10573502 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300011271|Ga0137393_10760719 | Not Available | 829 | Open in IMG/M |
| 3300011271|Ga0137393_10988041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300012096|Ga0137389_10361128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1237 | Open in IMG/M |
| 3300012096|Ga0137389_10745745 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300012096|Ga0137389_11286107 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012189|Ga0137388_10182292 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300012189|Ga0137388_10558762 | Not Available | 1064 | Open in IMG/M |
| 3300012189|Ga0137388_10999040 | Not Available | 772 | Open in IMG/M |
| 3300012189|Ga0137388_11052090 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300012189|Ga0137388_11350088 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012200|Ga0137382_10885059 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012202|Ga0137363_10392044 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300012202|Ga0137363_10790079 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 805 | Open in IMG/M |
| 3300012202|Ga0137363_11190984 | Not Available | 648 | Open in IMG/M |
| 3300012202|Ga0137363_11228175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300012202|Ga0137363_11501142 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
| 3300012202|Ga0137363_11813124 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012203|Ga0137399_11420322 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012205|Ga0137362_10901967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300012205|Ga0137362_10980662 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012205|Ga0137362_11270112 | Not Available | 621 | Open in IMG/M |
| 3300012208|Ga0137376_11479950 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300012209|Ga0137379_11826023 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012210|Ga0137378_10623203 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300012211|Ga0137377_11263605 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012211|Ga0137377_11360457 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012285|Ga0137370_10034775 | All Organisms → cellular organisms → Bacteria | 2640 | Open in IMG/M |
| 3300012349|Ga0137387_10204763 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300012359|Ga0137385_10704846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 843 | Open in IMG/M |
| 3300012361|Ga0137360_10431616 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300012361|Ga0137360_10729701 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300012361|Ga0137360_11098513 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300012362|Ga0137361_11943454 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012363|Ga0137390_11879689 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012582|Ga0137358_10002729 | All Organisms → cellular organisms → Bacteria | 10086 | Open in IMG/M |
| 3300012683|Ga0137398_10503154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pelagivirga → Pelagivirga sediminicola | 833 | Open in IMG/M |
| 3300012683|Ga0137398_10778859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 668 | Open in IMG/M |
| 3300012683|Ga0137398_10924606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 607 | Open in IMG/M |
| 3300012685|Ga0137397_11355384 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012917|Ga0137395_10013673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4525 | Open in IMG/M |
| 3300012917|Ga0137395_10693795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 737 | Open in IMG/M |
| 3300012917|Ga0137395_10796474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 684 | Open in IMG/M |
| 3300012918|Ga0137396_10872130 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012918|Ga0137396_11190761 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012922|Ga0137394_10359671 | Not Available | 1242 | Open in IMG/M |
| 3300012923|Ga0137359_10061865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3263 | Open in IMG/M |
| 3300012923|Ga0137359_10346186 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1321 | Open in IMG/M |
| 3300012923|Ga0137359_10720277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300012924|Ga0137413_11466792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 553 | Open in IMG/M |
| 3300012925|Ga0137419_10258823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1314 | Open in IMG/M |
| 3300012927|Ga0137416_10331126 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300012927|Ga0137416_11284313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 661 | Open in IMG/M |
| 3300012929|Ga0137404_10394906 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300012929|Ga0137404_11249759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 684 | Open in IMG/M |
| 3300012929|Ga0137404_12048879 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012930|Ga0137407_10947942 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 815 | Open in IMG/M |
| 3300012957|Ga0164303_10389559 | Not Available | 857 | Open in IMG/M |
| 3300012958|Ga0164299_10145945 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300012972|Ga0134077_10125648 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300012984|Ga0164309_10426832 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012986|Ga0164304_10382146 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300013102|Ga0157371_11148557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 597 | Open in IMG/M |
| 3300013102|Ga0157371_11543571 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300013297|Ga0157378_12052766 | Not Available | 622 | Open in IMG/M |
| 3300013308|Ga0157375_11202094 | Not Available | 889 | Open in IMG/M |
| 3300013308|Ga0157375_11376695 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300014166|Ga0134079_10402597 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300014745|Ga0157377_10662218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 753 | Open in IMG/M |
| 3300014968|Ga0157379_10689214 | Not Available | 958 | Open in IMG/M |
| 3300015054|Ga0137420_1273456 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300015054|Ga0137420_1444605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1315 | Open in IMG/M |
| 3300015241|Ga0137418_10032094 | All Organisms → cellular organisms → Bacteria | 4863 | Open in IMG/M |
| 3300015264|Ga0137403_10407402 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300015264|Ga0137403_10669404 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300015371|Ga0132258_10904418 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
| 3300015371|Ga0132258_12073270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1430 | Open in IMG/M |
| 3300015373|Ga0132257_104067641 | Not Available | 532 | Open in IMG/M |
| 3300016294|Ga0182041_10538085 | Not Available | 1018 | Open in IMG/M |
| 3300016294|Ga0182041_11390542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 644 | Open in IMG/M |
| 3300016357|Ga0182032_10622772 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300016404|Ga0182037_10326878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1241 | Open in IMG/M |
| 3300018007|Ga0187805_10254220 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300018468|Ga0066662_12500336 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300018469|Ga0190270_11545335 | Not Available | 714 | Open in IMG/M |
| 3300018482|Ga0066669_10725766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 876 | Open in IMG/M |
| 3300019878|Ga0193715_1063316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300020004|Ga0193755_1042980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1482 | Open in IMG/M |
| 3300020170|Ga0179594_10312796 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300020199|Ga0179592_10437373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Chthonomonadetes → Chthonomonadales → Chthonomonadaceae → Chthonomonas | 567 | Open in IMG/M |
| 3300020579|Ga0210407_10854939 | Not Available | 699 | Open in IMG/M |
| 3300020579|Ga0210407_11442354 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300020580|Ga0210403_10295148 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300020580|Ga0210403_10753130 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300020580|Ga0210403_10935673 | Not Available | 681 | Open in IMG/M |
| 3300020583|Ga0210401_10400722 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300020583|Ga0210401_10476675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1110 | Open in IMG/M |
| 3300021046|Ga0215015_10435179 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300021046|Ga0215015_10898899 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300021086|Ga0179596_10413870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300021088|Ga0210404_10345164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300021151|Ga0179584_1099915 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300021168|Ga0210406_10329673 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300021170|Ga0210400_10513100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 989 | Open in IMG/M |
| 3300021170|Ga0210400_10759829 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300021171|Ga0210405_10922949 | Not Available | 662 | Open in IMG/M |
| 3300021178|Ga0210408_10264956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1369 | Open in IMG/M |
| 3300021180|Ga0210396_11019780 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300021344|Ga0193719_10220424 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300021402|Ga0210385_11323735 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021402|Ga0210385_11333481 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300021405|Ga0210387_10947169 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300021411|Ga0193709_1110036 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021420|Ga0210394_10393165 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300021420|Ga0210394_10936951 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300021432|Ga0210384_10818646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300021432|Ga0210384_11158544 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300021432|Ga0210384_11192748 | Not Available | 665 | Open in IMG/M |
| 3300021478|Ga0210402_10602770 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300021479|Ga0210410_11222287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300021479|Ga0210410_11226913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300024288|Ga0179589_10528805 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300024331|Ga0247668_1090930 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 617 | Open in IMG/M |
| 3300025315|Ga0207697_10239808 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300025898|Ga0207692_10522081 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300025898|Ga0207692_10759556 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300025903|Ga0207680_10207749 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300025910|Ga0207684_10356609 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300025910|Ga0207684_10465921 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1084 | Open in IMG/M |
| 3300025910|Ga0207684_10496847 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300025914|Ga0207671_10172583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1680 | Open in IMG/M |
| 3300025914|Ga0207671_11112779 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Myroides → Myroides marinus | 620 | Open in IMG/M |
| 3300025922|Ga0207646_10305573 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300025922|Ga0207646_10612639 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300025922|Ga0207646_11079247 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300025929|Ga0207664_11012264 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300025933|Ga0207706_10254597 | Not Available | 1533 | Open in IMG/M |
| 3300025935|Ga0207709_10433442 | Not Available | 1012 | Open in IMG/M |
| 3300025939|Ga0207665_10681879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 807 | Open in IMG/M |
| 3300025960|Ga0207651_10714898 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300026088|Ga0207641_10515366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1163 | Open in IMG/M |
| 3300026295|Ga0209234_1083879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1209 | Open in IMG/M |
| 3300026295|Ga0209234_1196456 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300026297|Ga0209237_1213275 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300026298|Ga0209236_1064480 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300026300|Ga0209027_1082594 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300026318|Ga0209471_1065575 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300026322|Ga0209687_1263184 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300026325|Ga0209152_10158563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300026326|Ga0209801_1203904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 789 | Open in IMG/M |
| 3300026328|Ga0209802_1279743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300026330|Ga0209473_1009295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4936 | Open in IMG/M |
| 3300026332|Ga0209803_1030239 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
| 3300026333|Ga0209158_1336562 | Not Available | 523 | Open in IMG/M |
| 3300026335|Ga0209804_1114309 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300026360|Ga0257173_1026875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 749 | Open in IMG/M |
| 3300026498|Ga0257156_1022504 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1256 | Open in IMG/M |
| 3300026498|Ga0257156_1074632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300026524|Ga0209690_1016304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3839 | Open in IMG/M |
| 3300026550|Ga0209474_10777675 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300027050|Ga0209325_1020140 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300027071|Ga0209214_1026261 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300027376|Ga0209004_1067317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 605 | Open in IMG/M |
| 3300027502|Ga0209622_1004667 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
| 3300027546|Ga0208984_1091335 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300027562|Ga0209735_1037619 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300027629|Ga0209422_1014444 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
| 3300027633|Ga0208988_1019692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1727 | Open in IMG/M |
| 3300027645|Ga0209117_1055262 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300027651|Ga0209217_1071038 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300027812|Ga0209656_10005956 | All Organisms → cellular organisms → Bacteria | 7829 | Open in IMG/M |
| 3300027846|Ga0209180_10472830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300027862|Ga0209701_10349706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300027903|Ga0209488_10654336 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300027903|Ga0209488_11141520 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300027909|Ga0209382_11054035 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300028047|Ga0209526_10718216 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300028380|Ga0268265_11697557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 637 | Open in IMG/M |
| 3300028380|Ga0268265_12188616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 560 | Open in IMG/M |
| 3300028536|Ga0137415_10576366 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 935 | Open in IMG/M |
| 3300028597|Ga0247820_11311635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 525 | Open in IMG/M |
| 3300028784|Ga0307282_10677940 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300028791|Ga0307290_10321048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 567 | Open in IMG/M |
| 3300029636|Ga0222749_10248830 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300031057|Ga0170834_103166498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1198 | Open in IMG/M |
| 3300031057|Ga0170834_105386246 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031057|Ga0170834_113979414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 571 | Open in IMG/M |
| 3300031122|Ga0170822_15952685 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031231|Ga0170824_103695510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 640 | Open in IMG/M |
| 3300031231|Ga0170824_106010531 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300031720|Ga0307469_10128056 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300031740|Ga0307468_100935098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300031753|Ga0307477_10769919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300031820|Ga0307473_10647256 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031820|Ga0307473_10768845 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300031820|Ga0307473_11574141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 500 | Open in IMG/M |
| 3300031908|Ga0310900_11288667 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031912|Ga0306921_11694239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300031942|Ga0310916_11404111 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031943|Ga0310885_10526624 | Not Available | 647 | Open in IMG/M |
| 3300031962|Ga0307479_10031677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5040 | Open in IMG/M |
| 3300031962|Ga0307479_11050095 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300031962|Ga0307479_11710804 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300032059|Ga0318533_10147983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1660 | Open in IMG/M |
| 3300032174|Ga0307470_11363716 | Not Available | 584 | Open in IMG/M |
| 3300032174|Ga0307470_11520599 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300032180|Ga0307471_101762925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 771 | Open in IMG/M |
| 3300032180|Ga0307471_102176275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300032180|Ga0307471_102704774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300032180|Ga0307471_103172711 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
| 3300032205|Ga0307472_100226489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1445 | Open in IMG/M |
| 3300032205|Ga0307472_101994387 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032205|Ga0307472_102287327 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032261|Ga0306920_104191036 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300032515|Ga0348332_10975327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.28% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.31% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.31% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.31% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.31% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.31% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300001641 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_136740 | 2040502001 | Soil | GSLSAAVEHVYPLEQFKEAFEQSLKSNRSGKILFKFSA |
| E1_07972960 | 2170459002 | Grass Soil | VADGSLSAAVEHVYPLDQFKEAFRQSLKSNRSGKILFKF |
| JGI20238J16299_1029612 | 3300001641 | Forest Soil | GSLSAAVEQVYPLDQFKQAIDRSLKSSRYGKILFKFDAG* |
| JGIcombinedJ26739_1010442852 | 3300002245 | Forest Soil | ADGSLSSAVDHVYPLDQFKEAFKQSLKSNRSGKILFQFGGNDVAGISK* |
| JGI25382J43887_103056722 | 3300002908 | Grasslands Soil | DLVADGSLSAAVEHVYPLDQFKEAFKQSLKSHRAGKILFKFGTGGSTLASR* |
| Ga0062385_100672131 | 3300004080 | Bog Forest Soil | GDLVADGSLSAAVEHVYPLDQFKEAFRQSLTSNRSGKVLFKF* |
| Ga0062387_1005191132 | 3300004091 | Bog Forest Soil | EIYQKLGDLVADGSLFAAVEHVYPLDQFKEAFKQSLKSNRNGKILFQFGATDVAVISK* |
| Ga0062389_1010426181 | 3300004092 | Bog Forest Soil | QTLGGLVADGSLSAAVEQVYPIEQFKEAFERSLKSNRSGKILFKFGAH* |
| Ga0062389_1030120321 | 3300004092 | Bog Forest Soil | LYQKLADLVADGSLSAAVEHVCPLDQFKQAIDRSLKSNRSGKILFKFDAD* |
| Ga0062389_1043524472 | 3300004092 | Bog Forest Soil | DGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGATDVTVTA* |
| Ga0066680_102201691 | 3300005174 | Soil | VADGSLSAAVEHVYPLAQFKEAFRQSLKSNRSGKILFQFGATDQTDRG* |
| Ga0066680_108324741 | 3300005174 | Soil | KLGDLVADGSLYAAVEHVYPLDQFKEAIKRSLRSNRGGKILFQFGAH* |
| Ga0066673_109090422 | 3300005175 | Soil | ADGSLSAAVEHVYPLDQFKEAFRQSLKSNRSGKILFQFGATAQGRLSKKR* |
| Ga0066690_100913581 | 3300005177 | Soil | GSLSAAVEHVYPLDQFKEAFKQSLQSNRSGKILFKFGSTDVAMISK* |
| Ga0066678_104673792 | 3300005181 | Soil | QKLGDLVADGSLSAAVEHVYRLDQFKEAFKQSLQSNRSGKILFKFGTHGSI* |
| Ga0066676_110304161 | 3300005186 | Soil | KLGDLVADGSLSAAVEHVYPLEQFKEAFEQSLKSNRSGKILFKFDAH* |
| Ga0065704_100493991 | 3300005289 | Switchgrass Rhizosphere | ADGSLSAAVEHVYPLDQFKEAFEESLKSNRSGKILFEFRA* |
| Ga0065705_102595273 | 3300005294 | Switchgrass Rhizosphere | GALVADGSLSAAVEHVYPLEQFKEAFEHSSRSSRNGKILFKFDASEVRA* |
| Ga0070676_114157762 | 3300005328 | Miscanthus Rhizosphere | GDLVADGSLSAAVEQIYPLEQFKQAFEQSLKPNRGGKILFKF* |
| Ga0070690_1001825812 | 3300005330 | Switchgrass Rhizosphere | VADGSLSAAVEHVYPLEQFKEAFERSLKSQRSGKVLFKLGHH* |
| Ga0066388_1004498044 | 3300005332 | Tropical Forest Soil | MRERTPLPPSQKLGDLVANGSLSAAVEHTYPLEEFKQAIKQCLQSNRSGKILFQFGVH* |
| Ga0066388_1052933982 | 3300005332 | Tropical Forest Soil | VTDGSLSAAVEQVYPLEQFKKAFEQSLKPNRGGKILFKFGAGDDVSASK* |
| Ga0066388_1055746712 | 3300005332 | Tropical Forest Soil | LSAAVEQVYPLEQFKKAFEQSLKPNRGGKILFKFGAGDDVSASK* |
| Ga0070666_103298861 | 3300005335 | Switchgrass Rhizosphere | VADGSLSAAVEHVYPLEQFKEAFERSLKSQRSGKVLFKLGH |
| Ga0070691_102769711 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | QKLGDLVADGSLSAVVETVYALEQFKEAFDQSLKSKRGGKILFKFGATH* |
| Ga0070692_108000982 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | EIYRKLGDLVADGSLSAAVEHVYPLEQFNEAFAHSLRSSRNGKILFKF* |
| Ga0070668_1007213971 | 3300005347 | Switchgrass Rhizosphere | GDLVADGSLSAAVEHVYPLEQFKEAFERSLKSQRSGKVLFKLGHH* |
| Ga0070673_1016635681 | 3300005364 | Switchgrass Rhizosphere | LGDLVADGSLSAAVEHVYPLEQFKEAFEHSLRSSRSGKVLFKFGASEATR* |
| Ga0070667_1012345641 | 3300005367 | Switchgrass Rhizosphere | KLGDLVADGSLSAAVEQIYPLEQFKQAFEQSLKPNRGGKILFKF* |
| Ga0070713_1020581131 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLVADGSLSAAVEHVYPLDQFKEAFRQSLKSNRSGKILFKF* |
| Ga0070705_1017594731 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLVAEGSLSAAVEHVYPLDHFKDAFKHSLQPNRSGKILFKLGAH* |
| Ga0070700_1004736052 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | QEIYQKLGDLVADGSLSAAVEHVYPLDHFKDAFKHSLKPNRSGKILFKFGAR* |
| Ga0070708_1007548233 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | QKLGDLVADGSLSAAVEQVYPLDQFKEAFKQSLKSSRSGKILFKFGATDAAMISK* |
| Ga0070708_1011079732 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLQSNRSGKILFKFGGNDLAMISK* |
| Ga0070662_1002384534 | 3300005457 | Corn Rhizosphere | VADGSLSAVVETVYALEQFKEAFDQSLKSKRGGKILFKFGATH* |
| Ga0070706_1005135533 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGADGSTLASH* |
| Ga0070707_1000778531 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | KLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFQATDVAVISK* |
| Ga0070707_1002829691 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGATDVAGISK* |
| Ga0070707_1003887222 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MYQRLGDLVTDGSLSAAVAQVYPLEQFKEAIKHSLTSNRSGKILFKFGATDR* |
| Ga0070707_1008013072 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MERSLLAVEQVYPLEQFKEGFEQSLKSNRSGKILFKFGPTA* |
| Ga0070707_1018235382 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGAADVATISK* |
| Ga0070699_1002281193 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | YQKLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKTLFKFGATDVAMISK* |
| Ga0070697_1015490202 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DLVADGSLSAIVEHVYPLDRFKEAFKQSLQSNRGGKVLFKFGDTDRQSRVAPSPQTSKRK |
| Ga0070695_1002891353 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VADGSLSAAVEHVYPLEQFKEAFAHSLRSSRNGKILFKFGAIGHR* |
| Ga0066707_101562551 | 3300005556 | Soil | LGDLVADGSLSAAVEHVYPLAQFKEAFRQSLKSNRSGKILFQFWGH* |
| Ga0068859_1002449024 | 3300005617 | Switchgrass Rhizosphere | SLSAAVEHVYPLEQFKEAFEHSLRPSRNGKILFKFGASEVTT* |
| Ga0068870_104834921 | 3300005840 | Miscanthus Rhizosphere | TYQKLGELVADGSLSAAVEHVYPLDQFKEAFEESLKSNRSGKVLFKFRA* |
| Ga0068860_1007141303 | 3300005843 | Switchgrass Rhizosphere | VADGSLSAAVEHVYPIEQFKEAFEHSLRSSRNGKILFKF* |
| Ga0070717_102988183 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLVADGSLSAAVDHVYRLDQFKKAFEQSLKPNRSGKILFKFGRN* |
| Ga0070717_115235232 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LGDLVADGSLSAAVEHVYPLDEFKEAFKQSLKSNRSGKILFQFGAN* |
| Ga0066651_103384692 | 3300006031 | Soil | ADGSLSAAVDHVYALDDFKEAFDQSLKSNRSGKILFKFGNY* |
| Ga0075417_101793082 | 3300006049 | Populus Rhizosphere | SAAVEHVYPLDQFKEAFEESLKSNRSGKILFKFRA* |
| Ga0070716_1001801431 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SAAVEHVYPLDQFKDAIERSLRSNRGGKILFQFGAH* |
| Ga0070716_1007295011 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KLGELVADGSLSATVEHVYPLDQFKEAFKQSLKSNRSGKVLFKFA* |
| Ga0070765_1008492623 | 3300006176 | Soil | VADGSLSAAVEQVYPLEQFKEAFKQSLKSNRTGKILFRFSEEGKDDNQKSRD* |
| Ga0066658_100142937 | 3300006794 | Soil | VAGGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFVDY* |
| Ga0066659_107828913 | 3300006797 | Soil | AVEHVYPLDQFKEAIKRSLRSNRGGKILFQFGAQ* |
| Ga0066660_100775913 | 3300006800 | Soil | VADGSLSATVDRVYPLERFKEAFEQSLKPNRSGKVLFKFGDNP* |
| Ga0075425_1016804062 | 3300006854 | Populus Rhizosphere | LVADRSLSATVEHVYSLDQFKEAFKQSLKSNRSGKVLFKFA* |
| Ga0075425_1022681131 | 3300006854 | Populus Rhizosphere | SLSAAVEQVYPLDEFKEAFKQSLKSNRSGKILFQFGATDVAVISK* |
| Ga0075434_1005566671 | 3300006871 | Populus Rhizosphere | DGSLSATIERVYPLEEFKEAFEQSLKWNRNGKVLFKFSNQK* |
| Ga0075434_1008646791 | 3300006871 | Populus Rhizosphere | LSAAVEHVYPLDQFKEAFEESLKSNRSGKILFKFRA* |
| Ga0075434_1009350392 | 3300006871 | Populus Rhizosphere | DGSLSAAVEHVYPLDQFKEAFEQSLKSNRSGKILFKFRA* |
| Ga0075426_104410253 | 3300006903 | Populus Rhizosphere | AAVEHVYPLEQFKEALKQSLKSNRSGKILFEFGAH* |
| Ga0075426_108582152 | 3300006903 | Populus Rhizosphere | GDLVADGSLSAAVEQIYPLDEFKEAFKQSLKSNRSGKILFKFEATDVAMISK* |
| Ga0099791_103444311 | 3300007255 | Vadose Zone Soil | VADGSLSAAVGHVYPLDQFKEAFRQSLKSNRSGKILFRFGATDQSDRG* |
| Ga0099794_104691342 | 3300007265 | Vadose Zone Soil | RAEIRETYQKLGALVADGSLSAAVEHVYPLEQFKQAFEHSLRSSRDGKILFKFGAIGHR* |
| Ga0066710_1009482311 | 3300009012 | Grasslands Soil | AAVEHVYPLEQFKEAFEHSLRPSRNGKILFKFGAIGHR |
| Ga0066710_1028601992 | 3300009012 | Grasslands Soil | ADGSLSAAVEHVYPLDQFKEAFKQSLQSNRSGKILFKFGANDVAMISK |
| Ga0099829_100772794 | 3300009038 | Vadose Zone Soil | LGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKF* |
| Ga0099829_102412513 | 3300009038 | Vadose Zone Soil | LVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGGYEK* |
| Ga0099829_117519221 | 3300009038 | Vadose Zone Soil | DLVADGSLSAVVEHVYPLDQFKEAFKQSLLSNRSGKILFKFGANDVATISK* |
| Ga0099830_112384701 | 3300009088 | Vadose Zone Soil | LVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGAADVAVISK* |
| Ga0099828_102984101 | 3300009089 | Vadose Zone Soil | LVAGGSLSAAVEHVYPLEQFKEAIKRSLRSNRGGKILFQFGAH* |
| Ga0099828_103233262 | 3300009089 | Vadose Zone Soil | DLVADGSLSAAVEHVYPLDQFKEAFKQSLQSNRSGKILFKFGATDQTDRG* |
| Ga0099828_111141721 | 3300009089 | Vadose Zone Soil | DLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFVDY* |
| Ga0099828_119854021 | 3300009089 | Vadose Zone Soil | DLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKF* |
| Ga0099827_100544971 | 3300009090 | Vadose Zone Soil | KLGDLVADGSLYAAVEHVYPLEQFKEAFTRSLRSHRGGKILFQFGH* |
| Ga0114129_102406454 | 3300009147 | Populus Rhizosphere | ATIERVYPLEEFKEAFEQSLKWNRNGKVLFKFSNQE* |
| Ga0114129_109958821 | 3300009147 | Populus Rhizosphere | LSATIERVYPLEEFKEAFEQSLKWNRNGKVLFKFSNQE* |
| Ga0114129_113712992 | 3300009147 | Populus Rhizosphere | YQKLGDLVADGSLSATGDHVYPLDQFKEAFDQSLKPNRRGKILFEFK* |
| Ga0111538_130977981 | 3300009156 | Populus Rhizosphere | DGSLSAAVEHVYPLEQFKEAFEHSLKSQRSGKVLFKLGHP* |
| Ga0075423_105494351 | 3300009162 | Populus Rhizosphere | KLGDLVADGSLSAAVEHVYPLEQFKEAFERSLKSNRSGKILFKFGVH* |
| Ga0105242_106959112 | 3300009176 | Miscanthus Rhizosphere | DGSLSAAVEKVYPLEQFKEAFGQSLKPNRSGKILFKF* |
| Ga0105248_120475442 | 3300009177 | Switchgrass Rhizosphere | LGDLVADGSLSAAVEQVYPLEQFKEAFEQSLKSNRSGKILFQFGAQGR* |
| Ga0116222_13719312 | 3300009521 | Peatlands Soil | GDRVADGSLSAAVEHVYPLEQFKEAFKQSLKSNRSGKILFKFGATD* |
| Ga0105237_111123872 | 3300009545 | Corn Rhizosphere | DLVADGSLSAAVEQVYPLAQFKEAFKQSLKSNRSGKVLFKFGATDVAMISK* |
| Ga0105249_135175642 | 3300009553 | Switchgrass Rhizosphere | VVETVYALEQFKEAFDQSLKSNRGGKILFKFGATH* |
| Ga0126380_103755902 | 3300010043 | Tropical Forest Soil | SAAVEQVYPLEQFKKAFEQSLKPNRGGKILFKFGAGDDVSDSK* |
| Ga0126384_104428502 | 3300010046 | Tropical Forest Soil | LGDLVADGSLSATVEHVYPLEQFKEAITQSVKSNRSGKILFKFGATDR* |
| Ga0127503_101521952 | 3300010154 | Soil | RSLSAVVETVYPLEQFKEAFDQSLKSNRGGKILFKFGATH* |
| Ga0099796_103490261 | 3300010159 | Vadose Zone Soil | KLGDLVADGSLFAAVEHVYPLEQFKEAFKQSLNSNRSGKILFEFVAH* |
| Ga0134070_101585973 | 3300010301 | Grasslands Soil | ADGSLSAAVEHVYPLDQFKEAFEHSLRSSRTGKIIFKFGAIGQR* |
| Ga0134070_103180521 | 3300010301 | Grasslands Soil | SATVDRVYPLDLFKEAFEQSLKPNRSGKILFKFD* |
| Ga0134088_101518222 | 3300010304 | Grasslands Soil | LSAAVDNVYPLEQFKEAFEQSLKSNRRGKILFKFGAHND* |
| Ga0134088_104198161 | 3300010304 | Grasslands Soil | LSATVDRVYPLDLFKEAFEQSLKPNRSGKILFKFD* |
| Ga0134065_101629363 | 3300010326 | Grasslands Soil | EHVYPLEQFKEAFEHSLRSSRNGKILFKFGASEVTT* |
| Ga0134080_105190031 | 3300010333 | Grasslands Soil | VADGWLSAKVDHVYPLDLFKEAFEQSLKPNRSGKILFKFD* |
| Ga0134071_105531113 | 3300010336 | Grasslands Soil | LGDLVADGSLSAAVERTYPLEQFKEAFEQSLKPNRGGKILFKF* |
| Ga0126378_105897353 | 3300010361 | Tropical Forest Soil | VADGSLSAAVEQVYPLDQFKKAYEHSLKSNRGGKILFKLDAH* |
| Ga0126379_121034652 | 3300010366 | Tropical Forest Soil | GSLSAAVERAYPLHQFKQAIDRSLKSNRNGKILLKFKAD* |
| Ga0126381_1049546351 | 3300010376 | Tropical Forest Soil | KLGDLVADGSLSAAVEQVYPLEQFKKAFEQSLKPNRGGKILFKFGASDEVSASK* |
| Ga0136449_1026683841 | 3300010379 | Peatlands Soil | VADGSLSAAVEHVYPLEQFKDAFEQSLKSNRSGKILFKFGATD* |
| Ga0134124_118061571 | 3300010397 | Terrestrial Soil | YRKLGDLVADGSLSASVEHVYPLDQFKEAFEHSLRPSRNGKILFKFGAIGHR* |
| Ga0134124_128437441 | 3300010397 | Terrestrial Soil | DLVADGSLSATVEQVYPLEQFKEAFKQSLNSNRSGKILFGFGAH* |
| Ga0134127_118890831 | 3300010399 | Terrestrial Soil | GSLSAAVEHVYPLEQFKEAFEHSLRPSRNGKILFKFGASEVAT* |
| Ga0134123_135875811 | 3300010403 | Terrestrial Soil | VQEIYRKLGDLVADGSLSASVEHVYSLDQFKEAFEHSLRPSRNGKILFKFGAIGHR* |
| Ga0105246_115657611 | 3300011119 | Miscanthus Rhizosphere | VADGSLSAVVETVYALEQFKEAFDQSLKSNRGGKILFKFGATHS* |
| Ga0150983_153808521 | 3300011120 | Forest Soil | MANGPLSAAVEHVYTLDQFKQAICRSLKSNRNGKILFKFDAD* |
| Ga0137392_104933712 | 3300011269 | Vadose Zone Soil | DGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFVSY* |
| Ga0137391_101039044 | 3300011270 | Vadose Zone Soil | LVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFVSY* |
| Ga0137391_104793993 | 3300011270 | Vadose Zone Soil | ADGSLSATVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGGYEK* |
| Ga0137391_105735023 | 3300011270 | Vadose Zone Soil | LVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFVDY* |
| Ga0137393_107607193 | 3300011271 | Vadose Zone Soil | SAAVEHVYPLEQFQEAFAHSLQSHRSGKILFKFAAIDR* |
| Ga0137393_109880411 | 3300011271 | Vadose Zone Soil | QKLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSSRSGKILFKF* |
| Ga0137389_103611281 | 3300012096 | Vadose Zone Soil | LSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKF* |
| Ga0137389_107457453 | 3300012096 | Vadose Zone Soil | LGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGADGSTLASR* |
| Ga0137389_112861071 | 3300012096 | Vadose Zone Soil | AVEHVYPLDQFKEAFKQSLQSNRSGKILFKFGAN* |
| Ga0137388_101822921 | 3300012189 | Vadose Zone Soil | LVADGSLSAAVEHVYPLDQFKEAFKQSLQSNRSGKILFKFGATDQTDRG* |
| Ga0137388_105587621 | 3300012189 | Vadose Zone Soil | QKLGDLVADGSLSAAVEHVYPLDQFKEAFQQSLKSNRSGKILFQFGATDVAGISK* |
| Ga0137388_109990402 | 3300012189 | Vadose Zone Soil | LSAAVEHVYPLEQFKEALKQSLKSNRSGKILFKFGG* |
| Ga0137388_110520901 | 3300012189 | Vadose Zone Soil | AVEHVYPLEQFKQAFEHSLRSSRNGKILFQFDASEVRA* |
| Ga0137388_113500881 | 3300012189 | Vadose Zone Soil | AAVEHVYPLEQFKEAFEHSLQPHRSGKILFQFGAH* |
| Ga0137382_108850592 | 3300012200 | Vadose Zone Soil | ADGSLSAAVEHVYPLEQFKEAFGQSLKSNRSGKILFKFSA* |
| Ga0137363_103920443 | 3300012202 | Vadose Zone Soil | GDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFVGY* |
| Ga0137363_107900793 | 3300012202 | Vadose Zone Soil | SAAVEHVYPLEQFKEAFKQSLKSNRTGKILFRFSGH* |
| Ga0137363_111909842 | 3300012202 | Vadose Zone Soil | RWLLSAAVEHVYLLDQFKQAIDRSLKSNRNGKILFRFDY* |
| Ga0137363_112281751 | 3300012202 | Vadose Zone Soil | SLFAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKF* |
| Ga0137363_115011421 | 3300012202 | Vadose Zone Soil | LGDLIADGSLSAAVEHVYPLEQFKEAFEQSLKSNRSGKILFKFGATDRTDLKA* |
| Ga0137363_118131241 | 3300012202 | Vadose Zone Soil | LVADGSLSAAVEHVYPLEQFKEAFEQSLRSNRSGKVLFGNGRNRAE* |
| Ga0137399_114203221 | 3300012203 | Vadose Zone Soil | EVQEIYQKLGDLVVDGSLSAAVEHVYLLEQFREAFEQSLRSSRNGKILFKFGAAE* |
| Ga0137362_109019671 | 3300012205 | Vadose Zone Soil | DGSLSAVVEQVYPLDQFKEAFKQSLKPNRSGKILFKF* |
| Ga0137362_109806621 | 3300012205 | Vadose Zone Soil | QEIYQKLGDLVADGSLSAAVEHVYTLDQFKEAFKQSLKSNRSGKILFKFGAH* |
| Ga0137362_112701122 | 3300012205 | Vadose Zone Soil | LGDLVADRSLSAAVEHVYPLAQFKEAFRQSLKSNRSGKILFKFGATDVISK* |
| Ga0137376_114799502 | 3300012208 | Vadose Zone Soil | KLGDLVTDGSLSAAVEHVYPLEQFKEAFGQSLKSNRSGKILFKFSA* |
| Ga0137379_118260231 | 3300012209 | Vadose Zone Soil | IYQKLGDLVADGSLSAAVEHVYPLDQFKEAFEQSLKSNRSGKILFKFGAH* |
| Ga0137378_106232031 | 3300012210 | Vadose Zone Soil | KLGDLVADGSLCAAVEHVYPLDQFKEAIKRSLRSNRGGKILFQFGAH* |
| Ga0137377_112636051 | 3300012211 | Vadose Zone Soil | ADGSLSAAVEHVYPLDQFKEEFEQSLKSHRSGKILFKFSA* |
| Ga0137377_113604572 | 3300012211 | Vadose Zone Soil | GSLSATVEHLYPLDQFKEAFKHSLKSNRSGKILFQFGGH* |
| Ga0137370_100347751 | 3300012285 | Vadose Zone Soil | LVTDGSLSATVEHVHPLDQFKEAFEQSLKPNRGGKILFKFSA* |
| Ga0137387_102047633 | 3300012349 | Vadose Zone Soil | GSLSAAVEQVYPLEQFKEAFEHSLRPSRNGKILFKFGAIGHR* |
| Ga0137385_107048461 | 3300012359 | Vadose Zone Soil | LSAAVEHVYQLAQFKEAFTQSLKSNRSGKILFQFGATDQTDRG* |
| Ga0137360_104316163 | 3300012361 | Vadose Zone Soil | DGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFVGY* |
| Ga0137360_107297012 | 3300012361 | Vadose Zone Soil | GDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGATDQTDRG* |
| Ga0137360_110985131 | 3300012361 | Vadose Zone Soil | TYQELGDLIADGSLSAAIESVYPLEEFKEAFEEALRWNRKGKVLFKFNNQE* |
| Ga0137361_119434542 | 3300012362 | Vadose Zone Soil | GDLVADGSLSAAVEHVYPLEQFKEAFEQSLRSNRSGKVLFGNGRNRAE* |
| Ga0137390_118796892 | 3300012363 | Vadose Zone Soil | YQKLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLQSNRSGKILFKFGATDVAMISK* |
| Ga0137358_100027291 | 3300012582 | Vadose Zone Soil | LSAEVEHVYPLERFKEAFEQSLKSNRSGKILFKFGAH* |
| Ga0137398_105031541 | 3300012683 | Vadose Zone Soil | QEIYQKLGDLVADGSLSAAVEHLYPLEQFKEAFEQSLKPNRSGKILFKLVAR* |
| Ga0137398_107788591 | 3300012683 | Vadose Zone Soil | KLGDLVADGSLSAAVEHVYPLNQFKEAFKQSLKSNRSGKILFKFDASDVAMFSK* |
| Ga0137398_109246061 | 3300012683 | Vadose Zone Soil | RTEIKEIYQKLGDLVADGSLSAAVEHVYPLNQFKEAFKQSLKSNRSGNVLFKFGASDMTMIPK* |
| Ga0137397_113553841 | 3300012685 | Vadose Zone Soil | AAVEHVYPLAQFKEAFEQSLKSNRSGKVLFKFGAHG* |
| Ga0137395_100136738 | 3300012917 | Vadose Zone Soil | VADGSLSAAVEHVYPLDEFKEAFKQSLQSNRSGKILFKFGANDVAMISK* |
| Ga0137395_106937951 | 3300012917 | Vadose Zone Soil | DLVADGSLSAVVEHVYPLDQFKEAFKQSLLSNRSGKILFKFGATDVAMISK* |
| Ga0137395_107964741 | 3300012917 | Vadose Zone Soil | QKLGALVADGSLSAAVEHVYPLEQFKEAFEHSLRPRRNGKILFKFDAIGHR* |
| Ga0137396_108721302 | 3300012918 | Vadose Zone Soil | GSLSATVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGVTDMAGISKV* |
| Ga0137396_111907611 | 3300012918 | Vadose Zone Soil | GSLSATVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGVTDRAGISKA* |
| Ga0137394_103596711 | 3300012922 | Vadose Zone Soil | KLGDLVADGSLSAAVDHVYRLDQFKEAFEQSLKPNRSGKILFKFGRN* |
| Ga0137359_100618654 | 3300012923 | Vadose Zone Soil | ADGSLSAAVEHVYPLDQFKEAFEQSLKSNRSGKILFKFGAH* |
| Ga0137359_103461861 | 3300012923 | Vadose Zone Soil | DGSLSAAVERVYPLEQFKEAFEQSLKSTRDGKILFKFGAH* |
| Ga0137359_107202772 | 3300012923 | Vadose Zone Soil | YQKLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKF* |
| Ga0137413_114667921 | 3300012924 | Vadose Zone Soil | ADFVADGSLSAAVEQRYPLEQFGEAIKQSSQSNRGGKVLFQFGVH* |
| Ga0137419_102588232 | 3300012925 | Vadose Zone Soil | DGSLSAVVEHVYPLDQFKEAFKQSLKSNRSGKILFKF* |
| Ga0137416_103311263 | 3300012927 | Vadose Zone Soil | GDLVADGSLSAAVDRVYPLGQFKEAFEQSLKPNRSGKILFKFSA* |
| Ga0137416_112843132 | 3300012927 | Vadose Zone Soil | LVADGSLSAAVEHVYRLDQFKEAFKQSLKSNRSGKILFKFGTHGSI* |
| Ga0137404_103949061 | 3300012929 | Vadose Zone Soil | EKSLSATVEQVYPLDQFKEAFKQSLKSNRSGKILFEFGAH* |
| Ga0137404_112497592 | 3300012929 | Vadose Zone Soil | ADGSLSAAVEHVYPLDQFKEAFEHSLRPSRNGKIIFKFGASEVTT* |
| Ga0137404_120488793 | 3300012929 | Vadose Zone Soil | VADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGATDAAMISK* |
| Ga0137407_109479422 | 3300012930 | Vadose Zone Soil | DGSLSAAVEHVYPLEQFKEAFEHSLRSSRNGKILFKFDASEVRA* |
| Ga0164303_103895592 | 3300012957 | Soil | VADGSLSAAVEHVYPLEQFKEAFERSWKSQRSGKVLFKLGHH* |
| Ga0164299_101459451 | 3300012958 | Soil | VADGSLSAAVEHVYPLEKFKEALERSLKSQRSGKVLFKLGHH* |
| Ga0134077_101256483 | 3300012972 | Grasslands Soil | LYAAVEHVYPLEQFKEAFTRSLRSHRGGKILFQFGH* |
| Ga0164309_104268321 | 3300012984 | Soil | LEEIYQKLGDLVADRSLSAAVEHVYPLDQFKEAFRQSLKSNRSGKILFKF* |
| Ga0164304_103821461 | 3300012986 | Soil | ADGSLSAVVETVYALEQFKEAFDQFLKSNRSGKILFKFGATHG* |
| Ga0157371_111485573 | 3300013102 | Corn Rhizosphere | LSAVVDSVYALEQFKEAFDPSLKSNRGGKILFKFGATH* |
| Ga0157371_115435711 | 3300013102 | Corn Rhizosphere | VADGSLSAAVEHVYPLEQFKEAFERSLKSQRSGKVLFKL |
| Ga0157378_120527662 | 3300013297 | Miscanthus Rhizosphere | VADGSLSAAVEHGYPLEQFTAAFERSLKSQRSGKVLFKLG |
| Ga0157375_112020942 | 3300013308 | Miscanthus Rhizosphere | GDLVADGSLSAAVEQVYPLEQFQEAFDQSSKSNRSGKILFKFRA* |
| Ga0157375_113766952 | 3300013308 | Miscanthus Rhizosphere | ADGSLSAAVEHVYPLDQFKEAFKQSLQPNRSGKVLFKF* |
| Ga0134079_104025972 | 3300014166 | Grasslands Soil | VYPLEQFKEAFEHSLRPSRNGKILFKFGASEVTT* |
| Ga0157377_106622181 | 3300014745 | Miscanthus Rhizosphere | DLVADGSLSAVVETVYALEQFKEAFDQSLKSKRGGKILFKFGATH* |
| Ga0157379_106892141 | 3300014968 | Switchgrass Rhizosphere | GSLSAAVEHVYPLDQFKEAFEESLKSNRSGKILFKFRA* |
| Ga0137420_12734561 | 3300015054 | Vadose Zone Soil | VADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGPTDQTDRG* |
| Ga0137420_14446051 | 3300015054 | Vadose Zone Soil | VTDGSLSAVVEHVYPLDQFKEAFKQSLKSNRSGKILFKF* |
| Ga0137418_100320944 | 3300015241 | Vadose Zone Soil | FVTDGSLSAVVEHVYPLDQFKEAFKQSLKSNRSGKILFKF* |
| Ga0137403_104074024 | 3300015264 | Vadose Zone Soil | LSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGATDAAMISK* |
| Ga0137403_106694041 | 3300015264 | Vadose Zone Soil | GSLSAAVEHVYPLEQFKEAFEHSLRSSRNGKILFKFGA* |
| Ga0132258_109044183 | 3300015371 | Arabidopsis Rhizosphere | GSLSAQVEHVYPLEEFKDAFKQSLKSNRSGKILFEIGAH* |
| Ga0132258_120732702 | 3300015371 | Arabidopsis Rhizosphere | VADGSLSAAVEHVYPLEQFKEAFERSLKSQRGGKVLFKLGHH* |
| Ga0132257_1040676411 | 3300015373 | Arabidopsis Rhizosphere | ADGSLSAAVEHVYPLDQFKEAFEQSLKSNRSGKILFRFRA* |
| Ga0182041_105380853 | 3300016294 | Soil | VADGSLSAAVEHVFPLDQFKQAIDRSLKSNRNGKILFKFEAD |
| Ga0182041_113905421 | 3300016294 | Soil | ADGSLFAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGAN |
| Ga0182032_106227722 | 3300016357 | Soil | SLSAAVEHLYPLDQFKEAIDRSLKSTRCGKILFELDSD |
| Ga0182037_103268783 | 3300016404 | Soil | GSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKF |
| Ga0187805_102542202 | 3300018007 | Freshwater Sediment | VADGSLSAAVERVYPLDQFKEAFKQSLKSNRSGKILFQCGATDVAVISK |
| Ga0066662_125003362 | 3300018468 | Grasslands Soil | DGSLSAAVEHVYPLEQFKEAFEQSLKSNRSGKILFKFSA |
| Ga0190270_115453351 | 3300018469 | Soil | LVADGSLSAAVEQVYPLEQFKEAFEHSSRSSRNGKILFKFDASEVRA |
| Ga0066669_107257661 | 3300018482 | Grasslands Soil | SLSAAVEHVYPLGQFKEAFKQSLKSNRSGKILFQFGAGENLADPGL |
| Ga0193715_10633161 | 3300019878 | Soil | GVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGATDVAIISKQPETTTKP |
| Ga0193755_10429802 | 3300020004 | Soil | KLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQLGAADVAVISK |
| Ga0179594_103127961 | 3300020170 | Vadose Zone Soil | DGSLYAAVEHVYPLEQFKEAFTRSLRSHRGGKILFQFGH |
| Ga0179592_104373732 | 3300020199 | Vadose Zone Soil | PRTEIQEIYQKLDDLVADGSLSAAVEHVYPLEQFKEAFEQSLKSNRNGKILFKFGAQ |
| Ga0210407_108549391 | 3300020579 | Soil | ADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGATDVAAISK |
| Ga0210407_114423541 | 3300020579 | Soil | VADGSLSAVVEHVYPLNQFKEAIQQSLKSNRSGKVLFKF |
| Ga0210403_102951484 | 3300020580 | Soil | LVADGSLSSAVEHVYPLDQFKEAFKQSLKSNRSGKILFKF |
| Ga0210403_107531302 | 3300020580 | Soil | SLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKIGDNP |
| Ga0210403_109356731 | 3300020580 | Soil | SLSAAVEHVYPLNQFREAFKQSLKSNRRGKILFQFAATHQTERG |
| Ga0210401_104007223 | 3300020583 | Soil | QKLGDLVTDGSLAAAVDHVYPLDQFKEAFKQSLQSNRSGKILFKFGATDVISK |
| Ga0210401_104766752 | 3300020583 | Soil | VADGSLSAAVEHVYPLDQFKEAFRQALKANRNGKILFKF |
| Ga0215015_104351792 | 3300021046 | Soil | SASSYVYKRQGSLSAAVEHVYPLDQFKEAFKQSLKSNRGGKVLFQFGATDVAAISK |
| Ga0215015_108988993 | 3300021046 | Soil | ADLVAGGSLSDAVEHLYPLEQFREAFEQSLKSNRDGKLLFIFGAR |
| Ga0179596_104138702 | 3300021086 | Vadose Zone Soil | GDLVADGSLSATVEHVYALDQFKEAFKQSLKSNRSGKILFKF |
| Ga0210404_103451641 | 3300021088 | Soil | GDLVEDGSLSATVEHVYPLDQFKEAFKQSLKSNRSGKILFKF |
| Ga0179584_10999151 | 3300021151 | Vadose Zone Soil | LSAAVEQVYPLEQFKEAFEQSLKPNRSGKILFKFSA |
| Ga0210406_103296731 | 3300021168 | Soil | ADGSLSAVVEHVYPLEQFKEAIQQSLKSNRSGKILFKF |
| Ga0210400_105131001 | 3300021170 | Soil | GDLVADGSLSASVEHVYPLDQFKEAFKQSLKSNRTGKILFKF |
| Ga0210400_107598291 | 3300021170 | Soil | LVADGSLSAAVEQVYPLYQFKEAFKQSLRSNRSGKILFQFGATDQTDRG |
| Ga0210405_109229494 | 3300021171 | Soil | AVEHAYPLDEFKEAFKQSLKSNRSGKIVFKFGVTDVARISKQAETTTTKP |
| Ga0210408_102649561 | 3300021178 | Soil | KLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLQSNRSGKILFKFGGNDWR |
| Ga0210396_110197801 | 3300021180 | Soil | KLGDLVADGSLSALVEHVYPLDQFKEAIQQSLKSNRSGKILFKF |
| Ga0193719_102204241 | 3300021344 | Soil | GSLSATVDHVYPLDLFKEAFEQSLKPNRSGKILFKFDELVKGGK |
| Ga0210385_113237351 | 3300021402 | Soil | KLGDLVADGSLSAAVEQVYPLYQFKEAFKQSLRSNRSGKILFQFGATDQTDRG |
| Ga0210385_113334811 | 3300021402 | Soil | KLGDLVADGSLSAAVEHVYPLDQFKEAFRQALKANRNGKILFKF |
| Ga0210387_109471691 | 3300021405 | Soil | LVADGSLSAVVEHVFPLEQFKEAIQQSLKSNRSGKVLFKF |
| Ga0193709_11100362 | 3300021411 | Soil | GDLVADGSLSAEVEHVYPLDQFKEAFEQSLKPNRGGKILFKFSA |
| Ga0210394_103931651 | 3300021420 | Soil | VADGSLSAAVEHVYPLYQFKEAFKQSLRSNRSGKILFQFGATDQTDRG |
| Ga0210394_109369512 | 3300021420 | Soil | DGSLSALVEHVYPLDQFKEAIQQSLKSNRSGKILFKF |
| Ga0210384_108186461 | 3300021432 | Soil | DGSLSAAVEHVYSLDQFKEAFKQSLKSNRSGKILFKF |
| Ga0210384_111585442 | 3300021432 | Soil | KLGDLVADGSLSAAVEHVYPLYQFKEAFKQSLKSNRSGKILFQFGATDQTDRG |
| Ga0210384_111927481 | 3300021432 | Soil | DLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGATDVAAISK |
| Ga0210402_106027703 | 3300021478 | Soil | LGDLVADGSLSAVVEHVYPLEQFKEAIQQSLKSNRSGKILFKF |
| Ga0210410_112222872 | 3300021479 | Soil | VAEGSLSAAVEHVYPLDQFKEAFKQSLKSNRTGKILFKF |
| Ga0210410_112269131 | 3300021479 | Soil | DGSLSAAVEHVYPLDQFKEAFRQSLKSNRSGKILFKF |
| Ga0179589_105288052 | 3300024288 | Vadose Zone Soil | DLVADGSLSAEVEHVYPLDQFKEAFKQSLKSNRRGKILFKFGATDVISK |
| Ga0247668_10909302 | 3300024331 | Soil | ADGSLYAAVEHVYPLEQFKEAFEHSLRSSRNGKILFKFGASEVTT |
| Ga0207697_102398082 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | ADGSLSAAVEHVYPLEQFKEAFEQSLKSNRSGKILFRFSN |
| Ga0207692_105220811 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLVADGSLSAAVEHVYPLEQFKEAFEQSLKSNRSGKILFKF |
| Ga0207692_107595561 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | QKLGDLVADGSLSAAVEHVYPLAHFREAFRQSLKSNRSGKILFQFRVTDDTDRG |
| Ga0207680_102077492 | 3300025903 | Switchgrass Rhizosphere | SLSAAVEHVYPLEQFKEAFEHSLKSQRSGKVLFKLGHH |
| Ga0207684_103566091 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LGDLVADGSLTAAVEHVYPLEQFKEAFTRSLRSHRGGKILFQFGH |
| Ga0207684_104659213 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ADGSLSAAVEHEYPLEQFKEAFEHSLRPSRNGKILFKFGASEVTT |
| Ga0207684_104968471 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ADGSLSAAVEQVYSLEQFKEAIKHSLTSNRSGKILFKFGATDR |
| Ga0207671_101725831 | 3300025914 | Corn Rhizosphere | VADGSLSAAVEHVYPLEQFKEAFERSLKSQRGGKVLFKLGHH |
| Ga0207671_111127791 | 3300025914 | Corn Rhizosphere | DLVADGSLSAAVEHVYPLERFKEAFEQSLKPNRGGKILFKF |
| Ga0207646_103055734 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EIYQKLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGATDVAGISK |
| Ga0207646_106126391 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MERSLLAVEQVYPLEQFKEGFEQSLKSNRSGKILFKFGPTA |
| Ga0207646_110792471 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MYQRLGDLVTDGSLSAAVAQVYPLEQFKEAIKHSLTSNRSGKILFKFGATDR |
| Ga0207664_110122641 | 3300025929 | Agricultural Soil | LVADGSLSAAVEHVYPLDQFKEAFEQSLKSNRSGKILFKFSA |
| Ga0207706_102545974 | 3300025933 | Corn Rhizosphere | VADGSLSAVVETVYALEQFKEAFDQSLKSKRGGKILFKFGATH |
| Ga0207709_104334421 | 3300025935 | Miscanthus Rhizosphere | DGSLSAAVEHVYPLDQFKEAFEESLKSNRSGKILFKFRA |
| Ga0207665_106818791 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LVADGSLSAAVERVYPLDQFKEAFKQSLKSNHSGKILFRLGATDAAVISK |
| Ga0207651_107148981 | 3300025960 | Switchgrass Rhizosphere | LVADGSLSAAVEHVYPLEQFKEAFERSLKSQRSGKVLFKLGHH |
| Ga0207641_105153663 | 3300026088 | Switchgrass Rhizosphere | LVADGSLSAAVEHVYPLDQFKEAFEESLKSNRSGKILFKFRA |
| Ga0209234_10838791 | 3300026295 | Grasslands Soil | SLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFVDY |
| Ga0209234_11964562 | 3300026295 | Grasslands Soil | GSLSAAVEHVYPLDEFKEAFRQSLKSNRSGKILFQFGATDQTDRG |
| Ga0209237_12132752 | 3300026297 | Grasslands Soil | NLGDLVADGSLSAAVEHVYPLAQFKEAFRQSLKSNRSGKILFQFGATDQTDRG |
| Ga0209236_10644803 | 3300026298 | Grasslands Soil | LGDLVADGSLSAAVEHVYPLEQFKEAFRQSLKPNRSGKILFRFGAH |
| Ga0209027_10825941 | 3300026300 | Grasslands Soil | SFSAAVEHVYPLDQFKEAFEQSLKPNRGGKILFKFSA |
| Ga0209471_10655751 | 3300026318 | Soil | LGDLVANGSLSAAVEHTYPLDQYKEAFKQSLKSNRSGKILFKFGASDMTLIPK |
| Ga0209687_12631842 | 3300026322 | Soil | DLVANGSLSAAVEHTYPLDQYKEAFKQSLKSNRSGKILFKFGSTDVAMISK |
| Ga0209152_101585632 | 3300026325 | Soil | VADGSLSAGVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGATDGAVISKA |
| Ga0209801_12039042 | 3300026326 | Soil | VADGSLSAAVEHVYRLDQFKEAFKQSLKSNRSGKILFKFGTHGSI |
| Ga0209802_12797432 | 3300026328 | Soil | LGDLVADGSLYAAVEHVYPLDQFKEAIKRSLRSNRGGKILFQFGAH |
| Ga0209473_10092959 | 3300026330 | Soil | QKLGDLVVDGSLSAAVEHVYPLEQFKEAFRQSLKSNRSGKILFKFSA |
| Ga0209803_10302391 | 3300026332 | Soil | DLVADGSLSAAVEHVYPLDQYKEAFKQSLKSNRSGKILFKFGASDMTMIPK |
| Ga0209158_13365621 | 3300026333 | Soil | KLGDLVADGSLSAAVEYVYPLDQFKEAFKQSLQSNRSGKILFKFGATDVISK |
| Ga0209804_11143091 | 3300026335 | Soil | LVADGSLSAAVEYVYPLDQFKEAFKQSLQSNRSGKILFKFGATDVISK |
| Ga0257173_10268752 | 3300026360 | Soil | ADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGANDVAMISK |
| Ga0257156_10225043 | 3300026498 | Soil | SLSAAVKHVYPLEQFKEAFEQSLKPNRNGKILFKFGATDRTDLKN |
| Ga0257156_10746321 | 3300026498 | Soil | VADGSLSAAVEHVYPLNQFKEAFKQSLKSNRSGKILFQFAATDQTDRG |
| Ga0209690_10163041 | 3300026524 | Soil | QKLGDLVADGSLYAAVEHVYPLEQFKEAFTRSLRSHRGGKILFQFGH |
| Ga0209474_107776751 | 3300026550 | Soil | ADGSLSAAVEHVYPLEQFKEAFEQSLKSNRSGKILFKFGATE |
| Ga0209325_10201402 | 3300027050 | Forest Soil | LVADGSLSAAVERLYPLDQFKEAFKQSLKSNHSGKILFRLGATDAAVISK |
| Ga0209214_10262611 | 3300027071 | Forest Soil | VADGSLSAAVEHDYPLDQFKEAFKQSLKSNHSGKILFRLGATDAAVISK |
| Ga0209004_10673171 | 3300027376 | Forest Soil | VADGSLSAAVDRVYPLDQFKEAFKQSLKSSRSGKILFKFGATGVRMISK |
| Ga0209622_10046673 | 3300027502 | Forest Soil | DLVADGSLSAAVEHVYPLNQFQEAFKQSLQSNRSGKILFKFGATDVISK |
| Ga0208984_10913351 | 3300027546 | Forest Soil | DGSLSATVDHVYPLDQFKEAFKESLKSNRSGKILFKFGATDVAVISK |
| Ga0209735_10376191 | 3300027562 | Forest Soil | KLGDLVADGSLSAAVGHVYPLDEFKEAFDQSLKSNRSGKILFKLGGTDVAMISK |
| Ga0209422_10144441 | 3300027629 | Forest Soil | LGTFVADGALSAVVERIYPLEQFKDAIGHAMRSSRGGKILFRFNE |
| Ga0208988_10196921 | 3300027633 | Forest Soil | GSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFEEVAANSK |
| Ga0209117_10552623 | 3300027645 | Forest Soil | VADGSLSAAVEHVYPLGQFKEAFKQSLKSNRSGKILFKFGVPDVAGISK |
| Ga0209217_10710382 | 3300027651 | Forest Soil | DRSLSAAVERVYPLDQFKEAFKQSLKSNHSGKILFRLGATDAAVISK |
| Ga0209656_1000595610 | 3300027812 | Bog Forest Soil | LSAEVEHVYPLERFKEAFEQSLKSNRSGKILFKFGAH |
| Ga0209180_104728302 | 3300027846 | Vadose Zone Soil | LSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFVDY |
| Ga0209701_103497061 | 3300027862 | Vadose Zone Soil | SAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFVDY |
| Ga0209488_106543363 | 3300027903 | Vadose Zone Soil | LGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKF |
| Ga0209488_111415202 | 3300027903 | Vadose Zone Soil | QEIYQKLGDLVADGSLWAAVEHVYPLEQFKEAIKQSVKSNRSGKILFKFGATDR |
| Ga0209382_110540351 | 3300027909 | Populus Rhizosphere | DLVADGSLSAAVEQVYPLEQFKEAFEQSLKSNRSGKILFKFGAADKAMISK |
| Ga0209526_107182162 | 3300028047 | Forest Soil | QKLGDLVADGSLSAAVEQVYPLYQFKEAFKQSLRSNRSGKILFQFGATDQTDRG |
| Ga0268265_116975571 | 3300028380 | Switchgrass Rhizosphere | VEHVYPFEQFKEAFEHSLRPSRNGKILFKFGASEVTS |
| Ga0268265_121886161 | 3300028380 | Switchgrass Rhizosphere | VVDSVYALEQFKEAFDQSLKSNRGGKILFKFGATH |
| Ga0137415_105763661 | 3300028536 | Vadose Zone Soil | VEHVYALDQFKEAFEHSLISSRTGKIIFKFGAIGQR |
| Ga0247820_113116351 | 3300028597 | Soil | VVETVYALEQFKEAFDQSLRSNRGGKILFKFAATHDDR |
| Ga0307282_106779401 | 3300028784 | Soil | ADGSLSAAVEHVYPLDQFKEAFEQSLKSNRSGKILFKFSA |
| Ga0307290_103210481 | 3300028791 | Soil | GDLVADGSLSAVVETVYALEQFKEAFDQSLKSNRGGKILFKFGATH |
| Ga0222749_102488302 | 3300029636 | Soil | GDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFSVNDVARSSN |
| Ga0170834_1031664981 | 3300031057 | Forest Soil | ADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGPSDVISR |
| Ga0170834_1053862462 | 3300031057 | Forest Soil | QKLGDLVTDGSLSAAVEHVYPLDQFKEAFKQSLKPNRSGKILFKF |
| Ga0170834_1139794141 | 3300031057 | Forest Soil | VADGSLSAAVEHVYPLYQFKEAFKQSLKSNRSGKILFQFGASENLVDAGL |
| Ga0170822_159526852 | 3300031122 | Forest Soil | GSLSAEVEHVYPLDQFKEAFKRSLKSNRSGKILFQFGANENLADPGL |
| Ga0170824_1036955102 | 3300031231 | Forest Soil | DGSLSAAVEHVYPLEQFKEAFQQSLKSNRSGKILFKF |
| Ga0170824_1060105312 | 3300031231 | Forest Soil | ADGSLSAAVEKVYPLEQFKEVFEQSLKANRGGKILFKF |
| Ga0307469_101280563 | 3300031720 | Hardwood Forest Soil | LVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGADGSTLASR |
| Ga0307468_1009350982 | 3300031740 | Hardwood Forest Soil | VAAGTLSTAVEHVYPLDQFKDAFEHSLNPNRSGKILFEFGSDGDTTQRSGATAF |
| Ga0307477_107699191 | 3300031753 | Hardwood Forest Soil | LGDLVADGSLSAAVEHVYPLDQFKEAFRQSLKSNRSGKILFKF |
| Ga0307473_106472561 | 3300031820 | Hardwood Forest Soil | GDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGVTDVAGTSK |
| Ga0307473_107688452 | 3300031820 | Hardwood Forest Soil | IYQKLGDLVADGSLSAEVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGATDQPDRG |
| Ga0307473_115741411 | 3300031820 | Hardwood Forest Soil | NGSLFAAVDHVYALDEFKEAFKQSLKSNRSGKVLFKFA |
| Ga0310900_112886671 | 3300031908 | Soil | VADGSLSAAVEHVYPLEQFKEAFERSLKSQRSGKVL |
| Ga0306921_116942391 | 3300031912 | Soil | QELYQKLADLVADGSLSAAVEHLYPLDQFKEAIDRSLKSTRNGKILFKLDSD |
| Ga0310916_114041111 | 3300031942 | Soil | SLSATVEHVYPLDQFKQAIDRSLKSNRRGKILFKSDIN |
| Ga0310885_105266242 | 3300031943 | Soil | QKLGELVADGSLSAAVEHVYPLDQFKEAFEESLKSNRSGKVLFKFRA |
| Ga0307479_100316777 | 3300031962 | Hardwood Forest Soil | GDLVADGPLSAAVEQVYPLDQFKEAFKQSLKPNRSGKILFKFGATGVARTSK |
| Ga0307479_110500952 | 3300031962 | Hardwood Forest Soil | YQKLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKFGSDGSTLASH |
| Ga0307479_117108042 | 3300031962 | Hardwood Forest Soil | IYQKLGDLVADGSLSAAVEHVYPLDQFKEAFKQSLKPNRSGKILFKFGATDVAGTSK |
| Ga0318533_101479833 | 3300032059 | Soil | SLFAAVEHVYPLDQFKEAFKQSLKSNRSGKILFQFGAN |
| Ga0307470_113637162 | 3300032174 | Hardwood Forest Soil | GDLVAQGSLSAAVEHVYPLDHFKDAFEHSVKPNRSGKILFEFGAR |
| Ga0307470_115205991 | 3300032174 | Hardwood Forest Soil | SAAVEHVYPLEQFKEAFEQALRPNRSGKILFKFGA |
| Ga0307471_1017629251 | 3300032180 | Hardwood Forest Soil | LVAGGALSAAVEHVYPLDQFKEAFKQSLQSNRSGKILFKFGANDVAMISK |
| Ga0307471_1021762752 | 3300032180 | Hardwood Forest Soil | DGSLCASVEHVYALDQFKEAFKQSLKSNRSGKILFKF |
| Ga0307471_1027047743 | 3300032180 | Hardwood Forest Soil | IYQKLGDLVADGSLSAAVQHVYPLDQFKDAFKQSLKSNRSGKILFKF |
| Ga0307471_1031727111 | 3300032180 | Hardwood Forest Soil | PRTDIQEVYRKLGDLVAEGSLSAALEHVYPLDHYKEALEQSLTSSRDGKILFKFGAH |
| Ga0307472_1002264892 | 3300032205 | Hardwood Forest Soil | GDLVADGSLSAAVEHVYPLDQFKEAFKQSLKSNRSGKILFKF |
| Ga0307472_1019943872 | 3300032205 | Hardwood Forest Soil | LGDLVADGSLSAAVERVYPLEQFKEAFEQSLKSNRDGKILFKFGAH |
| Ga0307472_1022873271 | 3300032205 | Hardwood Forest Soil | DGSLWAAVEHVYPLEQFKEAIKQSVKSQRSGKILFKFGATDR |
| Ga0306920_1041910362 | 3300032261 | Soil | IYQKLGNLVADGSLSAAVEQVYPLEQFKEAFEQSLKPNRSGKILFKFSA |
| Ga0348332_109753272 | 3300032515 | Plant Litter | LVADGSLSAAVEHVYTLDQFKEAFKQSLKSNRSGKILFKFGATDVISK |
| ⦗Top⦘ |